ELF>m@H&@8 @0I0IPPP  $ % %Q1&%&%& $$Std Ptd!!!dKdKQtdRtd$ % % " "GNUGNU. MŚ[em?D $Q!x`|<ҤB^??Rh T l|<  8 _F B   l  `mh Y e -d  Z ru  P 6 K  w$ 4X[ " 8\  n) ,  $?F" {QU\  @ sB 4h ` 1 M : f# _S "  @s]5 j! + 0S 0   GMA A+ x g]}{  < B 04D&l+     "('N SIwTya L L  +Se Un 0  5} @ M 4  Pc__gmon_start___ITM_deregisterTMCloneTable_ITM_registerTMCloneTable__cxa_finalizestrrchr__stack_chk_failstrlenstrncmpstrcmplstat64__isoc99_sscanffopen64strstr__getdelimfclose__errno_locationstrerrorusleepmemcpystrdupdm_event_handler_createdm_event_handler_set_dmeventd_pathdm_event_handler_set_dsodm_event_handler_set_uuiddm_event_handler_set_timeoutdm_event_handler_set_event_maskdm_event_handler_destroymemccpydm_event_get_registered_devicedm_event_handler_get_event_maskdm_event_handler_get_dso__assert_failstrncpycallocstrcasecmpmemset__ctype_b_locgetenvctime_rcloselogopenlogunamefcntl64stdinselabel_closepthread_mutex_lockpthread_mutex_unlockstdoutsetlinebufgetpagesizeio_destroyio_submitio_geteventsmalloclseek64strchrfputc__fprintf_chkstrspnstrcspnmemmove__ctype_toupper_locstrtodstrtollfgetsumasksd_id128_get_machine_app_specificopendirreaddir64closediralphasort64scandir64setlocaleudev_enumerate_newudev_enumerate_add_match_subsystemudev_enumerate_scan_devicesudev_enumerate_get_list_entryudev_list_entry_get_nameudev_device_new_from_syspathudev_device_get_devnodeudev_device_get_devlinks_list_entryudev_list_entry_get_nextudev_device_unrefudev_enumerate_unrefmkdirlocaltimestrftimerename__snprintf_chk__memcpy_chk__sprintf_chk__ctype_tolower_locmemcmpunlinkctimegetpidfputsfflushfilenofsyncstrtouldirfdversionsort64unlinkatflockstrtoludev_device_new_from_devnumudev_device_get_is_initializedreadlinkioctludev_device_get_property_valuedirname__xpg_basenameblkid_new_probe_from_filenameblkid_probe_enable_superblocksblkid_probe_set_superblocks_flagsblkid_do_safeprobeblkid_probe_lookup_valueblkid_free_probestrtoullblkid_probe_enable_partitionsblkid_probe_set_partitions_flagsblkid_do_probeblkid_probe_step_backnvme_get_nsidposix_memalignnvme_identifysnprintfsetmntentgetmntentendmntentreallocferror__vfprintf_chk__vsnprintf_chkgetcstderrfeoffwriteaccessfdopenrand_r__strncpy_chk__vsyslog_chksd_journal_printv_with_locationabortfstat64io_setupsysconfdup2qsortgetrlimit64mallinfo2mlockallmlockmunlockallmunlockstrncasecmplocaltime_rmktimesysinfowaitpidsigprocmasksigactionsigaddsetsigismembersigdelsetudev_newudev_queue_newudev_queue_get_udev_is_activeudev_queue_unrefudev_unrefgetprioritysetpriorityforkwait4execvplockf64sd_bus_open_systemsd_bus_call_methodsd_bus_message_readsd_bus_error_freesd_bus_message_unrefsd_bus_flush_close_unrefsd_bus_error_has_namememchrsymlinkrmdirputchar__printf_chkoptargoptindgetopt_longnanosleepsetsidlvm2_disable_dmeventd_monitoringlvm2_log_levellvm2_log_fnlvm2_exitlvm2_initlvm2_runsetenvsd_journal_send_with_locationlvm2_init_threaded__fdelt_chkselectmknodgeteuidclock_gettime__isoc99_fscanfsemctlsemgetsemopgmtime_rrewind__open64_2strndupmalloptsyscallsetvbufnl_langinfotmpfile64pipesigfillsetgethostnameprlimit64dm_event_unregister_handlerdm_event_register_handlerstrcpyisspacesocketconnectselabel_lookupsetfscreateconfreeconis_selinux_enabledselabel_openchownlibdevmapper-event.so.1.02libdevmapper.so.1.02libsystemd.so.0libblkid.so.1libnvme.so.1libaio.so.1libselinux.so.1libudev.so.1libc.so.6liblvm2cmd.so.2.03BaseLIBNVME_1_0LIBAIO_0.4LIBAIO_0.1LIBSELINUX_1.0LIBSYSTEMD_222LIBSYSTEMD_233LIBSYSTEMD_221LIBSYSTEMD_209LIBUDEV_183BLKID_2.23BLKID_2.17BLKID_2.15GLIBC_2.15GLIBC_2.13GLIBC_2.14GLIBC_2.4GLIBC_2.28GLIBC_2.33GLIBC_2.3GLIBC_2.17GLIBC_2.7GLIBC_2.3.4GLIBC_2.2.5                       K   0t0 q0     H   x Pb b. b= bL   #[  @A g A r A }     ii    ii  ii ti ui  %  %} %~ %`|%%(%p%¸%h%%%0%H%x%%' %%% %Q8P%h%–% %4(%8@%hp%`%%%0%%'H%`%x%%0% %H%%%0 %8%P%Bh%%&%:%8%:%@%x%GX%Q%%n%Z %P%4%q%H0%`%x%%%%%% %8%!P%h%q% #%%&%%.%'(%@%GX%()p%O%G%@.%%8%:%]%@ %H%g`%%y% %/ %P%`0h%%(1%%2%%(%2@%p%3%%%5%%7%.H%08`%A%9%X%H:%I %=8%8>h%X>%q%h@%% A%X%%HE%%E%%XF0%H`%Hx%%@K%%K%8%NP%&p%7%O%Q%Q%HU %pU( %RX %Up %V %W %j %o! %PW %!%0!%WH!%`!%o!x!%@X!%!%xY!%"%0Z "%P"%Zh"%"%@"%["%"%0]"%](#%^@#%p#%P^#%#%_#%,#%!$%_$%?0$%[H$%``$%c$%b$%q$%$%Xb$% %%c8%%h%%d%%%%d%%%% %%e&%@&%XfX&%&%f&% &%g&%!'%i0'%;`'%Xix'%P'%i'%i'%j(%z8(%jP(%(%`k(%(%l(%)% m()%X)%mp)%)%n)%)%p*%*%0*%qH*% x*%t*%*%w*%+%`w +%.8+%?P+%P{h+%K+%{+%x|+%\+%}+%0}+%1f(,%x@,%rp,%,%y,%x,%;-%-%H-%`-%-%-%-%ȃ-% .%x8.%h.%.%r.%8.%.%–.%/%X/%p/%H/%/%/%/%/%0%0%P00%' `0%x0%0%`0%0% 0%|0%x1% 1%(1% 81%؉P1%1%01%1%X1%2%(2%*X2%p2%02%02%52%X2%3%;03%ȋH3%Ox3%،3%–3%3%V 4%e84%h4%g4%x4%5%5%(5%@5%X5%`5%p5%5%5%6%6%`6% 6%$6%06%>6%6%Q 7%87%hh7%X7%t7%7%7%8%PX8%8%x8%8%8%8%8%9%09%H9%/P9%6`9%x9%O9%9%f9%9%X9%:%(:%8:%P:%:%:%;%(;%X;%p;%;%;%;%P<% 0<%H<% `<%x<%<%8<%N<%c<%P<%t<%<%=% =%8=%@=%P=%h=%=%=%=%=%.=%x=%=%A>%U(>%@>%XX>%Up>%>%m>%0>%?%?%0?%8?%H?%p`?%x?%?%?%?%?%/?%F?%?%Y@%r@% @%8@%P@%xh@%@%@%U@%0@%@%U@%hA%(A%0A%@A%XA%pA%UA%A%*A%XA%@B%QB%aB%H0B%nHB%Z `B%xB%B%B%'B% C%(C%8C%PC%C%C%C%pC%D%(D%XD%pD%D%D%D%E% E%ˀ0E%HE%"xE%8E%4E%E%CF% F%SPF%PhF%tF%F%dF%F%(G%@G%hG%pG%HG%G%G%H%H%0H%HH%`H%xH%H%H%H%@6H%H%I% I%P8I%&PI%36`I%hI%@I%AI%I%_I%hJ%@J%XJ%{J%J%J%@J%K%(0K%`K%hxK%K%K%K%L%8L%@PL%L%L%!L%1L%hL%?M%p(M%:XM%pM%OM%`M%eM%N%x0N%HN%xN%N%N%XN%N%O% O%PO%hO%{YO%O%@P%P%P%&Q%@`Q%xQ% Q%PQ%Q%Q%R% R%8 8R%3hR% R%;R% R%DR% S%W(S%q@S% XS%MpS%jS% S%aS%(S%jT%`0T%q`T%xT%T%T%T%T%U% U%8U%p!PU%hU%!U%("U%U%!U%"U%U%V%(#(V% @V%#XV%$pV%V%x$V%@%V%'V%0V%%W%8W%(&0W%h&HW%A`W%&xW%0'W%RW%[W%'W%cW%(X%H( X%l8X%(PX%(hX%X%}X%h)X%X%)X%(*X%Y%*(Y%*@Y%XY%pY%x+Y%Y%,Y%x+Y%Y%H,Z%,Z%0Z%HZ%X-`Z%xZ%Z%-Z%Z%Z%H.Z%[%' [%.8[%P[%Ah[%H/[%Q[%0[%/[%_[%[[%H0\%m(\%@\%0X\%{p\%\%H1\%}\%\%1\%]%p20]%`]%2x]%]%3]%@3]%]%h4^% ^%48^%4P^% h^%5^%5^%e^%^%6^%4^%@_%8(_%|@_%X_%9p_%g_%^_%q_%8:_%_%`:`%J0`%:H`%x`%`=`%`%@>`%a%? a%Pa%XAa% a%0 a%@ a% b%0 b% b% (b% pb% xb% b%p b% b% b% b% b%@ b% b% b%@ b%p c%`0 c%^ c%P+ (c%? 8c%H @c%E Hc%0d Pc%pb Xc%E `c%`R hc%- pc%`P xc%P c% Q c%`b%c%a%c%fc%bd% *d%@rd%p8d%@@d%FHd%*d%fd%P`d%*d%md%@d%Fd%* e%@ 0e%P 8e% @e%P He% Xe% `e%@ xe% e%@ e% e% e% e%@ e%0 e% e% e%P e% e% f% f% f%@ (f% pf%)xf%8f%)f%`,f%Jf%Cf%pEf%p*g%)g%@> g%*(g%R8g%PGXg%D`g%Fhg%*g%Ig%Ig%Lg%Lg%Lg%Mg%MHh%IPh%Ii%-(i%7@i%@Xi%\pi%hi%qi%i%i%i%j%j%0j%Hj%`j%xj%Hj%j%j%j%j%k% k%(8k%xPk%Ahk%]k%ik%zk%k%k%k%l%(l%@l%Xl%pl%l%l%l%Ql%Ql%Ql%Rm%& m%28m%;Pm%;m%2m%Cm%Nn%U(n%Z@n%`Xn%mpn%|n%o%U o%Z8o%`Po%ho%o%No%fo%o%o%o%p%(p%@p%Xp%pp%p%mp%+p%;p%Kp%q%Yt%t% t% t% t%u%u%u%`u% u%@(u%`0u% 8u%`@u%Hu%p`u%0hu%`3pu%p8xu% u%u%0u%u%u%0u%`u%0u%@u%`u%u%v%`6v%6v%P v%0v%v%v%pv%v% v%v%v%v% 0v%/w% w%w%@ w%`60w%P@w% Pw%w%w%(x%`x% hx% px% xx%P x%P x% x%@ x% x%` x% x% x% x% x% x%P x%@ x% x% x%@ x% y% y% y% y% y% (y%p 0y% 8y% @y% Hy% Py% Xy% `y% hy% py% xy% y% y% y%Ќ y% y% y%p y% y% y% y% y% y% y% y% y% y%` z% z% z% z% z%P (z%0 0z% 8z%0 @z%0 Hz% Pz% Xz%@ `z% hz% pz%` xz% z%p z%p z%0 z% z% z%P z% z% z% z% z% z% z%p z%0 z% z% {% {% {% {% {% ({% 0{% 8{%p @{%0 H{%0 P{% X{% `{% h{% p{% x{% {% {% {% {% {% {% {% {% {% {% {%D|%h0|%tP|%p|%|%|%|%|%}%0}%P}%p}%}%Ȇ}%Ȇ}%Ԇ}%Ԇ~%0~%P~%4p~%4~%4~%L~%L~%L%d0%dP%dp%|%%%%%0%P%p%%%Ѐ% % %0%P%$p%0%0%<Ё%<%H%H0%TP%Tp%`%`%lЂ%l%x%x %|(%d0%r8%@%H%P%X%`%ƃh%΃p%փx%%%% %%&%4%D%Q%\ȃ%mЃ%y؃%%%%%„%τ%ل%% %(%0%"P%. X%5 `%`1 h%@2 x%` %9 %@7 %N %PQ %p- %0P %P %P %%%%%8%@%H%h%p%x%%%%ȅ%؅%@x %@x %%% %0(%0%H%0`%ˀh%Ӛp%%ˀ%%%ۑȆ%І%؆% %ۑ%%X%Y (%@%ёH%p8P% h%ёp%x%%%%ȇ%Ї%؇%%%%(%0%8%X%`%h%%%%%%Ȉ%%%%%(%@%H%P%h%p%}x%%%}%ȉ%%%%% %(%0%H%P%iX%x%%i%%%Ȋ%Њ%&؊%%%%%&%8%@%H%/P%:X%x%%%/%:%%% u!ȋ%%% u!%% %(%0%H%`%h%p%%%%%Ȍ%%%%% %(%t!0%8%X%`%h%t!p%x%%%?%t!%F%؍%%?%t!%F%% %(%t!0%&8%X%`%h%t!p%&x%%%t!%Ȏ%Ў%t!؎%%%}%O%(%@%}H%OP%h%%k%`9%%%kȏ%`9Џ%%%`%% %`(%H%P% X%x%% %%%Ȑ%А%%%%%(%@%MH%[P%h%%M%[%%%bȑ%%%X%Y % %ё(%p80% H%ёP%[X%x%%[%%%%ؒ%%%%%>%8%@%>H%h%p%x%%%%ȓ%Г%Bؓ%%%B%(%0%8%X%`%h%%%% %Ȕ%%% %%%%8%@%H%h%p%x%%%%ȕ%Е%6ؕ%%%6%(%@%H%\ P%X%U%1%i%%y%i%%% ?%DM!% %@ 8% @%0 H% %P % % % %Ю %0 % %@ ؗ% % (% 8%Л H%p `% p%P x%@ % %Ш % % % Ș%И%@%ؘ%% %%%%%%%Е%%(%%0%%8%H%%P%p%X%h%`%p%@%x%%0%%%%%%%%%ș%%Й%%ؙ%%%%`%%%P%%0%%(% %0%%8%H%%P%Г%X%h%%p%%x%%%%p%%%`%%@%%Ț%0%К%%ؚ%%%%%%%В%%%%(%%0%%8%H%p%P%P%X%h%@%p% %x%%%%%%%%%%%ț%%Л%%؛%%`%%@%%% %%%%(%%0%%8%H%%P%%X%h%p%p%P%x%%@%% %%%%%%%Ȝ%%М%%؜%%%%%%%`%%@%%(% %0%%8%H%%P%Ў%X%h%%p%%x%%%%`%%%P%% %%ȝ%%Н%%؝%%Ѝ%%%%%%%`%%(%P%0% %8%H%%P%%X%h%%p%%x%%%%`%%%@%% %%Ȟ%%О%%؞%%%%%%%%%%%(%p%0%@%8%H%0%P%%X%h%%p%%x%%%%%%%p%%P%%ȟ%@%П% %؟%%%%%%%%%%%(%%0%p%8%H%`%P%@%X%h% %p%%x%%%%%%%%%%%Ƞ%%Р%`%ؠ%%P%%0%%% %%%%(%%0%Ї%8%H%%P%%X%h%%p%p%x%%`%%@%%% %%%%ȡ%%С%%ء%%%%%%%%%`%%(%@%0% %8%H%%P%%X%h%%p%x%%Ѕ%%%%%%%%Ȣ%%Т%p%آ%%`%%@%%%0%%%%(%%0%%8%%  %[%P+ %p%; x%PФ%< ؤ%0%= 8%%@< %%r %nP%s X%y% %8%` %xp% x%Ч%@ ا%0% 8%% %ظ%` %P%z X%8%P{ %`%@ %p%0 x%Ъ%@ ت%0%2 8%ع%t %% %(P% X%`% Z %%`P %Λp% n x%Э%`^ ح%0% > 8%%> %@%`S %P%F X%%`H %%I %@p%`K x%а%` ذ%ȼ0% 8%%^ %@%P_ %P%_ X%н%Pj %%pl %p%0m x%г%L س%80%M 8%x%: %%: %P%p3 X%@%4 %x%4 %p%5 x%ж%`6 ض%P0%7 8%%7 %%8 %(P% X%1% %% %p%o x%й%o ع%0% 8%(% %P%{ %?P%` X%\%P %% %p%`Z x%м% ؼ%v0% 8%% %@% %hP%w X%%g %%`g %p% h x% п%h ؿ%p0%h 8%p% %%` %̜P% X%ߜ% %% %p%` x%% %)0% 8%%p %=% %P%` X%Z% %@%y %xp% x%l% %0%P 8%% %%` %@P%Q X%x%0a %% %p% x%%` %0% 8%%P %%` %ڝP% X%[%0f % % %p% x%%p %0%U 8%P%PV %%] %P%N X%%T %9%@e %p%pT x%@%0- %0% 8%x%p %% %P%Z X%%Z % % %1p%f x%P%0g %0%N 8%%N %%. %VP% X%8%p %i%q %`p%` x%ڝ% %[0%p 8%%/ %%0 %P%P X%% %%p %p% x%Ş% %۞0% 8%%2 % %Q %P%0U X%% %% %p% x%8% %`0%X 8%%Z %%Z %P%Z X%%Z % %Z %p%p] x%X%^ %30%^ 8%B%Z %% %1P%@ X%%\ %%\ % p%W x%P% W %0%0] 8%%` %W%Z %P%Z X%(%b %X%b %p%0[ x%k%d %0%pc 8%%p[ %(%X %PP%X X%%R %%`` %(p% x%h%P %0%` 8%%0x %% % P%P\ X%p%Q %%Z %p%@R x%(%@\ %P0% 8%1% %x%` %P% X%@% %%` %p%a x%%p %@0%@ 8%p% %%p| %P%p} X%%` %% % p% x%H%p %0% 8%p% %%` %P% X%%` %% %p%` x%H% %p0%` 8%% %% %P%p~ X%0%` %h%Z %p%Z x%ǟ0% 8%% %%p %%Z %%p %p%p x% %p %10%p 8%F%p %[%p %nP%p X%%p %% %p% x%%6 %%p % %Ѡ% (%ՠ0%Ѡ8% H%P%ѠX% h%`p%Ѡx% % %% %!%% %7%h%Ѐ %N%f% %%(%m0%z8% H%P%h%p%Ʃ!x% %%%%%%¸%,%%%@,%P% %,%0 %(%p,0% @%H%'P%@`%;h%@p%1%Z%,%` %t%,%pQ%š%b%p%%%%%,%К %b(%0%@@%H%-P%P`%h%,p%%!%% K%%X-%0%%%0% % %&3 &-& &: (&-0&@&H&-P&`&C h&L p&&k&d &E&a|&(.&&| &X.&& &.&& &.& & (&.0&@& H&/P&`& h&@/p&&i&x/&& &/&& & && &/&& & & & (& 0&@& H&0P&``&h&P0p&`&^&p0&&" &0&p&. &0&0 &; &0&&D &1& &I (&@10&@&H&S P&pi`&i h&h1p&0&s &1&&| &1&L& &1&P& & && &2&p & (& 0& @& H&H2P&P`& h&2p&p&& &`& & &&- &2&&1 &8 &&U &2&(&] X&P`&a &&&e & &q 8&P@&t p&P&P&P&PP&`&P&{ && 0&`8& h&Pp& 3&& &&  & & H &P &  & &  &p &  & & ( &0 & ` &Ph &  &P &&  & &  & &# @ &H &6 x & &I  &p & &P &H3 & ( &x3X &` &3 & &N  & &_  &  &p 8 &P!@ & p &!x &s & &4 &` & & & P&PX& && &p&04&`&40&8&4h&p& &] &] h&`x&&&&&&&&&&`&(&`0& 8&2@&P2 H&`P& X&2&P&}&P&}&-&7&@&\&h&q &8&P&h&&&&&&&H&(&@&X&p&&&(&x&A&]&i&z0&H&`&x&&&&&&& &H&X&`h&x&p&0&&&P&p&&&&(&.X&h&Ђx&& {&P{& &z&{&{&&`:&@&@(&` 8&H&X&0h&p x&`&`&`Z&&&%&$&@"& '&P3&((&(8&p"H&p"X&"h&#x&&&"&&&0#&`#&`#&$&N&N(&`8&H&0X&h&x&p&0&p&&&&`&`&` &&(& 8& H& X& h& x& & P!&(h!& p!& x!&@!&!&!&`!&"&"&H> p"&Px"&}"&P"&}@#& P#&o X#&jh#&o p#& #& #&:#& #&|#&! #&l#&+! #&u!#& $&! $&> $&! $&> $&! $&(? $&o_$&`? $&! %&? %&8%&? %&! 0%&? 8%&9H%&(@ P%&! `%&X@ h%&zx%&@ 0@&@@&@@&H@&@@&P@&P@&X@&P@&`@&`@&h@&`@&p@&`@&@&@&@&@&8V&8V&@V&8V&HV&HV&PV&HV&V& V& W&0W&`W&`W&hW&`W&W&W&W&W&W&W&W&W&W&W&W&W& X& X&(X& X&X&X&X&X&X&Y&Y&Y&Y&Y&Y&Y&Y& Y& Y&(Y& Y&0Y&0Y&8Y&0Y&XY&hY&`&Y&͖Y&`\&Y&Y&XZ&XZ&`Z&XZ&Z&Z&Z&Z&\&\&\&\&\& ]& ]&(]& ]&0]&0]&8]&0]&@]&@]&H]&@]&P]&P]&X]&P]&x]&]&]&]&]&]& V&`^&p^&^&^&^&^&^&^&^&^&^&^&^&^&^&^&^&^&/&/&F/&O/&P/&Z/&]/&_/&/&/&/&@(&H(&P(&X(&`(&h(&p(&x(&(& (& (& (& (& (&(&(&(&(&(&(&(&(&(&(&)&)&)&)& )&()&0)& 8)&!@)&"H)&#P)&$X)&%`)&&h)&'p)&(x)&))&*)&+)&,)&-)&.)&/)&0)&1)&2)&3)&4)&5)&6)&7)&8)&9*&:*&;*&<*&= *&>(*&?0*&@8*&A@*&BH*&CP*&DX*&E`*&Gh*&Hp*&Ix*&J*&K*&L*&M*&N*&Q*&R*&S*&T*&U*&V*&W*&X*&Y*&Z*&[*&\+&^+&`+&a+&b +&c(+&d0+&e8+&f@+&gH+&hP+&iX+&j`+&kh+&lp+&mx+&n+&o+&p+&q+&r+&s+&t+&u+&v+&w+&x+&y+&z+&{+&|+&}+&~,&,&,&,& ,&(,&0,&8,&@,&H,&P,&X,&`,&h,&p,&x,&,&,&,&,&,&,&,&,&,&,&,&,&,&,&,&,&-&-&-&-& -&(-&0-&8-&@-&H-&P-&X-&`-&h-&p-&x-&-&-&-&-&-&-&-&-&-&-&-&-&-&-&-&-&.&.&.&.& .&(.&0.&8.&@.&H.&P.&X.&`.&h.&p.&x.&.&.&.&.&.&.&.&.&.&.&.&.&.&.&.&.&/&/&/&/& /&(/&0/&8/&@/&H/&P/&X/&`/&h/&p/&x/&/&/&/&HH$HtH5 $% $hhhhhhhhqhah Qh Ah 1h !h hhhhhhhhhhqhahQhAh1h!hhhh h!h"h#h$h%h&h'qh(ah)Qh*Ah+1h,!h-h.h/h0h1h2h3h4h5h6h7qh8ah9Qh:Ah;1h<!h=h>h?h@hAhBhChDhEhFhGqhHahIQhJAhK1hL!hMhNhOhPhQhRhShThUhVhWqhXahYQhZAh[1h\!h]h^h_h`hahbhchdhehfhgqhhahiQhjAhk1hl!hmhnhohphqhrhshthuhvhwqhxahyQhzAh{1h|!h}h~hhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhA%U$D%M$D%E$D%=$D%5$D%-$D%%$D%$D%$D% $D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%}$D%u$D%m$D%e$D%]$D%U$D%M$D%E$D%=$D%5$D%-$D%%$D%$D%$D% $D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%}$D%u$D%m$D%e$D%]$D%U$D%M$D%E$D%=$D%5$D%-$D%%$D%$D%$D% $D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%}$D%u$D%m$D%e$D%]$D%U$D%M$D%E$D%=$D%5$D%-$D%%$D%$D%$D% $D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%}$D%u$D%m$D%e$D%]$D%U$D%M$D%E$D%=$D%5$D%-$D%%$D%$D%$D% $D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%}$D%u$D%m$D%e$D%]$D%U$D%M$D%E$D%=$D%5$D%-$D%%$D%$D%$D% $D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%}$D%u$D%m$D%e$D%]$D%U$D%M$D%E$D%=$D%5$D%-$D%%$D%$D%$D% $D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%}$D%u$D%m$D%e$D%]$D%U$D%M$D%E$D%=$D%5$D%-$D%%$D%$D%$D% $D%$DH% HnmL1ɺIH5rs1H%H %L H% %L H%h %T H%p H% H% %T H% %L H% H% H% H% H% H% H% H% %L H% H%P H% H% H% H% H% H% %L H% %L H% %L H% H% %T H% H% ?p H% %L H% H%X H% H% H% %( H% H% % H% % H% %( H% %T H% H% % H%X H%` H%h H% H% H%h H% H% H% H% H%X H% H% H% H% H% H% H% H% % H% %T H% H% % H% H% % H% % iL1ɺIH5>1%L %L H% H% H% H% %( L% H% H% L$% H% H% %T %T %T %L % H% H% %L %L %L %8 %L %( %P %P H% H% %L % %< H%0 %L % 1H|$P %8 %L HD$`HD$hHD$`%L H% H% H% H% H% % %L %L %L %L %L %L %L %L %L %L %L %L %L %L %L %L %L %L %L %L %L %L H% H% % H%0 H% %( H% %L %L %L %L H% H% HD$ H% H% H% H% H% H% H% %d H% L,% H% %H %L H%h H% H% H% H% H%h H% H% H%X H%X H% %< %@ %D %p H% H% H% H% H% H% H% H% H% H% H% H% H% H% H% H% H% H% H% H% H% H% H% %T H%X % H% H% H% %H H% H% H%0 H%  H% H% H% H% H% H% H% H% H% H% H% H% H% H% %` %0 H% H% H% H% H% % %X %Y % H% % %L H%0 H% H% H% H% H% % H% H% H% % % H% %L H% H% H% H% H% H% H% %L H%X H% H% H% H% H% H% H% H% %L H% H% H% H% %L H% H%h H% % H% %L % H% H% H%h H% H% H% H% L% H% H% H% H%h H% H% H% H% %  H% H% H% H% H% H% %L H% H% H% H% H% H% TH% 1H% % H% %L H% H% H% %L %  H,% H% H% H% HD$ HD$(HD$ H% H% H% H$H% H% H% H% H% H% H% H% H% %L H% %L H%` H%` f.@$P$tD I$AVAUATUSEt!L@ H5A$6H='$HtH=f$H $HtL5$H-$H8$LH9m^1L% LL@$Hy$H9t=L-DHIs e1ML$HXZH9uLiLL1$$[s$]A\A]A^LfUH=Ht 8H=`$HHtH5EH3u ձ$]H5~HtH5sHu$]$]DH=$H$H9tH$Ht H=$H5$H)HH?HHHtH$HtfD=u$u+UH=°$Ht H=#)dM$]wAWAVAUATUSHdH%(H$1HHLL9HD$1Ld$@H$L5u`DHCA龀LHPPL@H1HLP#IH/LHHPLL%Lt~9u]LH- `V1L_1ɺ HI1H$dH+%(H[]A\A]A^A_fDH4$LLueDH-_fj$LLUf.L\_1ɺ H-Z_1HAT$uSHL93f.1L^1ɺ H5^O1D$ u~!H/LHD$#LD$HtQLHPLLD$LDžLD$H|$AE7H-b^XfD2$LLLD$LD$L'^1ɺ Gd uAATUSHt[]A\HGPHL HLt[]A\H][]A\ff.@AWIAVAUIATUSHHFH@ H@`HtH|$H|$AIEtnLHI9t[Il$HHH9t,LHH|$pH|$AHH9uIEM$$HI9uHHt @dAUL1ۅuA9]LH@IHЃ8uHHPHHH9ufH6H9tF 9rF$9sLH|$H|$AuL=\1ɺM1H59\GfDH- \1ɺ_1L\HdL[11<HGHD[]A\A]A^A_DAዀHFH@ H@`HH|$LH|$ALs11H5bW9fATIUHH蕖Ht HLHH]A\fD1Lr1ɺH5VOH]A\f9=ֶ$=ʶ$uNu"Lks1ɺ1H5VLs1ɺ1H5VLr1ɺ1H5`Vff.@AWL=2VI1AVL8VIAUIպATILUSHHL$1YHHŋ$t DžHtKH]PCHHH9HHsLuߋCA$CAEC 7@M LLrA$1AEHT$HM1LaUL(PAEPA$AP1iH HMHD[]A\A]A^A_E1LT1ɺ1LE1 ff.AWAVAUATUSHH $HH $HhH |$HTdH%(H$X!HTHHLl$@L$PILl$(HD$0LHD$ 1U~lAHLfPA/t-u@_HEuH$Lu$%=@$IcǀP/H5nTHtb1HHZTLﾀHt$ 11H`I H$X!dH+%(Hh![]A\A]A^A_HHL$HT$H5.xD$vf|$[DHSHD$(fH$PL5[SLHD$H1LHD$H?StH|$H5BIHAGL|$HIHD$H$DH|$LHH<$L LHH|$Lb28kLR1ɺVPHRPLL$H5Q1<Y^ D1Iٹ|LzoH5Q 121MnLQH5Q1MNH-ZQLnHH|$Lu-HML{nA8XV1HPHQLQPLL$1-XZ8LUQ1ɺHPH*PLL$ff.AWAVMAUATUSHD d$EtoHIMŅt?ILLLHAمtHD[]A\A]A^A_HLetQHLLL[H]A\A]A^A_fLm1H5ODL$ 'DL$ 닉D$ LO11H5ODL$ \AWMAVIAUIATAULSHHXdH%(HD$H1D$EL\$Eu AEd VHtL}1L{ HLD1EHDLULAWASD$D$^r H AąDd$Ht.HD$AHD$ CHD$(HC D$0CHD$HCHD$HdH+%(YHXD[]A\A]A^A_Ð$  $ $ $ D$LL\$D$`L\$D$HfDLM1ɺ1H5MOCf.IIH99HD$H11jE1E1LjLASL\$(p H L\$D$AtD$E1A/DLLM1ɺ1H5HMDUHH0D$dH%(HD$(HGPH8EHw_HtHEP $H8u!HT$(dH+%(H0]fHHE1E1jHjjH t$tD$tHqG LjI_HHE1E1j1HjjH @<$5t$)HG LGjI1H5LY1ff.fAWAVAUATUSH(HnD%ë$HjELe`IIHAEI-r|I%HK=HE1E11jHLARAWH AąsL?K1ɺ,1H5;KH(D[]A\A]A^A_HH9pHDIH8HHpLK81jLAjjAH E1AtLHC8MLEHM1jHLARAWH Aą3St {HfA#DHLK8MjHLjjH tǃ{HuHE1E11j1HLjjrH uHCP@8uCHLK8M1jHLjAj'H |fDHHtHL! A upLK8A@HM1HjLARAWH AfL,I1ɺ<1H5(If.HE1E11jHLARAWcH AąCyILK8LAHpLHI9LDH1jjjLk@H R@HDT$HL$H$HD$] H$HL$DT$LjXHt$LK8LMII9LDH1LjARDT$ AWHL$ |H H $DT$ACHAEdt HLe`I<DLG1ɺ1H5GE1eHMHjLjjH {HHE1E11j1HLjjH BLG1ɺa1H5GlLF1ɺK1H5FFHAALgeOIH5F1 uAWAVAUATIUSHH$t$ dH%(HD$8HGPH8u0AHD$8dH+%(<HHD[]A\A]A^A_@L|$HE1E1jL1LjjH tD\$EtDT$E$=$t$ |$!\AŅ)$L5ED=B$u<$3$ @ d  $f$ tLbIH5C1E1J@DD$ LEtk>LbIDLE1]>LXDLI1Dt$ |$R>L*bIKff.fAWAVAUATUHSHHGPH8ޢ$uE1HD[]A\A]A^A_DHIE1E1j11HjjH tHL5Bz=LaLI1HEPHH8/n HHE1EctE1HAHW uHEPHUH1H;HIHH;1H! HHHE1E1LAWH HjATAk H H;mHH HhXhLlA1ɺ1LÿfDLDA1ɺG1H5gB藿L#A1ɺ1LE1wefL@1ɺJ1H5BODL@1ɺQH5A)AWLAVAUATIUSHH(HLD$I9t"H1fHI9uf$uE1H(D[]A\A]A^A_DHE1E11j1LjjH tLL5@;L_LI1RID$PHH8k IHjI$I9uH@LH@(HD$'RIT$HI}IID$PLLD$HLD$HI0I}LLB H;HD$H1Lm@AWLL$ LֹL!_k肽MAL$LAt$SHL$0HT$8h H L@t:I}jyI9wyLQAM1ɺoLֿL>L}>1ɺ1LE1ѼI}HjLO>1ɺ1L覼L->1ɺf1H5P?耼L >1ɺi1H5-?]gAWAVAUATIUHSHhdH%(HD$XHGPHH8i L=1ɺHHHPH; IiHfLH@I$H;: LF=HHHt$ jE11jE1ɿ jjCE H 1ɺIL=Ht_Dt$ EHCH;hHD$XdH+%(oHhD[]A\A]A^A_DI$L<1ɺH5=1H;ohL{<1ɺH5y<1E1˺{fDHL=|=A7LILZ\1莺IUH!LrHT$MH5S LŅtBH1AVL , LL\-LXZ'fDHT$LD$H;HrLOHI$HHT$HJHPHRHHtSH9HfH*HfH*^Y՞,DhLAZDL5@1ɺLL:5L1fHʃfHH H*XQfHփfHH H*XMCAUATUHSH I$dH%(HD$HGPH8u(E1HD$dH+%(HD[]A\A]HHE1E1j11HjjYH tHEPHL-9LCZLLuH1XZHHAąt$H$AHPH8HR@HWeEfL\91ɺ1L賷!)fAWAVAUATUSHHdH%(HD$1HGPHH8$u3E1HD$dH+%(6HD[]A\A]A^A_f.HHE1E1j11Hjj!H tHL-83LCYLI,1׶HH|AąL4$IFLx0L轻L`HCPLHHxdHt)LLHAHEI>c @HE1L1L74E1@fDL71ɺ01LAUATUHSHdH%(HD$1HGPHH8{$u'E1HD$dH+%(HD[]A\A]fHHE1E1j11HjjH tHL-7 2LWLI\1WHHAąt%H$AHPH8HRHbOL61ɺ`1L*yfAWAVAUATUSHHdH%(HD$1HGPHH8W$u3E1HD$dH+%(>HD[]A\A]A^A_f.HHE1E1j11HjjqH tHL-50LVLIs1'HHAąL4$IFLx8MtXLL`HCPLHHxaHt,LLHAHEI>H;HHf Lr+OHHHt$ jE11AUE1ɿ jjo3 H 1ɺRIL-+Ht[Dt$ EHoH;VHD$XdH+%(8HhD[]A\A]A^A_ÐI$L*1ɺKH5+1'H;VL*1ɺ-H5*1E1fDHL=+q%WLILL1辨IUHLrHT$MH5u+L ŅtBH]1AVL N+LLJJ]LEXZ'fDHT$LD$H;HrLk7HI$HHD$HB@8t.HBLA|L5Z@Hp HxHtZ1HtSH9HNfH*HfH*^YΌ,ȅ9DΉJHPI $H@HHtOH9HfH*HxvfH*^Yb,DiLA{f1ɺcLLm(զL转HЃfHH H*XuHƃfHH H*XIHfHH H*XHfHH H*X-覰fDAWAVAUIATUHSHXdH%(HD$HHGPHH8bS HHH9IEcH;LH3 HHHt$jE1E1j1ҿ jjH/ H IHDt$EunLVH;RHD$HdH+%(HXD[]A\A]A^A_HaHEP5$L0E1DDHL='!L'LI1ΤID$HHx LpLHLL$MH5-BL LL$Mt*L1LLL$H5o'զLL$AHLL$ HLHPLL$1LLXZfDH 8HE1E1jH1HjLHD$(PH H 0L$H@ LILG1荣LuL%1ɺV1H5 %E1a@L$1ɺR1H5$E14L$H5%1 E1HHMLGPL\$1ɺ1H5%询%f.1ɺE1L$H5"$~@ATIUHSHW`HGPH HHH8O HLHHH t-LHH AtXH;xOD[]A\L|#1ɺH5$ѡL]#1ɺ1H5Y#E1譡L4#1ɺH5T$艡1E1L#1ɺH5#\D[]A\@AWAVAUIATUHSHHHW`HGPDfH HH8HN HIIEPL8LaH1HtLLECEL1HLAFk AŅt4AFAEI>NDcHD[]A\A]A^A_f11L"H5/#_L!11H5!>@L!1ɺ1H5!E1tff.@AUATIUHSH76 tAHD[]A\A]I<$HKIHtH5 tL0HH-5!HHLDSIH1fIt$XLZIT$AądL 1ɺ1H*HDAVAUIATIUSHGPL0L_H1HtLLLIU`AD$IEPH HH8H5L IHhLKLHE AątAI>L[D]A\A]A^@11L6H5!OL11H5.@1E1L1ɺH5[D]A\A]A^AWAVAUATUSHHD%w$dH%(HD$81ELHHE1L-BL9L|$ M6I9txI~3 tD$M^H;EHm LHT$HLHT$I1LAR#M6Y^I9ufH1ELLAXZHD$8dH+%(utHHD[]A\A]A^A_HE1E11jLLjjL\$(H L\$t1|$A=~$H=ئAWAVAUATUSH8D%}$dH%(HD$(1EHLHE1L5I9t^IfHL9tHH{/2 tDt}$HsH}EuLS1ɺ1L誛HL9ufH1E%LLsXZHD$(dH+%(uRH8D[]A\A]A^A_HE1E1Lj1jj>H [L$1A芥f.HdH%(HD$1D$F@t!HF H@XHt51HT$Ѕt(D$t!HT$dH+%(u4H1L?7H5t1ff.UHSH85{$dH%(HD$(HGPH8u\H=HHL>SI1H5X1ZHT$(dH+%(uSH8[]fDHHE1E1j1HjjH A$Eu F{$jH+;e ff.fATUSH@dH%(HD$8HG`@ H%HH/HCPz$L H4-HE1E1jH1HjLHD$P> H tX$tqHuHH / AątnAHD$8dH+%(H@D[]A\L1ɺH5qHAtHy@HLv IH51H]`[: HfDH#HH#C`Jf.UHSHHH9t9HCHxHG`@u uHuHCHxuHH9u1H[]DHCHxLK IH51,HCH@H[]ff.fAWAAVEAUIATUHSHHjIHHHtbLHtHLbLLuKDL谙DL襚HL[]A\A]A^A_!1H!lHHDL1ɺ[1H5/LE1TfL1ɺU1H5DL1ɺX1H5וDL\1ɺO1H5X试%f.ATUSHH $H1dH%(H$1H(k8/HHXHL$1IHoLuF1ҹHLTHtGLH$dH+%(ukHĠ[]A\HLufDƄ$fD1ҾHijHXHHJL$c@AVAUATIUSAHIHHILg(I}HH L1ɺHHt`A1LLHHt71HtYAuvH[D]A\A]A^f.L\1ɺ1E1H5P謓[D]A\A]A^Ht A%AL1ɺ1H5E1Ta1L1ɺH5'[D]A\A]A^ff.AWfAVIAUATAUSHH|$L$dH%(H$1)$D$\D$XDŽ$)$)$)$)$)$Ht BIՉ$c$ED$L$ur$d$D$IF`H.r H/2IIH9ǸHD:H H@@e EL_H\3L mRLV(PH5F1蛑Y^D$H$dH+%( D$H[]A\A]A^A_@1L2H5<b$D$L1ɺ1H5 D$k@HH9AUt AFd ( EtL&  IHtxAFduqA AEuL' a HsH|$D1_D$L1ɺKH5DAED$HMIHD$(I9tQMtLIHtKHHH9t8Ht3H@@t)H|$1D ML9|$(B1EH81L4$HD$0IDML|$L-#HD$ H$HEHD$$$.AnL1ۅt#H@IHЃ8PA9^LwIHt7HT$ DLu#1ɺLL|D$HIHt7HT$ DLu#1ɺLL9衎D$HIHt1DLpIFHP€AF1 H@ H@pHEiInpHD$\D$X="IHH HHA11LHH1HʑJHD\$\ED$XH<$2 1ɺLILv1肍fM6L;t$( L4$DL$HED$EL EHL LDH1ɺPL3H51 ^_D$mfDL H)2L v.DHp1DL1ɺxLL<褌D$HoL12H5l HL$\HT$XLHT$8HHL$ЅZT$\udL$XtdH<$1ɺLIL1~fD1ɺLLu ݋D$HXD$XIFHP Hzx5=ό$H<-HHh0H<$HD1ɺLSILH1UlIFD$AXAYH@ H@xEH1LЅR$uH$@fL|$@11Dd$LLd$8fIFHt$LLD$\H@ PpD$\(H<$LH1ɺt$IL 11L蔊A_X$u$$ WA $uU{$'D t4L 1ɺ1LL|$@Dd$LD$HLj 12H5f ܉InD\$HL|$@Dd$LE(DT$XED$D$H @H蠕HD$0Ht6H~IHXHN7HHt$0HHeHD$0H蘎HD$XQ\$\bD$X^HD$0H{8r $H,$Hu*HS HHE\1ɺLSIL t$81览5$ZYIFH@tIVpHt$01A L1HD$XHD$8HD$\HD$1ɺLL L|$@Dd$L+D$HL 1ɺm1H5 L4$ML} 1ɺL%{ 1L͇IG@@IFH1ɺPL OLt-L{@AUIFPD=i$H8E>HE1E11j1Ljj^H IIL8H9D$HH-L4$MMELd$Hp1DL4I9SLM6MLf1ɺL%d1L趆HމIFPH8 L%IDD}$EL AEeaLl$xL$ht$p|$lHL=LDD$PL5KL%,HLDLLDLDEHDAWLEAVIS ATHlSHHD$01{D V]$H EHt$L011Z {#DLL"1ɺIHHD$H1L{L@H@HD$L4$L9*IMHD$fHD$I^I9IfM?M9IwHhuL[1ɺ1H5zL6! L"IMe`LD$hLl$xDM6L9t$:IEPL L H$HXM9t+MfDM6M9tIvH蔄uH$HH$H9D$uLnHt$1L`I1yH9HhAuIHBc2 H LD"HD$H1UyLL1ɺD IH51$y6Ht$L1ɺj xH=юH91HHtLH5L$hvL 1H5xL L9HI#E`IU`L$4H"r0H!r)H%r@u|$huHH H9LHt$LoIb 1wLf1ɺH5w1ATIH5GUHHHdH%(HD$81 LufHLHHH$HD$(D$D$ۙHT$8dH+%(uHH]A\讁ff.ATIH5UHHHdH%(HD$81 LkufHLHHD$HH$HD$(D$EHT$8dH+%(uHH]A\ATAUHHHHdH%(HD$81tW$fH$HD$(D$D$tHHHAH=>HD$8dH+%(u HHD]A\~ff.ATAUHHHHdH%(HD$81DtfHD$(HD$HH$;W$D$tHHGAH=8蘍HD$8dH+%(u HHD]A\AV11LAUL-L5v$ATUHSHLu=lv$uK PIHH謏tpI|$PL5dHHHtCL`Mt:IT$TID$\H3$H3D$H u"IT$dID$lH3T$H3D$H CDE16Htr$tQ1HIHtπIL11YH5E1kqfDHhvHD`DaH=Rr$DHUcHHYL`MLA${IO1LH5p\{ff.AVfAUATUH8dH%(HD$(1D$ )$)D$HooVHIH) $)T$uHD`D`H=xq$DHsbHHtKH@HtBL`HMtID$8H$LT$  HC8T$@T$   ‰T$D4uu HDŽ$H$Hu\ HDŽ$HDŽ$LuMLLHD$PH$H$tHD$HteI$H% L9 HpH|$h$HHH9HpH|$h$fƄ$H?$H$)$L)$Ao)$AoU)$I9II0MA0L9fDHQH7HGH32H3BH HwHGH3rH3BH LjPHJXAHAMtJH\$0HHl$8DILHgTIHYBL9uH\$0Hl$8$HD$8HD$0$H|$HL^H|$HHA^H|$XLD$`^H|$XHމD$dM|$D$hg|$ D$lgt$@|$D$p蒲t$D|$ D$t聲H 4 D$xHD$HHEHHL$HyH9pHPI$HOL9FHHHHEL# Lt$|$TL1W|$8WR|$hcW|$HWQ@[HD$xH@H=yHHEHHH9HpHD$0H \yHHEI$HL9HPMH1yL LDHHEWVLL1Q@RiAU)[HH$H0HH9HPI$H$HL9HpHHEL3 Q@RLo1WVLt$xZ$H0HHHDHH`H9WHxDl$dH HEHDI $HL9HqHMRLuWPL1@VLZH D\$pH'HEHDHHH9HxDT$lH HEHDI $HbL9YHqHMRL zWPL1@VLvYH DL$xHHEHDHHH9HxDD$tH OHOEHDI $HL9HqHMRLWPL1@VLX$H HHHDHH1H9(HxH EHHDI $HL9HqHMRLWPL1@VLFXH|$PH 8]H|$8.]L$|r$H̻]I$HmH;l$H$Ll$HHxH@hI9g MtI$Ht L9=H e9$HtHHt H9HH9$Q@LPLL$81LqWH$ZYHt$HPHHI9H9uMtI$Ht L9H8$HPLL$8L'L1WHt$H$JA\A^UDH L9H$L$H;$H$L$H-?H;$H$H$H=0,$H$L$L-H$H$>H+$H+$H9SLJIع@{L1JHE1HNNHHtqHmL9(HEHt HHtH9uL g+$DLJI@L1IHsL脜HL9HCHt HHtH9uL +$fM1ɺEL9IHCHHHH9LJH1L1UGLHHH*$AZA[H9HC@HLoo)$)$  NHCHeL 9*$qHQHPHH$|H$HH$HAH$HH$aSHtAH$H$HShHPH$H$HPHHH$Ht$H$;D1MHu8L9HHH$0SHl$HBHBHJLHH@HPsD$`HL$PH$H9uH$HH9H$H9L$PJ$$Hʃ@8D$tzDt$xHiED\$tEeIHHHI($HL&@LPLL$81oF[]}MI$HL9t~Hp1LLL$8@L!FH$^_Ht$H9I$HAL98H@HPLLL$8H5u'$1LLL$8@LEH$ZYH;D$tHt$H9HPHHI9uHQHPHH$`H$HH$HAH$HH$4HH9kLd$L$0a@IFhHHH1H9(HBQIL1PSL1DAXAYHHl&$H9L%E$fHCƄ$P)$0)$@MtoLA)moA)ueILDpD4DLLV6HHtLpMgIFhH|$@Ho)$o)$ W 1ɺQLL\CHa%$H$H$HH9 HGHCHHHHH9u$$HHAHBHH$NH$HH$HAH$HHAH$Ht HHtH9ulH$$HL@PLL$8LW1B^_4H$H9L$PIHLHLHaHBLHH@NLHLHL $$ HWHPHJG]LeLt$(:HD$HXhHtzHHtrH9tmLHHL1Lt$01AAZA[H|$u1HLIHPc`2MHd#$L X#$IH5D#$L1LL$8@LioAH$^_H;D$Dl$xEDT$lEtWDL$pHEDD$lEu?IHH +%$H59H=JCnKI5|$pu|$dt(|$hH|$duIH|$huHAVAUATUSHHHF\HVTLfTH3EH3UIHH {TL-rA$<fLCTAD$AD$ oMKToUAT$4ELHLP2AŅH[HHtH5$H[CtJL tMtZIFhHtJHHtBH9t=LJ>IT$ID$H3UH3EH 8A[]DA\A]A^L 1!$AT$1LQS@H5Z?XZfDM1LH5S)?[D]A\A]A^DL DLLP2ff.fAWIAVLrAUATUHSHH(L"MH5L!BH5LM`LC@LmPMt(I}HLLD$LL$ ILL$LD$LLHLtAŅMF1LH5P&>H(D[]A\A]A^A_@LmPMIMHHtHϺHL$XAHL$t_HEhHHHH9LJH:1QL1H5A=[]`fDLM`LC@LmPLLHAŅCCPu H{XS`t*9sƅvƅL}PMAHsX{T9GHMhAƇAAIHLMI9MHHL@VWPATRL-|1LM<HC@H0LsHL[8LS0HD$HEPHPPD1҃t~HpHHEhAH[H HDHUHHIH9@LIL\$1L@LT$RVL;AYHEPAZLT$L\$DPPMLMt'LLLD$L\$FL\$LD$LL\$Q@HUPH|$HT$EHT$L\$HHHEhHJHHSHHGH9>LJASL1Q@L:_AXMHEPLMtLLLD$;ELD$t}L?HUPLHT$iDHT$HH.HEhHJHHHHH9~LJAVLL1Q@':Y^H|$HHEPLMt LDtwL>H|$LuPCIHFHEhINHHHHH9LJt$ 1LQLM@9XZMG0HhMG0H MG8HHH9tCfDHqHHpHI0Iw8LHqIO8HHHIW8HH9uALnPM1L-H5 8HE`L`8M IEH9uA9tHMhHtL Mt I9vH ?$PM1E1APLVH5WRQ1a8AƇH0Kd&@D[TEfDDDMO1LjH57@HMhAAIHLMI9MHHL:@VWPATR"DHMhAƇHtLMtwI9trMHHL3@AVH5`WP1ATR*7H0IIL $K@L $O@L $L $)@L y$z@L i$@L Y$&@L I$*LL$LLn6MLL1K6MLtL'6MLL6@AULoATIUSHHoHt=H]L9t4fH}:HUHEHHHBH:HI9uIl$@Ml$Ml$Ml$@Ht7H]L9t.H}w:HUHEHHHBH]:HI9uMl$HMl$@H[]A\A]HwHtVxdu?H$H $L!H9u HH9t@H;BuLLHH韪LHLfLȻHLÐff.ff.HI11L*H5$4Hf.988AWAVAUATUHSHL/HGMHF8IH$Lt$I9t#L~(HI~(L%>Aąt>M6L;4$uH|$tyH$AHEIHEIH(I;Hs1ML!H5"3XHE HZPhHD[]A\A]A^A__'ff.@AUATUHSHHH7H;L`LIHtLHH@IL-1ɺN1LL2H;H@HjAątHA[D]A\A]IL1LDL1ɺ;1H5 g*(fHSIOHHHtHQMLP8OfDHEL LHPHHCHtLHL:RAfL|1ɺO1H5s)f.HEL HPHHCHtLHLjRH;f.HJHHSHHtHQMLPDoHEL rHPHHCHtLHL@RUHEL <HPHHCHtLHL R[HEL HPHHCHtLHLRa]HEL ЯHPHHCHtLHLRg'HEL HPHHCHtLHLhRmHEL dHPHHCHtLHL2RsHEL .HPHHCHtLHLRyHEL HPHHCHtLHLROHEL ®HPHHCHtLHLRHEL HPHHCHtLHLZRHEL VHPHHCHtLHL$R1H5 E1&XZHEL HPHHCHtLHLR_H{LIHEQpH1@ATUHH5 SHhHHHPH1F#fHH5_HH@HPH1#Aą pH5 H1"Aą1" @: +HHH H5 H1\"AąAHH5 H19"AąLʦ1ɺ1H5 %$L1ɺ1H5 $D[]A\ALq11ɺH5h $D[]A\@HH5 H1!Aą5fH5{ H1Q!AąL1ɺ1H5 5$9HH5 H1!Aą/H5 H1 AąfH5 H1 AąfH5 H1y AąfA[]DA\fHxH5 H18 AąM?HH5 H1 AąMHH5 H1AąML\1ɺ1H5S"f.H5 H1yAąfH5 H1IAąLڣ1ɺ1H5-"1L1ɺ1H5!f.L|1ɺ1H5s!f.LL1ɺ1H5C!f.L1ɺ1H5o!sf.L1ɺ1H5?!Cf.L1ɺ1H5!f.L1ɺ1H5 f.L\1ɺ1H5S f.L,1ɺ1H5# f.L1ɺ1H5O Sf.ATUHH5YSHHHH@HPH1zHH5H1Aą'HH5 H1AąH5oH1AąBH5H1{AąxHH58H1XAąHHt HPHH5!H1,Aą <d$Lt HH)A"LL1ɺ1H57D[]A\AL11ɺH5lD[]A\@L1ɺ1H5?D1LŸ1ɺH5D[]A\L1ɺ1H5CfH5H1AąfH5H1AąfH5H1YAąjL1ɺ1H5=H5H1Aą.L1ɺ1H5OfDH5aH1AąLX1ɺ1H5CfDH5*H1yAąL 1ɺ1H5]Lܝ1ɺ1H5/f.H5H1AąL1ɺ1H5{?fDH5H1AąthfDH5H1Aąt^rfDL1ɺ1H5WLޜ1ɺ1H51L1ɺ1H5 gL1ɺ1H5}ALl1ɺ1H5Wf.H(dH%(HD$4#t >$>$t HT$dH+%(H(HL$ LL$=$LD$H5VK=$tT$ t$|$v=$=$1LJ  H51UP$H(dH%(HD$T#t ^M$TM$tHT$dH+%(uvH(HL$ LL$#M$LD$H5)~JM$tT$ t|$w1L H5!1z#DAUL-ATIUHSHHH9u 3HH9t(HsLd#uHA[D]A\A]@LLHAąu1L] !H5#HD[]A\A]ÐAUL-)ATIUHSHHH9u 3HH9t(HsL"uHA[D]A\A]@LLHJAąu1L  H5wHD[]A\A]ÐAUL-ATIUHSHHH9u 3HH9t(HsL$"uHA[D]A\A]@LLHAąu1L H5?HD[]A\A]ÐAVAUATUSI@@ &IH1LHHp{x L1ɺ(IHLMt'1LHHx LT1ɺ,IHHHH|$0 D HHMHD$0A<$H8HwHXH|$0{Lϗ1ɺH5#L1ɺ81H5[1]A\A]A^LQ#1H5d1[]A\A]A^ÐLY0DLPHXHH8M1L?H5U#=L"1H5+#fDHD$0A}H8uqHwHuHH|$0?L1ɺH5#fLl1ɺ1H5t#fLXHEHHHuM1LvH5*d#LoHD$0`opooDǀBff.AW>AVAUATUSHXH$LD$(Ht$0HD$8dH%(HD$HI@L@HD$(HhD%7$EuHD$(6$HD$(D$L|$@L53$LhI$I$HD$ H9#fDuL1ۅuf;]LH@HHЃ8uH@LLLhID$PHIU@H(`D\$@IE@EH5HH)H9 LjLH1ɺRAUI1LSH5bWD$AYAZ;]LADHmH;l$  $#T$$ LA葎L&1ɺaIH51IE@HtgHHt_H9tZLjL>H1AUI1LUH5D$,_AXgL-#@L- #HD$(HH@L1ɺNH5LHH1ǃE1HD$(H|$0H)HHhHxHH'HD$(H|$0HrHhHwIHHD$(H|$8 H$DpHHHD$8DDA>H8HwHH|$8pLđ1ɺH5#L1ɺa1H51&L<C1H5s1HT$HdH+%(BHX[]A\A]A^A_Ë#HH@L1ɺHH5LHH1pǃLHHHM1LH5#L蚋LF\IH51Lo1ɺTL\1ɺ1H5d#H1L IH51zL1ɺW]HD$8;H8HwHuHH|$8tLȏ1ɺH5 #H蟊L{IH531 Lt1ɺZH}HEHHHoIٹ1LoH5K#xHL$(oxo)$oo(o8HHHLMLH>LL`HD$8LHH8ܺHHtLLHHHD$(H8LLL`HD$8LHH8葺HHtLLHHH@fAWf1AVAULATL%EULHSHHxdH%(HD$h1Lt$01)D$@AEHt$HLAE AE0HD$(HD$ HD$HD$)D$0)D$P败HLHT$(H蛳AąHULd$(HzPLHT$膶HT$HLxM E11L1HyAąHH5H舲Aą]HT$H5(lH Aą^Ld$L!HLLwHH5GH聱AąVHH5H`Aą}HT$H5H聲AąVLl$LL`HELH@PHxaHhLLL%Hsf1LHL1)D$@)D$0H\$H)D$PIHtPLHT$ HAąCHULd$ HzPLHT$شHT$H'LhML%f11LL)D$@)D$0H\$H)D$PHtLH H(AąL%f11LL)D$@)D$0H\$H)D$P/Ht$LHHدAąL%f11LL)D$@)D$0H\$H)D$PآHt$LHH聯AąL%if11LL)D$@)D$0H\$H)D$P聢Ht$LHH*AąL%!f11LL)D$@)D$0H\$H)D$P*Ht$LHHӮAąL%/f11LL)D$@)D$0H\$H)D$PӡHt$LHH|AąL%f11LL)D$@)D$0H\$H)D$P|Ht$LH H%AąQ L%Df11LL)D$@)D$0H\$H)D$P%Ht$LHHnAą"@L%f11LL)D$@)D$0H\$H)D$PΠH\HEL}XLHH`MtIM`HLfAąAIHEL čHPHHCHtLHLR:1H5\XZHD$hdH+%(HxD[]A\A]A^A_@HEL THPHHCHtLHL*R7H51E1AYAZHEL HPHHCHtLHLRE;f.L,1ɺ@1H5 f.HJHHSHHtHQML>P=?fDHEL \HPHHCHtLHLjRYfHEL $HPHHCHtLHLRMf.HEL HPHHCHtLHL*RJf.HEL HPHHCHtLHLjRTf.HEL dHPHHCHtLHLR^f.HEL $HDžHPHHCHtLHLRaHEL HPHHCHtLHLRgLHHAą{HEL HPHHCHtLHL RoHEL NHPHHCHtLHLRvHEL HPHHCHtLHLR|OHEL HPHHCHtLHLRHEL HPHHCHtLHLrRH{IIHEAPLApHH{ L)IHEWpHH{LIHEVpHjLe1ɺ1H5PYH{HT$HT$ML rHjP H{wLIHEQpHUSHHHPDHEtLtTH[]@ǃHH{}H1ɿjI1H5DLmdL^_uǃLHQH{HA}Hj1UILS1H5XZH[]H-HPH|H1ɺ]UILH518AYAZff.@ATUHSWTHLHPHtaH5uH1Aą5LXMt9I$H5HF NI|$tI1Hj1LAD[]A\fH5aH1_AąYL1ɺ1H5C뷐~t)L1ɺ1H5jE1vHHH5H1AąLi1ɺ1H5-HL,1ɺ1H5f.Hk@IL>1E1H56AUIH5.ATUHHLH@HPH1HH5LHPH1AąDHEt)AD$w|DH5L1AąLHrAąAD]A\A]AL~11ɺH5LD]A\A]H}yHLGATIE11H5iXDZ]A\A]@1L~1ɺH59D]A\A]fDLT~1ɺ#1H5 !fL,~1ɺ1H5f.AUATUSH8dH%(HD$(HHxHHHH5]HHPH1AątqHH5\5HH@HPH1Aątr`H@fAHD$(dH+%(H8D[]A\A]L4}1ɺ1H5DL }1ɺ1H5_DL|1ɺ1H5E14bH5bH1Aą(L|1ɺ 1H5MfDHH5H1AąHHAąHH5H1Aą%H H5H1]AąH(H5H1:AąH0H5H1AąH8Ht:I(Lp AąLH5`H1AąH@HI(L& AąsLH5H1AąL{1ɺ61H5kfDLz1ɺ(1H5?mf.Lz1ɺ#1H5q=f.Lz1ɺ&1H5A f.L\z1ɺ)1H5L6z1ɺ*1H5Lz1ɺ+1H5cLy1ɺ/1H5=kLy1ɺ51H5yELy1ɺ01H5SgUSHHGH@ -HBf4HHGHsTH-H@PHDL$Hxj{ZLYI1ɺ?H1IDHEtL1ɺC1H LLPMtL1ɺI1HHXHtHxHtE11Hx1HHL1[O1]fDH@H[]D@HHH9H@G1ɺFHIL10ff.AWf1AVAUATL%[ULHSHHHdH%(HD$8HGI1H@PLp)D$Ht$L)$)D$ 袏HtLHUTHNAąL%f11LL)D$)$H\$)D$ VHf11LL)D$)$H\$)D$ 'Ht7H@ Ht.8ML11-H5#HEL /|HPHHCHtLHLRDL%f11LL)D$)$H\$)D$ 胎Hf11LL)D$)$H\$)D$ THt3H@ Ht*8taML11-H5 ,#HEL `{HPHHCHtLHLnRfDLxA?tLLL`LϡHLLHHPfL11H~)D$)$H\$)D$ wHH}HP}Hx tNHEL zHPHHFHtLHLxR1H5E1/XZ#1L螛HXHAHD$8dH+%(uHHD[]A\A]A^A_fHEL zHPHHCHtLHL"RxH51Y^Hp>xHLCAąHEL yHPHHCHtLHLfRf1ɺE1LsH5kfHEL $yHPHHFHtLHLRf.HEL xHDžPHPHHCHtLHL'R:f.AWf1AVAUATI1UHSHݛHHXdH%(HD$H1Ll$)D$ Ht$(L)D$)D$0Hf11HL)D$ )D$Hl$()D$0ŊHt7H@ Ht.8ILt11-H5z#ID$L wHPHHEHtLHL2R7DID$L wHPHHEHtLHLRH51E1(Y^HD$HdH+%(HXD[]A\A]A^A_HXM|$;EIPHҚfH%LpML= 11LL)D$ )D$)D$0Hl$(~fH11LL)D$ )D$Hl$()D$0NHt;H@ Ht28L 1ɺ-1LH5#ID$L QvHPHHEHtLHLRID$L vHPHHEHtLHLR{fHUIOHHuHtHQIL~P@fDHXIT$;8HzPHHT$EHT$HwLxMjHEyf11HL)D$ )D$Hl$()D$0HtGI$HHH蔔E$HAAAuID$Hh`;fDHLAŅLL߈AŅLLiAŅID$AHH99L,fID$HUHHHHktHtHQL_E1P1H5m XZ@Ln1ɺ1H5Af.HJHHUHsHtHQILP`fDL$n1ɺ1H5wLfLm1ɺ1H5O$DAWf1AVAUATL% ULH1SHHXdH%(HD$H1Ll$)D$ Ht$(L)D$)D$0ŅHf11LL)D$ )D$H\$()D$0蕅Ht7H@ Ht.8MLD11-H5Ji#HEL rHPHHCHtLHLR7fDHEL drHPHHCHtLHLRH5`1A\E1A]HD$HdH+%(HXD[]A\A]A^A_L`L}A<$"HmHt9}tL1L Lf}LHmHu $$HH-L5rщ $tt#f.H8L9CtuU1ɺLS1L LX^]$ S$뱐D$ T$L1H5-$R[P1rA[[`f.H!HLu C $H8I9ufC;D$ LK HLLL$ LL$HHCLPLq1fD sAYEAZD 5h$HL1LSL J1v_AXLL `1ɺVH5aR@L- ֿ#Hօtf.1ff.fAWAVAUATUSH(H$`HD$dH%(H$IHtIIPMB uQ1LSH51H$dH+%( H([]A\A]A^A_fIPH1IH-LLJHpHW1H:I$A$`A^YHHHD$H9ӺHD@fIMEu#ALBH{HHD$AHtl=D V#EHt$|L@I|$D$|HHL$ YLfHI1ZI$1LHp= HD$HI$M$ @f|I$0I$I$(MHH9 IT$fH L)$H$)$)$)$HDŽ$HDŽ$HRP)$)$ooI$8)$H)$HDo)$oZI$@)$H)$HD)$o")$ojH v)$9BHD$(HH$HdLBHD$@H1ɺHLC\1 @MuI$0TI|$WLHI1_1I|$T$VHHT$ I1LRfAZA[;DL[1ɺx1H1I@I|$Ht$HL$HT$WVHT$L>I1RHt$ VHAWHL$(QH 1DI|$T$VHLrT$IR1HF_1AX@H1L: HD$(HH1LHp: HD$@HeE$`EmIXHPHD$8H|$ HHHH|HHT$`HD$8H@HHKH"H\$PILd$HIHLl$XHLHDHD$0HL$hIM'ILd$0Lf.I4$IHHuMMuLd$HDI$ENTM$0M$(HD$0M$ HL$ HcHHEHD$ H|$HD$HHHKLL$L|1:H5 F#LX1ɺIAHSHLSI{fDLl$XHt$81H\$PLd$HLrHD$8HAL|$0LhH\$0Ld$HLt$ Lt$hMI]MLMu;I4$IH'HuMmDI$ENTHD$8M$0M$(HD$0HKM$ HD$ H|$ H5-DL$HDL$HHHED$HD$A?A HFh L5H5y1#ZYdf.1ɺHL-W1fDLL$LT1)H5N#H@j@LrhH$hH|$1DL$H4DL$HHH HD$H8HD$@8Ld$@DL$HL蛂DL$HHH8HMP1LH5a#PL=ϿH|$ LbL|$`A1ɺHLU_11ɺHLU=1HwH8H|$DL$@LDL$@CLU1ɺUH5ߵ#Ld$HLt$ H\$0I$A$`ENTM$0HD$0M$(M$ HPHD$ 1ɺHLUv1IE H1ɺSLaHp1SL$6HD$XH HHH6L9bH fL9HH@HuI3LT1ɺL1H5#vHD$H8HD$(8tQLd$(DL$@LXDL$@HH0Hu6ML1YH5$^#HwH0H|$DL$@~DL$@u2LS1ɺ^H5׺#IEHBHD$H8HD$8twHt$DL$@DL$@HHCHHu_LL$(b1LH5p#_MmHD$8LhL/S1ɺ HwHsHH|$DL$}DL$*HD$0H|$8LL HHD$L(HChHD$ DhHCxǃlHD$Ht$81DL$HH8{yDL$HHL`MtWL5(EIElID$ Md$Mt+Ml$ I<$Mt>AEu6L&tEAD9lsDlIL61zH52#LQ1ɺgH5θ #LQ1ɺuH5#HHD$ 3fAWAVAUIATUSHʐHBLx ME1HH-vAMMtLA?u]MwHLNHL;tH5tL(uTMAMuHD[]A\A]A^A_DML11H5 kH5_Lu AH@H5HLuA(@E1qH)1MAVL1ɿH5XZME1LH5ϳW fH8HtfHFHt;tHvHu@HfHHtHVfDHfDAUATIUH SHH8Ht`H1 fHHPHt :HPHHuDHHAHt 8HAHHuI$ H9tHCHt HxzHH9uI$0I$(I$ I$8HHzHRHE1 fHHqHt >+HqIHu1HHJHt 9HJHHuH H L+HH9DHS HtHzyI$0H HSHHC HHQH HrHH3HSHH*HH IMLLI9tsIA$qH90dI$0f.HJH[HNI$8HBH H L+HH9ufDI$8H1HHPHt:t?HPHHuHd1[L]A\H5A]=DHPH+HQI$8HxH@xI$8uH[]A\A]HPHHVI$8HxH@FxQHQMtIPLM$8HAI$8HAHDHHAHtHBI$ I$8HAH9u,@HH9t H9HuH0HPHVH2HH9u@Hywf.HH HI$8GH $H5NH=OgAWAVAUATIUHպ@SHHH|$L$HLD$LL $dH%(H$1N !HiIHHIEHHIEHIEIEIE IE(IE IE0IE8IE0H$IE@H=#LHP菻AƅLL1AƅI}HLL'J11YH5MzDHsPHL|$@]Ao$LAoL$D$`)D$@)L$PL|$ FLDhD跸H=8#DL3HHGLxM:MoHHL{3MWH$IIG@L{PIGLHCIGHHChI_HtHHt H9L A#AT1LU@H5LAdXZH$dH+%( HD[]A\A]A^A_fDL-ILLH1ɺ<LfLJfI}HLLkH11SH5KWfAUL-KM1ULbeL1A[1A_H8SIHHPTH@\I3$I3D$H uIWdIGlI3T$I3D$H XHChHHHzH9qLJULLAVh1E1AYLyGAZ1ɺiL1gfL-JHLI1AV@sL_AXIHHJIGHHJIG MWHIG(IG IG0MWMWIG8IG0H?#LT$0HD$0HP։T$(蟵T$(H|$HLT$0HH[LXML\$(IL:1IL@LT$L\$(LT$ISTIC\MCTI3D$I3$H uIPI@I3T$I3D$H RHt$H|$LT$(L\$0LD$8DL\$0H|$D$IL\$%T$L\$LT$(tF AƇAƃHץ#HH ǥ#IIOL=#LxH=#H#AIEH#IEL(L-#5HLT$H|$LHP0LT$AbILL1=IH4L,HILAPL1AsHE1ATIHH Lr@Ht$ H|$8@LT$'H LT$L\$=LT$I1ɺAƇL1AƃLMt$ AVm#`YL`^1ɺL1ALT$9*"HLT$#H=#HP葵H H=#LHP褴LT$AIL"L1J@L Q#IL CH5F1E1t 1ɺLLBML\$LT$蔵菶L'IHLL I{LL1E1ILPvff.AUATUSHHt>Hu=LV1ɺD1H5L%b}HL[]A\A]HHmH;LhL>nIHBL1HH]HH0HHH^t LE1%@ALOAH Ht=H0LLBNuԀ.tπ_tʍqՁt HIufAA<$tU H5 L1ɺUE1L[H5GfMAIL11PH5E1 @LA1ɺI1H5W߾]f.AWAVAUATUSH8H<$Ht$dH%(HD$(1HD$ HK>BH|$H5ѸiHHPE1Ll$H\$ H LH]HL|$ E7EtH@EwIEtIDA uA#tMtA<$u4ALuBHt<#uH<$LIiLL$L-11xH5製H|$ Hu"HD$(dH+%(u[H8L[]A\A]A^A_L>1ɺ1H5¢JL>1ɺe1H5E1$E181ɿH5nRLhPLL$1Y^Rff.@AW1ҾlAVAUATUSHHXdH%(HD$H1d9H=FH\1ҾpH-Hi##ST1ҾjH߉#1ҾqH߉P'#z1ҾH߉#es1H߉#ГHHHt1ҹH=#H1n1ҾHD ȼ#\EuK1ҾoH߉-#އ1ҾmHA,HHD$HD$HDc#EEH=D$Ai#HD$EIHt:H01HH!ILDNuHD$HD$EH5HHDHH#H#1ҾtHvH߉#r{HLx 1L%ʟMtwL-AofDMMt\A?"MwLL H5ILܼtH5m@Lɼ MMuDL1A1LdL躹LwHHG#xHHG#nH߉#mzHHh E1Ht\L5QG0ML1Lm1(HmHt#}uH}@HmA HuD1H\$ D-7#H|$HHD$11ILLD$8諸H4vH9ݚ#H=#HtFH#H=##Ht&`H#H#H##HD$HdH+%(HX[]A\A]A^A_fL)1ɺ<1LfDH5#L詺uEDHut1ML1L衷XZrf.H5>LQtMH5sL> fDDU#EB#fF#O@&fD1ҾkHQ@HsH9ʘ#=H uH#HoH#H5!Lq~H5pLZ@̀4fk fD;U#@L1ɺE1H5'fH=誸#HD$H|$HHD$a$HL5#M1t$ DL$$LHHy^_JH=AL H5kIH1H#H5bLϷt/ML11+H56HS#H@#P@ML11H5 L B1LE1Lag躴L1ɺH5A薴H5ILRtH5IL?u[L1ɺ"1H54H=1f#衽IHEH5LѶu MLP1LY1ҳ6L% LL裳Y8蒺}IHUIHQH HDAP4L{QH5P1HH 躽f.AW1ҾAVAUATUHSHψH1ɺHHHH1ҾH7HL-L5< 1҈~H 1҈~H 1҈~1ҾHl1ҾHHGLHIIDŽu-D蓷HDX@II%%uAw@EtU@O+IaLH@8tHuL-1ɺ1L3LtyfAwcILDIٹL4H53H1[]A\A]A^A_fL1!L-v1LML1L=)ְ1HDžGH[]A\A]A^A_f.LGH[]A\A]A^A_DAwdIHfDU1ҾHSH|uHH[]uD1ҾH|HuVtH-LS1HH11Lx1֯H1[]DHktHZtNAWE1 H b"AVAUIATIUSHdH%(H$1Hl$@H1MMHMLt$fDMM+If1HL1)D$ )D$HD$()D$0HHHtHhHA$PL=JHmHH} uH]1;@HHHD$P $H]HD$Ls MtvL+LLuMAuAI$I~øtGMvMuD$fDH5tL虸 H[HtD$Ht$Lz$L\/1ɺH5$豭_D$fDMi1H-LHnL.1ɺ1HQH$dH+%($H[]A\A]A^A_ú"LL4iuCHkH'$맹tH-OLIHҬ_I$Ly$tAADŽ$PIٹ1LH5聬$%L.1ɺH5ɑV̶ff.AUL)ATUHSHH>uHLMHEL-#1IHhHLH}YIHLFID$HHH H >I$H(ID$H(L L(;H8AHD[]A\A]1E1LH5!HD[]A\A]1L,1ɺH5gE1HD[]A\A]fDH0AątQHA[D]A\A]D1LH5茪HD[]A\A]fDL,1ɺ1H5ϏW譞ff.fATUHHhu)1-H8HtYAHD]A\1H5KAąu1Lu+1ɺH5BʩHD]A\1E1L?H5 葩ff.@AUL@ATUSHH@I9t_Hf.HL9tHHs1HAąu1L*1ɺH5HD[]A\A]@HA[D]A\A]ff.AT1ҾUHS~HH0IHta1LH߳IMt []A\DƃL1H5Ս][1]A\fDH}82VHHHxHHHǀ0H1H)8HHH0HHH H(H !f1LZ)1ɺH5'诧1HDž0L>ff.@AUATUHSHH>ty1]IHtjH L I9u BHL9t:HSLHeu1ɺE1L(H5aHL[]A\A]ILq1H5/跦DAULoxATUSHLgxM9t]H/H{HTt3I|$0Ht H>tM$$M9t)I\$(HH!uHL[]A\A]HE1[L]A\A]AVAULoxATUSH_xI9tgHL5G HL9tPHS8IM1HH)Aąu1L\'1ɺyH5)豥[D]A\A]A^DA[]DA\A]A^ff.AWfIAVAUATUHSHdH%(HD$x1H H|$ H\$HHD$HH HD$PHXHD$XH HD$`HHD$hH HD$pD$(BIH@8IHH(HPIHIHCHt>LHuE1HD$xdH+%(HĈD[]A\A]A^A_LL%I$L|$MHHD$L5H"$D,$HHD$O@AG 1LMLAD$1H|$ LpBIL9}HIHHX Lx(IGHHIT$H$ pEgH|$UHTH$H T$ID$0IT$<@H|$L|$Hg"L%Hl$ .HOIHHCI](LIE C IEIP AIE0t HtIMLHnMM(1L1ɺ7LH螢H"H9`Hv#襭HHmHhHC@@HHHC(HI"HC `nLK(L%11L!LH1HHVHD HC HHHC(H5"HC mLK(L1L/1裡H/#躬IHH蟬IHH#LHIE(H IEH}"IE TmH@LID$(HID$H"ID$ X ID$0Ht IL$LHlgHAt$(MM(1ɺ~LۍH51褠H#軫HXZH.H(HHHC(HHCH7"HC nlLK(L)11H5Ņ!HBHHHśHHHC(H HCH`"HC kLK(L11[H5B誟AL$!1L$zH|$pD$$L 11 H5CD$L2L 11mH5,L 1ɺ1H5hE1G$Lq 1L.1ȞD$LK 1L$5衞D$$L! 11H5tD$L1ɺ|H5bL6$L11ZH5#D$yH 3$H5A#H=R#諠ML1L1؝Nb1LH5Š謝L褢L@L1%聝E1Q1LH5WE1z1LAH5̂-E1IL[L!1E1[1LVH57ڜE11fAUATUHSHdH%(H$1H Ll$AAL虡H}HXHiJH`HT$AHxLHHILHLHH) H)HHL$L/H}HXHIHn%t$HA_tT$AuATfTcfKE18聢HL PHL}PHtH5P1AH H$dH+%(HĘD[]A\A]DL1HDžH5YH$HxLHHILHLHH) H)HL1HDžH5i'@T$AۉATTf.$ۉATTJATfT8萤AUATUhH1Ҿ{Kf1Ҿ~Hpw1Ҿ}HAw1Ҿ|HAroL>1ɺHHDpDDHAą1ҾyHez1HtoHHtHڄAąAD]A\A]L1ɺ1L%:H5p~LH1苄LHE1A11SD]A\A]f.1L1ɺH5~蟘D]A\A]fDL1ɺ 1E1H5}lD]A\A]LŅ1ɺ1H5}?f.#SHuNH=蒡HH߾HHD1H#Nd[ت#f.H5#=#j#fAVAUATUHSH(HtHx茜H(fH@H0HtHxaH0fH@=Hy#tH*1HH=#tHΰ~HLHI9t HGHCHHG PhHHI9uH}xLexHI9t HGHCHHGPpHHI9uHHtHPHDžHHtyHDžH@H@HH9tHRHPHHHH9uH81Hu+f.HHPHt :CHPHHuH@Ht讇HG115u {8 tF11~4t,H=f#H5IHDžGfD1ϝu 8 t1话~@HG'H/H}HtBH}HtBHGHtrBHD ˧#ED#Ej= #,n#Pe#H=#HtTH## y#H=޷#`#ҷ#Ht&HH#H#H#}#[]A\A]A^@D Q#Et#L(@ H5Ou#,H=5#Ht蛠H=t#H#Ht诘L5(#H-u#HF#LΠH9mL%*L1^LLu#Hu#L-H9t:fHIs LMe1 u#HY^H9uLL1Lit#t#z#(DHPHHQH8HxH@@f.۶ fD[ fDkfDLY1 H5<mH5#=#>e#5HIL HTc#H5Hu&HDžG1Hc#H8ȝCH;軝sfDAW1ҾAVAUATUHSHdH%(H$1]E1HD%#JRHHX L-Hu6u@IL1L%1H[HD;:HkEtrHHt0|/)HuHH=~H9HF t5IL11H5vE1腐HkϢ#Ht$H誕ADžD$(%=@#HSH=#HPH$HHT$>IHHT$1H\H$I~HHH=(#H#H[IH#IFH #L0L5#HA@HfK8脖H1PI1L@}L_XZPL_}1+H5},LK1LڠH5wtH$dH+%(HĸD[]A\A]A^A_A_]1E1LH5 t葎LE1{H5scZH wr$H5H=躘f.AW1LR|hAV1AUATL%{sULHSH #1+#=o#tH躲1HpH=x#tH^YuHLHI9t HGHCHHG PhHHI9uH}xH]xL/H9t!HGIEL(HGPpLMmH9uMEHHt$HDžH@H@HH9tHRHPHHHH9uH81E1Hu (LHPHt :LhHMuH0HHtHvLMtMHHt$苾HDžPHDžXHDžG Ht$AH8HD$Mt IEL8Ht)H^RHHHVMt,LH-RHHHVHHt$H AƅhtH5 -HDAƅHAƅ8Ht$HH8HMt IEL8HAƅ`H>Aƅ&HLHh"HǯHHH_UH/`HHHHHHHuYHH}xHHHPHHHP(HHEpHHEhJAƅfHAƅuHAƅHAƅHGHGH9utHAƅ #tGHHtHPHDžHiAƅpH#u:#H=##Ht&WHĬ#H#H##AHPH#HQH8IH@IL| 1ɺx1LӈfD fDL1 H5= 蔈L 1ɺ1LkHD[]A\A]A^A_fL 1ɺL1E10L 1ɺ1LL 1ɺHLt 1ɺ1Lˇ[LR 1ɺ1L詇9L0 1ɺ1L臇1ɺqLLgL1ɺL1ɺ1L7L1LE1L1LE1Lx1ɺLe1ɺ1L輆LLC1ɺ1L蚆*L!1ɺ1LxE1HAH9uLM1ɺ1LGHGHGLL1ɺ1L11LXL=#u#Lr1ɺ1LɅYzLK1ɺ1L袅2f.fDH-@HM@Hm@H@fDfDfDAHH1EDɾ AA f HA觫AAt H@1L*H5蜄1HDAWAVIAUATUSHHH9tGHIA @HH9t0H{LAąuCD9u5IAf.IAHD[]A\A]A^A_ÐHKLmMH@H HQLP1H5ϺσXZff.ATHUHSH躈H;L`L1Ht&LHH訑HC[]A\f.HC1LbH5ID1ATL%3$1UHhHLSLlH]کL H}HXH0HtsuK[]A\fDH$HxLHHILHLHH) H)։H[]A\@$tATfT1Lh H5ID[1]A\D2$ۉATTMATL%#1UL-HH\SHhLH跨LH}HXH/HtsuO[]A\f.H#HxLHHILHLHH) H)H[]A\Y#tATfTH IٹH,LPH51 X1ZU@#ۉATT9ATL%#1UL-HHW[SHhLHwL覅H}HXHv.HtsuO[]A\f.HY#HxLHHILHLHH) H)H[]A\#tATfTH IٹHQLyPH5϶1X1ZU@#ۉATT9ATL%#1ULHHZSHhLH7LfH}HXH6-HtsuO[]A\f.H#HxLHHILHLHH) H)H[]A\ٲ#tATfTH IٹH*LiPH51~X1ZU@z#ۉATT9II1HIxLIIǀHH)HHcI HЃ tCt?A@tAHH=tA uDADE1f.ATSHHH=j#+IHt}HPHxHǀ1HHH)HID$ Md$AD$@ID$PID$XM$$ID$(ID$ IT$IT$I\$8HL[A\DL1fH5j|f.AUATLg USHHo H]I9t4IfDH}1AHUHEHHHBH蕁HL9uH[]A\A]ff.fW0HGw8LO LG уO0HO(h@IHLt'HxXHPXtNHW HP`HW(HP`L LH`@HxxW0HPxt!HW HHW(HL LP@pSHy8uQA0uKq4HQ HA(HBHHAHQ HxHHpHtxHq HpPHq(HHPHHPP[D H]qL11H5jU{XCZ[D HdqL1oHq4uaHAA0uGHq HQ(HVH2HxHHQ HpHtsHq HpPHq(HHPHHPPHh<f.HqD 1L0H5zXZHnH蓀=@tlA'AtA uHfDAt1L1ɺH5 czHHfDHdH%(HD$1HHT${(tD$HT$dH+%(u3HfD1L"1ɺ H5|wyff.HHH5TdH%(HD$1HHT${AAtHT$dH+%(u*Hf.1|$wظu1<$`AVIAUATIHUHSH}K<4HIH"|J<3LHA|uE1Et[D]A\A]A^Eu AuE[]A A\A]AAA^ADÐUHH(HGH9Gu"5}H} 茄u>H]}1ɿ1_L H5wH} Nt襁8~H-1P1L ߮LH5wXHZ]|fDAWAVAUATUSH8dH%(HD$(1LT$pDO0OI)MIHI ALcI MăuH&#HtD9-#<@HE(HH9HSH HQH HxHPLSHHPfHSHPHHXHCCH#C(C8CHBLs0S,1ELK@fS(HD$ Lc8Ld$ H} LO|tA,HD$(dH+%(OH8D[]A\A]A^A_fDLѐ1ɺ1H5D/vE1f.LW1ɺH5vE1@L9KH9Hc #L)1H5ڬHHHt#HH)LM9H5H>LT$11ɺSLATLL$ Ht$uuI9XZHt$LL$LT$I#HE(HSH HQH HH#HE1HCHZHSH51APL/tYE1^oLT$H5Q1P1SAPL-LL$0Ht$(tH Ht$LL$LT$Hco#HLP1jSSATotH0E1LT$H1ɺAS1L\$ SAPLLL$(1tH Ld$LL$LT$~ohjif.AVE1@AUIATIUSHdH%(H$1ILHI|$ L<}Hl$HLt(Uƅx H=wVAID$(HSHsHKHQH HHH HSHCHrH0I9tH]HEH{H;C u1ADH$dH+%(unH[]A\A]A^|8yH-1PL &1LH5̩rX1ZH z3H5H=Bu }ff.fAWAAVIAUATMUSLH(H|$uHD$H.H #IcLH L,<1H4$ ~HH9$L)H E1Hu$pHIL9H#IK4cA9}{L$HT$HLt_$<#LHLEH $I<$MH1_ID$@ tD|$ HbA9|H\$T$HE|AIAAA@A~ID$xtC@@:RfL1ɺ1H5$]f.IcV(HHtH $I<$1H<{_ID$H $I<$IHz1^_DH $I<$IHiz1^*DH $I<$IHz1^DH $I<$IHy1z^DH $I<$IHay1R^DIG8HifDLaLHID$xƄ$L]@LL1ɺ1H5[fDAWAVIAUATIUSHHLjHco(dH%(H$1D$ AE  AEL= "HT$AT/HDAT@tIEHtJIcT$(t?H5LcHH;MHLHL P1\ZYfAH$dH+%(_HD[]A\A]A^A_fDL= "HDM$AD$uLt$0A$ALᾀLHKDiA@t!A|$Ht$'*HKDiH $E1Ƅ$AtDHDIl8Ht5H^~)HT$ H$HTH $D$DifHD$'H HA@EjL ELVMDLQH;LP1RHAVu[H AfDIE(AEL="HDMEHLD$ADL$HD$AT@tXIEHt IcT$(uDAEHDAD$H{LaAfDH;LHT1ZLk띐H5ILaDL$LD$$L=/aLp7fDL="%@L$H5LDH}HH[fD$La1ɺFH51WD $LLD$DL$HD$\H{HI%HL$DL$LD$HcH{LLD$HDL$HL$J&HL$DL$LD$IH51DL$LLD$cH{IUIt&DL$t|HCLkLD$HPHH0L2LH APH@0@8AE AEf$L)1ɺDf.HCD $1ɺeLH@0@8fD1ɺ`D $LH5--VD $`ff.@AWAVAUATUHSHHH $dH%(HD$81B@LB t1AIMwL_HD$HHD$8#HD$0Ll$E1HD$HD$(IEA}HD$ &IEHD$I*fDx#LM~RZLLH$^#L'^IHuH} IHf@$AGHD$HtLxMMDYIUHI}BnFh^Ht$(H|$IcAMZAGHD$08AML|$MfDH} *IH.f@$AD$HD$8dH+%(+HHL[]A\A]A^A_SuSH|$XH}LhLHH%Ht$LaHD$0IG6DqH5t$ LK51s E1L{r^SH|$(TXXZ8D]Ht$(H|$ I&`AuIGuHD$08u1fLK1LYrH5݉RH5lj11ɺLOH4$RHD$H4$HD$ H|$E1HD$0WLK1Lr#H5ZZR@H|$KW1H5:1ɺ1LH4$!RH4$LKLq1E1H5QH|$VQ\E1LpH5QfAVAUATIUHSGHR t t @uHHA$"AA\D$ Tɍ/}HcUH5"u []A\A]A^LHHcTtLt[]A\A]A^fMA$2i5u+1[]A\A]A^u9b1fD1LpH5YTP1ADHAI9D$1DHAtHzIt$HZ1`HsH;1HIIHAEA9$u.LHLH%uMmMd$Mt MufDHCM LHxe Ml1tZH;1U 4f}t%HE f5H;1)fftH;1U HHcE E 1L1ɺH5N1S@AWIAVIAUMATUHSHHIpHFIH1AEAEAD$(EtvIE(HtmIL$ AEA} HAtQID$HH{I\$MtMgHL[]A\A]A^A_fDAEu H ЈHcH>fD}xуH}LLID$ID$ HqMd$wI~ HIf@UID$ T$ H}IL$ T$ L nH5S1E1IMIL$ IE AEBHH5HDHAIL$ AEAE AIL$ AufIcE HA fEHIL$ AEtdT$ H}1AU IL$ T$ HjID$ LcID$ LmIcE T$ 1H}AU IL$ AuT$ H?DT$ H}1AU IL$ T$ @T$ H}1IL$ T$ fDL1l1H5K_ff.@AWHMAVIH dpAUATIUHSHHHH9HLLl$PHDLD$1MEH $rH $LT$#ME1HLLqL PLDxD|;DLHEH@<HHLxMIcLME AU(MIxEWLEAu.fH[H!uEWEAAGuEML lGH5<11E1J0DMMLj1E1*H5ՀIHD[]A\A]A^A_EWAD$UAGJf#EPIcALEgA  HDmH HrQH#IIQAHHP1AH-+#oH DH臲AUMLjS1ɺH51E1HAYAZ fDEWAEA AGLHC8?EML?kjH5<11E1rHDEWEAD$DmHH H\QPAAQIIH#H1HH- #nt$ H HgAUMSLui1ɃH5~1G_AXfI} EM2Lh<1ɃH5~1E1GAE(DDmD$HLAPMH AAPAAPE1LLH~kfI}  f#ERL ~fDLo1I9L#DKLDxD(7DLHEH@8HHt LxMEM=Lg<1Ƀ@I} L C~H}LEEH-}LiH<H11AVEXL~Z1ɺTH1E1E@HH Q1DeQH.#IɾQL}HAQHgH-#AOlt$ H H߮ASfDI} Hc}L }LDEL)h<H1AVH-|1HEYQ^L1fDDmD$H}HH qPAQAfDLcL$L3L$@EM^Lf<H1ɃATf I} Hk|L |LDELig<H1ɃAVf#EL %|EL { Lzg<H1ɃAVAWE1AVIAUIATL%_!USHcHdH%(H$1HII,LUHg}t'M1LsgH5_zZCHIE1P@utI1LP AuLLt3H$dH+%(u3HĘD[]A\A]A^A_D` fDLL2AXMAVfAUATAUHSHH0dH%(HD$(1Hܾ)D$HD$HF HD$HD$ H<$H7Dh@1HL$IHH$EHHD$L5yHILf1P1LAXZH<$Ht Ht$HC HtDhHD$(dH+%(H0[]A\A]A^HyHHED$L5xHILy1PyfDL5exLeL[AH$H{yEtHoyE1KL5xfAWAVAUATUSHxH|$Ht$ HT$(dH%(HD$hHHD$HH$HH $Ld$0HHL$HIHH $L=HL)KnLt$Ld$0f11LLIF)D$@)D$0HD$H)D$P<HH|$Lx H@Mf.A?vMwA<@u AFIYHD$L@L9uCMmL93IuLgJuHD$HHD$f1L1)D$@)D$0HD$H)D$PHHHD$LxMteMMI} tIUHEf1L1)D$@)D$0HD$H)D$P%IHyIU IV MuH<$HHD$ H\$(H@HSHt!HtHZH9XHPHD$hdH+%(THx[]A\A]A^A_MMsH<${I}H5ILEH5vLLD$HLD$uI}H58HLD$tIH5LHI}H5lH|$HtH|$H5HIU HfDHH@HuIF HAHEHH@IEHELhfDHD$ HHH@HL$HAHD$ HHHBHD$L`M0H-Q!f.Md$HD$L`MI<$HGtMl$MI}HGu{IEID$IDLmIEJIHD$H|$ HH@8HZH9XoJHf.M[FAWIcE1AVIAUE1ATIU1SH!H($HHHT$HD$1HL$;ILLLLHLEHHHH(CA9$uAT$tCutCuAD$wPHAD$f9CwtsVf9rMtS{YELLLLTuAD$f9CFtsVf91MuLD$HL$LLHT$D\$!D\$HI}L `1yH5q:H(L[]A\A]A^A_f.H KAt$f9stSf9} ]fIL$Htj)GC=AD$f9C@AD$f9C Sfrf9dL^1-H5p9 2DAVAUATUSHdH%(HD$1H>HH/HAhBIHu`H0IDHLH豴L$$MEl$HD$dH+%(HL[]A\A]A^IL6^1E1H5o8@1E1LqH5o8}@H0LDHH `H$HH;(RIHfH@ H@DhG=H;LhLHHtLHH2FHH0IL$HHI$HIT$HL"LBA9DH@HH RHsHL ʺ PL\1H5yny7XZKfLo1 H5QnL7 L̸1ɺ H5!n!7L1ɺ H5m6sAIF+fDAUATUSHHD%I#EH~ tAHD[]A\A]@H0LFH1L-#HnLE]sLHC HHtsHAąH0H HSH HQH H H(H3AHSH(HH(:@LN1L[E1+ H5l5HD[]A\A]L[15 H5l5CHsLmH5VlH@H+qL кF 1;5HC ZYHt HxHC hu)DATUHSH~ HCL\t%H5k1E14D[]A\H8HPtntiHS HH8AHJ[D]A\AąiL1ɺ1H5Dk?4{f.HHHQ:tcHS HPfH8HPt&eLZ HHHQ:ufLaZf.AWAVAUL-/!ATIUHSHcHdH%(H$1HMtH~zuH0D$HuLHD$HL|$E1LMTLALT$LT$Azt'M1LVH5i2HIDE1P@utZLHP AAvLH膦|$u7H$dH+%(HĨD[]A\A]A^A_Dh fH8At$Ht1HPHHtHHPHt;2uHPHtKHQH8H@tH8DL6APfDD$fDH>AWLcAVAUATL%!UHSHHdH%(H$1KM,HzuH0D$HuHHD$KLt$@E1LMľLALT$聿LT$Azt'MN1LgKH5sXn!KIE1P@ut]HHP AAuLH)|$u:H$dH+%(CHD[]A\A]A^A_fDD` fH8uHt1DHPHHtHHPHt;2uHPHHQH8H@mL8IcHD$Mt\Ll$DMMtGIf11LL)D$ )D$HD$()D$0HtH@ Htu D`HL1Mt$L/J1H5 #XZ@D$fDH%K*ff.AWLcAVAUATL%J!UHSHHdH%(H$1KM,HzuH0D$HuHH@D$KLt$@E1LMľLALT$LT$Azt'Me1LHH5UKIE1P@ut]HHP LcAuLH詒|$u:H$dH+%(CHL[]A\A]A^A_fDLc` fH8uHt1DHPHHtHHPHt;2uHPHHQH8H@mL8MtdLl$DMMtOIf11LL)D$ )D$HD$()D$0襷HtH@ HtuLc`HL1MATLG1ɿH5Ae"XZfDD$fDH%'ff.ATHILcMtUI@BvDQ#MLdGH5TPHP#1h@B 1ɃXZLA\fA@BLA\@USHHtAHHHt\H;HhtuHSHHPHSHHCH[]1L1ɺ&H5UOH1[]fDL̝1ɺ)H5T!1xAUATUSHHtmHIHIH9u:f.HH9t(HsL\&uH[]A\A]HLHL[]A\A]1L1ɺAH5:ToH1[]A\A]fAWAVAUATUHSHH6L"HT$HvL9tjI@Mt$L3 LHXHIHt|HLH)H]H9u CHH9t8HsLl%uM$$L;d$uH[]A\A]A^A_fLHLuH-XS)DH-JS1ɺA1L HlH1L1ɺsOH1[]A\A]A^A_ff.AWAVAUATIHUHSH(Ht$L$LHIH4IFIHD$8IXL)LHpIHLLH'LLB(HD$L|$uBA?tTHL H HL$HuLl$LcLHD$vfDIHHLtA?uH(L[]A\A]A^A_LC1H5QLLE1@Ld1ɺH5QH-qQ1 HLqQH1L/CpFff.UHHGU0HOH8t]LM LE(uI<$MHDuHT$dH+%(uH[]A\A]A^fDt@AUHMATU1SHHdH %(HL$HOHt)H8I-AĄt H$@LHXH H<$HD$dH+%(uHD[]A\A]AWAVAUAATE1UHSHH(dH%(HD$HGHtD H}L7I H9tHAL|$HD$4HD$LDHx< H|$BH;\$tCH}HMHD@uHT$dH+%(uH([]A\A]A^A_D ff.AUATLghUHoXSHHLH,@H{hI9t2HGHHBHGuGuH H{hI9uLL;t#L-fDHC LHPL;uH9kXH[]A\A]AVAUATL%JUSHHH@HdH%(HD$81Lt$Ll$,t$,HLLHD$^H;tDHC LHPH9uLLD$HHLHD$D$u!HT$8dH+%(uJH@[]A\A]A^@HHL$0LD$ LD$ HsHPtD$ )D$:f.AWHAVAH1AUIATUSHHH?H/H HHII1HHHHt2ILDLI)I9LGLD$AULD$tXM|$L)tfH1DLHN$8HLLAUt+Ht>IEHIL[D]LA\1A]A^A_@H1[]A\A]A^A_H[]A\A]A^A_@HDHL$0HL$1fDAVAAUIATIUSHH5\HWHDHH HHQ Hu,EE1Hu6[D]A\A]A^HHÀ; HAbt8 M1ɺPH:LP1H5XDZ[]A\A]A^EdRE18 1M麄PHh>H5OPL1[Y^$@H?M1LJ1H5E1E8 M1ɺ~PH>L(P DAWAVAUATUSHH $HH $H81ҾdH%(H$(!1HAAA9t-H1ɺPL-L?=1L=AXAY1ҾHLhH+=HL1*LA0LHG"H5g;1ҾH"LVM-"{1ҾHH`eIHtmL5pHLH5mL RL/1ɺ o-7#LL ufD7#1ҾHLh"HŦHL1)L./vh"Ƅ$ L-0L/1ɺ1L$ 0"1ҾH1h2-1ҾHH 1҈H5РHIL5LLx1ҾH HHt!L5HLH=:7 H1ҾH1ҾH|81H1ҾH1ҾH"#RL:1H51ҾH_H 1҈H5G:H8HIM 5H"LH3 tH5L hH{HtQL` MtHHfDA<$u ID$8u ,H1L0/Md$Mu1ҾHv7H 1҈-H=!L 1ҾHL "'H 1҈H ЈHLAą1ҾH.1Ҿ%HHDžH1ҾHD L5HHEtH58H LHo H5!HH5f8HH5X8HjH5D8HSDH5:8H<-H5H%< H1HHc?L-Ht 8IL/1Lc1f1ҾHf)D$)D$ )D$0)D$@)D$P)D$`)D$p)$H蛾HLh ME11L=J7L50fA}u3I}LH|$H|$LDDDMmMutpH`H"L$ H.LHHD1#xRLt$1ɺLLKt |$THHtEtHt 1ҾHAK"1LY*H51E1RH$(!dH+%(=H8!D[]A\A]A^A_fDfDH$ H"1JzUDL*1H5L-1ɺ1L)LL)11Lo11L '*L4LK1Dž|DH5e7HVL-I11L)L*DLt|1ɺ=1H5?pfHL-#I1hL21L*YA^H$LL8@L '1ɺL-1L4H3H"D1ҾHL5ԧHHfH$ Lx$8%=@L-M11L&Lƅh"Ƅ$ f.HH8DLEUL-I11L)UL%6H$LPuk$%=`mL81ɺ"1L-LLg(LL#(1ɺ$L1H8L81ɺ1L-L'Lv18j1ɺLIL11JL'1ɺ{1ҾHL$ H1HLL-u1LH9h"Ƅ$ H#L1H0H{L%SH5HsIHH#L5i#L=0fLHIHtxLH]uH=<#LuLL%#uIM1H$ L-H?Ƅ$2L8ttL-&8=#LH4IHHDHH xAPL #LQP1_H IfDL$L-1L)@HHt7HL5H%1HHHuL-DH=Z2H5[2fHT$)D$ L$L$ HH&D$'LPD$.PD$5PD$-MtLH#LH$0LDhDH<$DL HHdLhMWMH#LH$LDxDNH<$DLHHYLxMLH=M#sIHfH@H=#GHfHhU`InsI?IOL8LHHIOHIGU`H@LA81LpPH'H5PLL$ 1XZLL$1E1LJ!H5^tL}L$@ 1MH ߾"HW'L0L$@0LLL$wL$1HL$8HT$4LH5PD$8Lc|$4Ht$Lk1ɺH>;fLL$1E1LbFH5MLHLwZAVH5LL$t'[H@L8MFLxLxAL k11vH5N_ALj11H5%68tc|$@HH#IHnWHDAPLSOH5E1PLL$01H =LL$L111LH5fATIHUHSH;"HHLHsHu[Li1ɺH5&<I$I9u 'HI9tH{HuHHCHBH[]A\D+ff.AWAVAUIATUHSH(dH%(HD$1Ld$Lt$\$H"LLHxI9L*AHH@E11ɉAD AAD HAUL=-1RLp!L'LL\$$H"Hx _AXI9H9iLh1ɺIHH-"LLLL$\$H}LD$LHH=LL$LLL|AąAHD$dH+%(H(D[]A\A]A^A_HAUH- 1RLWHY^LL3|AątLtg1ɺ1HXfDH@L8L-(MH‰քL9vH@8AL+AA % ʹR P@ AU% H-PH1H LL<{Aą}L}f1ɺ%1HaLxLDf1ɺ1L(fDLLE1oHt$H=#".f;H@LMM&Le1ɺ L1E1fA@H AIǨL%AWA AUH5U1AH 1LHZ MHAL A AAD E@H@8L=$L % LRP1AUQ\$4LH H"LHxI9HeIHH-"LLLL$\$H}LD$LHH%LL$LLxAąLc1ɺ1LPAU*1LQH5E1!XZf.t!%H@LM)LHfAWAVAUATUSHH $H81ҹdH%(H$(1Ld$ IHHD$LHD$ LL1Ʉuf1N@1ɈHBHttLH=f"HLH uLG1LE1gNfHL$H9L$L%@IH-H@H|$H@"A}H M@%Lb PD RAA%AAU к9P1ATL%\LoH0fDLF1LE1cBDLF1ɺ)H5GL-@1IH5߲LALiF1ɺ/1H5.A"LAF11-H5dGH|$z'H $H5IH=IHK"LE1ɺZ1LE1;H"@HtHHtH9t H@DH"UH H="dH%(HD$HHD$H$HHD$HtH11DL$EH=D"HtpH-;"HtHUuHqHWH= "HtH="HtH-."HtHUuHpHH-"HtHUuHpHH"1H׋T$H1HT$dH+%(u9H ]f.L1H5{fAW(AVAUATUHH=SHH"߶H"H(H[@H@H@ H"H"H.H"H(JH(@H@H@ H"HdLh@LH@H@ HT"gH="L`L4oHHLLMHH3".HH"H$"H5"H6"H'"HHHP 1L  uD IcHRDuHuH=$IH<DHHinHD$HHD$H[ H,Hu,d@LLHH^H[HEH=LkL1LLxLnHuHEL4H-ҭ1H޿LVm0H"fDH=y"4m1L>A1ɺH5}HM"舿1H[]A\A]A^A_L@1ɺH5;QH1[]A\A]A^A_L n1L1ɺH5L1H5ܬH"H1[]A\A]A^A_@H-LR1H衾L-@1ɺ1H脾fL1H5KHf"QjH-*1ɺ1L?H(L1H5H"fHt$H="DH"HtDLHk8H-LqH虽LkLfDUHSHnH\H"HxH9t!HH>H9t H1[]HDtuHGHH[]fDHGH[]ff.fAWAVAUATL%ªUHSHL7dH%(H$1Ll$IL9uIf1ɺ[LL>腼IIFHBHHIH9HI~LHU8HD$8uH9tЉA %ALA LQ1P Av% кWP1M~H LH="LI HwH|$RH|$/(DH$dH+%(uHĸ[]A\A]A^A_ff.AWAVAAUIHATUHSHHdH%(H$1IH@`uxH;L|$ HLIM $M9D$8%=`pIL$8Lt$HLL$I9H $Ht1LHLH$dH+%(HL[]A\A]A^A_fDL|$ HL訿uD$8%=`EL;1ɺ1H5&wDHt$LȉD$H"HxE1H $LL$I9*DAA A% Hw"MtIQL$HAɿUALPA AVL5n%RL 1P1oH0LL$MHD$H % IHt L9HH5њ"IR8L$HULQA1PA VAL% кP1ָH|$0H0Ht$HHH;IHIL4L1|IL1ɺH5=1E1I@ILV1ɺqH5 1E1j@I$H3I9*HPID$8HIRL-¥L&L % 1RzP1諷H H诼H`"HHLHsH1ɺ~LL8aI$I9u,fDHI9tH{HuHHCHBHLE1/pf.I$HCL9:LHLHrHy"@H@LLt$HHt$LDD4$ȉD$H"Hxv $I9LHo/HIHI1LH5 mIL&1ɺf.L|71LE1亼ҵ#D+_L i"@LP"H@L8MAU AL%%A H5+1P1<XLZbLt$HL61ɺH5 ZLxvvfDATUHSHfC;CsHHHKL$HCHt*Ht%AD$`u1LHHAAD$`D tL[]A\E1[]LA\DAWAVL52XAUL-ATUSH1HXdH%(HD$H1I胩HHH16IHAG8%;uMLLLHuIHt L9L "AT11ɺAULH5贳A<$1.0XZtA<$0.90jA|$^AHEHth H}rHjHD$HdH+%(uXHXD[]A\A]A^A_LH^E1L41ɺ1H5E1}ff.fAWAVAUATUSHH $HH $HdH%(H$ 1HxHH}tM Јu<H$ dH+%(OH []A\A]A^A_fD11fLhL$1LHn L2LOL$LLtZL=M11L, 7L豱@LyLg11D$ yD$ 1Hh2ILHy .LD1H5!211Ҿ|}uH$1HhH HkH$H1ҹHHh2޻H)ƃgBf1ҾH|u])HH8HHFHt 8HvHu1H߾躅HHt1I!LH5į1VDLL'`HML=L P1vX1ZDL01ɺ1H56GfHSkf1ҾH)D$ )D$0)D$@ɄHH8LhI1L$LH LUHt$PL@1腽H|$HD$HHLt$ H 0L1HH$1MILH{ HHL~x.ILe 11H5|L/1ɺ1H5ʛۭjfDAWAVAUAATAIUH@ASHHdH%(H$1 % AHL|$HL襲xyD$(%=`HD$8HHHD,HIHXH$dH+%(xHĸL[]A\A]A^A_@AV IAUHLdHHD$1赬XZHHL?HHLHȱD$(%=`(HD$8HH9AV %AUH5I LA1R P1Ht$XHH 1ɺ E1L}-H5șޫfkIHWHt$HLFAVH-M1AULHE1 vYL-^1ɺ H1W:fH.HD$H\$I1L HL,1ɺ H޿1E1Ht$Lw,11 E1ΪfUH-1EAVH L蓪XL,Z1ɺ H1tWHH-B1EAVH L 8_1AX H1L+HLE1AVH\$ HA[Ll+]1ɺ AVIL1AUH\$ H蠩AYL*+AZ1ɺ {@ATUHH=/"SHQWIHtaID$HI$XLHHPt L[]A\IٹE1LyH5fDIٹ1LH5Ѩff.@AT!UHHӳIHt(1ҹ!HHɳHuAD$ HL]A\L)1ɺG1H5,RHHHHAWAVAUATUSHHoPHLXE1MtsHHHO@H9u ZHH9txH;HuLh E1Mt@DpL%DLLEtIfu1AfA9t.HD[]A\A]A^A_@E1DfE1HLE1AfATUSH/H]H9tEIfHEH} HCHH}(H}0 HHHL9u[]A\fAVAUIHATAUHHݫHLHI,tEH5QLAąu=-L萯HtHxLHE1AHD]A\A]A^@HE1]DA\A]A^ff.AVAUATUHSH˅~AE19IH01HxH*Hu AƄ$H;fEt$fEl$HCI$ID$L Lc[L]A\A]A^fDH5oAt2H5#HE1ިuHE1oHAAE13tAE1!fH5A艨t;H5HAktH5HE1PAE1-LY&1ɺ1H5謤AWAVAUATUSHH $HHfAH"AdH%(H$81ID$,I)$0H$@H$0HN`@HHD$4HLPZYAt LcD$,Eu0H$8dH+%(VHHD[]A\A]A^A_@1IEL|$0HD$LHH$4HJDHD$H9AH$0L5]L<u,CLK< <D<$AfCH\H;\$S1HHЃ< <usH{HILL1YHL$LAĸA9DO1fCH\H;\$ffAD<8SHsLI萦|$0eui.|$0naa.D$CLK<<HCME1HD$fE$IcLHH1A+IL9d$uILL1=AĸHL$LA9DO1JEDA6@D$LE1mI9s-KK /LHC/I@I9rHL$t$1LHCME1HD$E$IcLHH1A+IL9d$uILL1=AĸHL$LA9DO1JEDD$HHC ME1HD$E$IcLHH1A苬IL9d$u[HC ME1HD$fE$IcLHH1A;IL9d$u HCME1HD$fE$IcLHH1AIL9d$ufDAWfIE1AVHMAAUATIUSHHdH%(H$1I)$HN` L)D$)D$()D$8)D$H)D$X)D$h)D$xjL$1< L:tu z1HcLLDc`AAu!11HKLXHMtIAH$dH+%(HĘD[]A\A]A^A_DHLE1AjHLHAXZEt$E1t2fz0BHcLL8fDHH|ADLT1ɺH5~詝#ff.@AWAVAUATUSL$HH $L9uH(fdH%(H$@1IH$ )$)D$HH|$ Hfw8HHHcH>fHF8I;z QCL$fv{H$tGL$L"tFHfX tE_H]Huڀ$E1@L$E1LLHl$LHH|$_H?HDH9wHH9t8_t@f$HL\LHH$TL訥IH<H$@dH+%(KH(@L[]A\A]A^A_Fb@H}HH9HkSH?H9G9uH#IFa@^H}HH9HSH?H9G9uHˤI'|$t|$1|$0H5HСHH/f.H1MULZ1ɿH5<gXZtH$HALjE1H\H$ _AXbfL$HE1AjLH$LH5'LY^Haf1E1D$H$ L$ HHALL)$ HfjAA\A_$ L$tLLK$HALHHD$ AHLPAZA[tDL$EHtHEHt H9L=z"H5LJ}L/HD$̞HPHLEA/@?LD$H1A,HA,@t HDQtI`Hj"H$0HUHHHD11ɺLH薑$ LLHH99H=y"HtHx跡IHLW1ɺa1H5誗DHh\L$ L Lxo$ fDI9LGH$ fu OfItGB<8 tMt;LfHIt#x tHpLLBƄ<${L(H-L?1ɺ_1H5lE1菖LD$ L 1ɺ1H59_ՠDAWAVAUATUSHH $HfH^ dH%(H$1IL~ H|$I)$HL9t{L-8fftH{u4HL9t[kftf uH{HtLڜHuft̸H$dH+%(H[]A\A]A^A_ÐLLHHt/HH5yHHtL1;늺LLHID$8Iǁ;z t|9z 9:t*AD$a@tID$I9D$.LL-HHE1AjHLLgZYt@H萙LLHH*ID$8IǁJ%9t(1L1ɺ;H5"1qH H ι諙tH59H1H5)HH5HA|$8IAWAVAUATUSHH $HHdH%(H$81IHHHt$,It D$,9Et0E1H$8dH+%(HHD[]A\A]A^A_Ðf}L} Lt$01ҹLL*HEfI\$ IL$ H9t"H{HtD}fD9{_HH9u߾ HL$軝HL$HHkULLHL$UI|$ HCIfS7ID$(HL$HCH HI\$(Mt%LLHL$T$詜T$HL$]fAD$`@@M|$ID$HD$I9u@M?L;|$zI_LHL$H6HL$AuҾ 軜HL$HIAT$`aAGAw H5D,fEjHLT$HL$T$LT$I|$ IB HL$T$I IL$(ցIJLсMT$(DLeHH uMT$0HAT$`HHDAUfwIJ4)I$HRL9IHzUL tDBfAwHL LT$L1ɺ P1AVH5!WAVDLT$(H ABfEDƄ$/:_L H2|$0_ LIDL9wHL9t8_tf}@|$0t|$11|$20H5L賖HLDIMt$8X I$Ht L9wH5q"Lؙ D%91ҹLLHtI9*HH5TL`t H5ELHHt$0L{Ht$XI%;B \ID$8  ʉ@  9.I $%HL9 LIVL1R PAWH51&H f AHHLm fHLЗI|$ HCID$ HID$(HCHI$I\$(LeAL$`I\$0HL9HHEL qPfwHIQL1ɺ( AU1H56AVXZLЗI$LeAL$`I\$0HtiL9tdHPAGL IqfwIMRLf1ɺW AVwfDHpL蟞f.H in"H]n"I$LeAL$`I\$0Ht9L9t4H@JL pfw HIPL1ɺr AWHn"H=m"@GLHL$HL$0%AGAH5-D,ID$8 % I $HtCL9t>LIHL1R PAW`LLHL$AD$`HL$L #m"L 1ɺ 1H5%K L l"L 1ɺ! H51oL 1ɺ` ff.@AVAUIATIUHSHHHv8HdH%(H$1HD$%;G 9G tj9j9GLLHD$HnfUHH$dH+%(HĠ[]A\A]A^LLHD$HufLL`Hu@HT$VtHD$eIE8I$;z L, 1ɺ1H5YIE8I$;z L 1ɺ)1H5>AE8I$%DLLHD$H LLP HD$Ho LL- HD$HL LL HD$H)LLHD$HiLt$ L H5~L/t{LHLt$ L 莍6H5L@L藑HtOJAE8I$%L 1ɺ1H58 L1ɺH5Dff.@AWAVAUATUSL$HH $L9uH(fdH%(H$F1D$lD$hD$d)$)$ )$0)$@)$P)$`)$p)$)$)$)$)$)$)$)$)$0u8AH$FdH+%( H(FD[]A\A]A^A_fD1ۀh2Ht"H$6Hh21,HHAL=(k#L5LZHLHDʀ=k#IEHAQA1RSRP1sH0`<`LL1M9t1I}(HtBI} Ht2MmM9uD-0"E=`j#t41HL$hHT$lLLD$dH5N|$lHh1H$H HL$8H|$nHh21H$H0HL$HH|$:bH|$(H|$H5 /HD$(HH|$113D$49H1L9tfHL9uHcD$HHt$@WHt$@HHD$ LMtLL1Mt ;\$3D$dAH$H`H|$@DH1~DT$LL$@Hc1H|$ L HA)IcDT$P蝏DT$PA9 D 1LHH|$@LD\$PHD\$PI9Hl$XL|$ DL}Dl$PgfwHM 1Dl$APHcLQLPA)RIcH1H L&D9HL9HCHHHH9HBf.H8/IEHK0Ht .tuLHS sL fDCHҍ~IDE"fwHM 1Dl$HcHLQLA)PIcRL1ɺ1Ls,fDHLeH5L誄tH5L蒄L%b"Hb"I9tE1L-/fDI|$HHtLQtM$$Hb"I9u҅= "LLh211L7蔀+;8 k1LPHLPLL$ 1@XZfLY1ɺ1LLw1ɺ1LLH|$ H1]=LR1ɺ1LfH|$ 薄H|$(|$4+1.8gP1LPH"LPLL$(1<XZDHC(H`"@H؜@L1ɺ1L~虈8҅1ɿLPHLPLL$(1~A\A_H|$( t9P8艅1ɺMLPHLPLL$ 1^~[]|$4 L1L,~ADl$PHl$XHt$ IcD$L|$p1D\$PL$LHD$p3~H;t$LAHGH0HDVSAPLPLM1H D\$P*Ht$(HLD\$PƄCD\$P&Ht$(H|$ D\$P"D\$P*H|$(D\$PD\$P3H|$(D\$P}SD\$P2H|$(D\$PGD\$P8Ht$HH|$D\$(D\$(C|$4D\$D\$h|$4D\$0~D\$&HD1ɺDSL}LASD$ PLL$`1B|f$HDŽ$)$)$)$ H HH|$ L1L{- L1LDl$P{=|"LL}11|{HA#DڿϦD\$PED\$PD$LL1L%{%L1L{[)L1Lz6Lb1ɺ-1LzL@1ɺ/1LzL1ɺ21LuzH|$ kL_L18HzH|$ >贄1ҾHWD$4H$&HL$8H.HD$H1_H|$OU-LL$DHL0HH$6eHL$8AM'1HHH[H5.HQIHHL:H|$ L%LzLynLnIL-1L1xH|$~HD$HzE1H$E1E1D$HD$8D|$(H|$1HH{.tL{L}P݃ wHS"f)$L$Hs2LH$S+H$LL$P$S/)$f$HcHDŽ$-|H|$8 1輅H 1HD$H覅H|$P 1HD$@莅LT$HAT$AA9vHL$@E9A90(1ҹ0LDL$H$贂DL$HuƄ$D$(AADL$L1ɺ?1L0wD\$L1ɺ=1L wD\$qD$4D|$(9FD9aH|$EA)AŅ Au$H5H|$H G"Ht$xH6~H5@AQLʽA1ATOLU11AWBvH JH;H t1H;H t;t;H t7H;H ufH;uAUATUHSHHH9tIIL-E HH9t2H{uHs(1LޱHCHtHH`H9uH[]A\A]LK(L1L mATUSHH $HH<dH%(H$1H$HHhH|HHqAąubHh2@1HsDžnAH$dH+%(HĠD[]A\@IL1E1H5l@1E1LBH5kz@uH1ɋIL*H5}P1kXZ?fL1ɺ1H5IokuDAVAUATUSHD%P#Q#A9EAվ1H@HH=LMUL5vQ#1HrL谑D /^"EDAABL1qAąBDpqD%]"AO#*AL11H5&E1IjHD[]A\A]A^fAHtHD[]A\A]A^1L_1ɺH5iHD[]A\A]A^L\ H51ic@1ҾHHD$T?HL$HIL1ɺ 1H5<biDs1ɺE1DLϱ1H5,i`A@L1ɺ 1H5hfrL-1ɿDL1L'hDljuE1`A\DL,1ɺ*1LhɐUHdH%(HD$1D$@H%=uaHL$uIL1ɺiH5 hT$HD$dH+%(H]@HȚHuLP1ɺmH5zg=h"HD$dH+%(HL11ZH52]\g@%=DM#6HD$dH+%(u:HH]sL 1ɺo1H5feqDAWAVAUATUSHhHt$T$,L$(LD$8dH%(HD$X1HD$@HD$ HD$HHD$@u(HD$XdH+%(0Hh[]A\A]A^A_DHL~11 H5 VQ1PH1ɺ UL u3LH5wNIFII~ HBHSI~(SI~0ySLqSHD$0LLd$(AZA[D$@Lq1ɺ 1H5'NHzA$sL1ɺ 1DH5AAM0L\1ɺ91H5;M D$IIv M$tH2/"HpUH/"0L1ɺf H5IMWH|$HD$00RL(RL RH|$0RL11 H5ϦLPKAff.AWAVIAUATUSHHHHt$@L$T$LHL$PdH%(H$1H$L$HD$H$H$HD$pHD$(HD$xHD$pHL$HD$0H9t8Ll$L|$0DH}tLm Mt f} HmL9uLl$L1ɺ 1H5K1AHD$HHt$LӖIHoID$ Il$ H9uHH9fxuLxMtIH9ufDHmH9tHuLUuI~9HpfL`H$H$L(HPH$HH$/IH !LLHIH !TLLHIH {LLHIH aLLHLLԬIHIH9 Hl$IH M?L9 IwHTuI~Hl$ Hl$LD$ HH f HBLD$ HT$TLD$ H AI|$ L@fDx IL$(HT$H(HHIL$(HH$ID$(Lb\ H$L*HBH$HH$}DHD$H@Hth H\$H;)NH!NH$E1L9t HAL9uL1ɺ)1H5HL$IM9x MgID$ IT$ H9Mfx6HhH)AD$`Ht$lLD$lWIDT$lE;IH LLHtFIH NLLHt)IH %LLH] IGH[HHOH9FHRHRI1PLH1H5xGIIGHBHAXAYHIL9tdHfHH9I$Ht L9tLHL ("1L 1ɺ-H5I%GHL9uL$M9 E1fM?AM9uL1ɺM1H5FH$Hl$H9n Ld$(HCHxHx0tI~@|Htlf@@ H|$p@0HSHJHHHJ0o HoQP(Z HL$xL HHHL$xHHD$xHB``HBHH9_H$L|$L9D$HLd$(Lt$DHmL9`HEHP0HtLH p(1ɿRH5l1LҔEH$Y_L9+LuHI~0LLGHXHLL1M1L 'LWHWL3H3L HI^K`HAH98H@MN Pw1WL`1H5DH$A[ZL9u KHL9t@H;XuIV0HHHpH@ H3 H3BH uHNHFH3JH3BH DHmD$HL9Lt$H$H;D$)Ll$ ILt$X@MmL;l$IEHD$H@HD$HuHD$L֓1ɺH5؝LH p(p01CH$AYAZHD$HX H;l$ Ll$8E1f.LeM|$ Ml$ M9t.DfAuIwHtHNWM?M9uHmH;l$ uHD$Ll$8LH0A}HL$MH'IEHHmHHaH9XLJVIGHHHH9HBHIL1P>&I$HtKL9tFH@HIL1P5H5q1BA[]DH1$"H%$"I$Ht L9H$"IĨPI1ATL71H#"HU1LIHPHuHCHHHmL9ML9uW@M$$I9FIt$LHuI~,HfHhH$H$HL$HPH$HHH$Ll$8HD$LH0HD$LӍ1ɺH5p(1S=_AXeH@MLHIH ›LLHC LE1SE1[D$HIL7BbHl$pH;l$( Gs1L1ɺG1H5̖<H !$H5H=%~?ff.AWAVAUATUHSHHt$8L$T$ L$@LD$PdH%(H$1H$L$L$HD$H$H$1D$ |$ u @ HLE1D$(D$L9bDD$$ϦIL-D$DM$$M9ML$0MtI|$uuD$ u fA|$u11L[L~;H}@XHtvf@ H$@@0IT$0o HoRP(H$It$0L8|$$D$DHPH$H H$AD$$M$$M9LAH$L9ЃE1ƒHL}1ɿATD$(H5QPD$@PD$,P1Rli:H0L9$u  L1ɺz1H5-:1f/IH D$pϦD$tf.LHIH1AEbuHH sLHHtHH CLHHtHH mLHHtHH WLHHjH}LHSfLhH$H|$Iu8D$tH$H8|$pHPH$HH$KD$pfD$ D$`; 1L71ɺqH58D$0D$@H$Ll$8L9tUDLcMt?H}qHt,fL`I} IUL(HPIUHIEHL9uu/D$ D$@u%D$tH}H5ÖB DH$dH+%(H[]A\A]A^A_E1ɃHAL9uID$Hth I<$LHD$X>HHD$H$HfLK0HLH5>MLDȃ=5"H1AV1t$8R+D4H a?IH<H|$H0H|$($H|$XH{ 8H{(8IE HHD$`^ZHD$(Lk$HC HD$HfSHC(HD$XfAVIFAM`I} Mu0" HD$`HsLIIE(IFIE(L0Mu(`D$`M?L;|$|$`L|$L$D$D$@!D$ M95L%@M6M9MnMtH1LHHPH1LHHuA}d荨IUINHL9tLJP[1MQH5p1ɿ2XZHtHCAe``HI9 1DD$fDL "k@L "y@At$XH=D"+Lo f.M7I$H*L9!LHL^1ɺ1H51HHH$HD$LH9wM$Ll$MDt$HIHl$XLL|$`IHSHC L{H3EH3UH IWIGH3UH3EH HCHMaI$HTL9KHJHHNH9EHBQML1PH510A[LX1ɺH5p101ML1ɿH5Ep0HHCHBHIELM9Ll$Dt$HHl$XL|$`)D$pϦD$tD$D$01L(1ɺlH5҉/D$0D$D$@HD$PH.|$#L i"@HH V"HHF"LH5sT$$LL9H5BLE1D$(9H5LA9HT$$I9D$)fDLHT$xf$8LHD$(H$8LHD$X8H1HD$PH51H$MLaR3.^_WMtI$Ht L9H)"HMLˀ1PH5,1P.LcAYAZD$@D$tD$D$pϦD$LP1ɺn1H5Ї-HnL2H|$(2H|$X2H|$H2LO11=H5|-=D$0D$@yD$DD$$ϦH@HTL-͍L%1H5L.:IH1H=124Aƅ1Hn#;H$H$T-=M#IHHDJ1HHMLAWAIH1.AXAYHXDD$$L$D1L.DD$pL$t1H<L.LZ;Å6L7t6 vH5ŌL}:H1ɺD$xLH5ӅP$PD$Ht :L!e1ɺp1H5H uߋ%=h2HHh2HOttfDH81E1LdH5 %=BD%,"E2HE1"11ҾH?Aą,L}f1H5_p LeH5iLtH5iLσ fg1E1Lh2LlH5 T`HLJHfHLJff.ATSHHHtLHL[A\fDL%)@"Mt4HW8bLIHtCHt_LfDL1ɺ:1H5jm DL1ɺ=1H5Bm afHHt8H9t3LHB1E1LawH5m "L I!SHHHtGHǃ[DUH-lSHH@ uTHC@HtH9u0L !HHLl1[] LHf.8HHtH9u?L !PH=1PH-l1LH XZX@LJfAVAUATUSHdH%(H$HH H=w11H$dH+%(H[]A\A]A^H IHպLLHLlT$==ILHL1Y$=t =SL1Dt$D$D9A9H9HH-H9$HRHMRL4uAVPefL1Dt$D$tD9t[A9tVHtHHt H9H!HMRLtuAVPH5c1H `LeSfL<1ɺhH5rc1+f.HR~L1ɺH52cQ1f.H!ff.@HHdH%(HD$1HtH1HL$Ht<|$LUKSt"HT$dH+%(u@HD1f|$uL41ɺH5 iff.fAWH5AVAUATUSH8H|$dH%(H$(1+HD$ IH$ D$LH HE1B\-E tքt} L8HADG u^#tMc{ILHtaH5:hL ty H57hL ED$D$`IIkJf.}LCHHD$t)D$ D$@D$ \$ \$ tH5TL HHD$Ll$ @ALHAMc117fu<"tPu PπgHcуD IA1BD5< t't#HAWf tfu <"u'>|$ JHft$M1P1LfH5fL H="YHX^HHHt5,tD$ tADfDfDH=q"H5Z"L)1ɺH57f~ifLuDH$(dH+%(H8[]A\A]A^A_fL1ɺ1H5eDHet$M1PLe1H5eLH=y"LpXZL蛱HHt;AAEt"D$ AtECD5fBD2fDH=!"H5"E\$9LՄ1ɺH5d*D$ HD$ HzLHHILHLHH) H)H/HD$ HzLHHDILHLHH)A H)HGD$ ۉADDD$ ECD5BD2 ff.AWAVAUATUSHH $HH $HH $HH|$HLD$ dH%(H$x1HH$HF8,AL$p!A LAL%k!AA LHc1(\L$pLL vH/LƄpL@H1LHxcL(H$LHHD$oAŅ`$%=@ULUIHCHD$L$pHhHD$LxHox.HXu{t߀x.u{.u {tDHL$1IؾHTLZ' Ht$LuH$AÉA AA H$L$8D\$L9H H="HAHt$LD\$k1ɁE1A H5J`P1_AXH$x1dH+%(HĈ1D[]A\A]A^A_f.HHt H9H=!/>HwxL@L$p!L%!H-_L_1WHLm1ɺH1E16@ML_11H5R_ HxGLIj1ɺ1H5_WrfHEHH9LHHLfjASD$HH5^P1AWH @HEHH9LHRH5~^1AWLiY^fLIi1ɺ1H5=^E1|L !.@HD$t$8H;p g|$8HT$PDt |$Pmpatt3H="H3Ht$LfL !@f|$Th-uHET$LHH9LHHH-r]RD$HLiHP1SH="H HtHt$L3LZAH-\Lbg1lH)L|1ɺCH]H-\8MH$p!IHnHCHDHqAPLSP1H 녹QH-L\LfHwH-"\LfH_1H5\IHܛHDHUHtkH9tfLJL$E1H-[PLgHASD$HP1SLT$ H LIADL y!L p!6H5L[1ɺIH5J[1DAWAVIιAUIATEUHSDH(dH%(HD$1L|$hHT$HD$T$pAED T$`DT$ u1LH=UgL!MH11AVL%5[LV[LY^1Ht$HcH:t6AAHD$dH+%(H(D[]A\A]A^A_fDHMLAVLZIXE1ZfHLUfM1AVH5Z_E1AXlM1LdZH5KZDT$ 3Jf.AWfAVIAULnATAUSHH<$Hl$Ht$dH%(H$1)D$D$eui.)D$ )D$0)D$@)D$P)D$`)D$p)$DEHcE1A)HLHIcA9~6IM9uH $HƄ$HPNH$HtgHHt_H9tZH@Hr1ɿPLL$1LeH5RYXZH$dH+%(uHĨ[]A\A]A^A_@H!f.AWfL~AVAAUATUHSHH<$Ll$Ht$dH%(H$1)D$D$eui.)D$ )D$0)D$@)D$P)D$`)D$p)$EHcDM1A)LL&HIc7A9~RHI9uH $LƄ$H5OH$dH+%(uhHĨ[]A\A]A^A_H$Ht HHtH9u:H!H1ɿPLL$1LcH5WXZ@H@uDATUSHPdH%(HD$H1HsHH@HH%zAąHC@HtHHt H9(L 9!L%OW11VLLNWe<$LL 1LELIW11X9LYHVL LDLb11HL1D[LVD+P1XLZL1ɺ^1AHD$HdH+%(uhHPD[]A\Lu1ɺT1H5FVoDLJ1ɺQE1LtH5V6ff.@HR"uv ue=^!toL0b11KH5L=5!"=!^uJ!H=!uLa1ɺF1H5FLHhLs1ɺT1H5L?!La1ɺODH5K1?fAUATUH-0!SHHLHTIHt{HL9tIH HHHtH9uEL N!RLNarPH5R1xXZHL[]A\A]LIf.HHHHtKH9tFLJHH5sRoPL`1 Y^LH[]A\A]fL !AUATAUSHDELHMtqH- HTAąuiHHHHHH9LJQH5QPL*`1>Y^HD[]A\A]fDHHHHtCH9t>LJAUL `PH5@Q1XZDH[]A\A]L y!L i!P@UG@HxqGD~GDuH(]ÐHEHt7H9t2LHL_1H5PJL !HHtH9u3L !1LF_H5dP1]@LHf.AUI1ATUHSHH(dH%(HD$1!HQH$Ll$HHDHHUHH9HRHML%OPL^1LRS.H!H u}@1HwHNtjAHD$dH+%(H(D[]A\A]fHy!e@ALIo11H5Of.1ɺLL ouv+8dHUHtkH9tfLJH1ɿPL ^1LAUS-H HqLLn11AL !bfAVIAUATUHSHHDoTdH%(HD$1HH$D$E1E}1HT${D91HhD$ыD$MLEHAEAHD$dH+%(HD[]A\A]A^ú1TAątDm@AafDGHAGLfD1ɺLUm1H5M$11ML$m1ɺ1H5LwD$f.HLl1ɺH5L1AWAVAUATUHSHxdH%(HD$h1HHt$$HL$XHH2HEFI PARTH9D$uyDt$`H\$XDl$dEtdE1L|$"f.H|$ALE9t8LHHuLk1ɺjH5LBfE1HD$hdH+%(upHxD[]A\A]A^A_ALk11YH5fLf1ɺ\E1LmkH5;L@A8AUATUSHdH%(H$1HHHHG`THH9LhD%!D9eh>1HھrWHHM1LbLxH HHEpDehP1H5XJXZA4fHt{H9L^j1ɺ>H5J1E1H$dH+%(HĨD[]A\A]fDL j1ɺ]L-! @L% !D-!D9mh(HL}HD$0HM1LnKQH HHEpDmhPfD1HAAąV}@1HھrH'!H1L%IMH LLJHHEpUhxP1YH^LLi11{ATL`8,A<$MIHH~HDHE1HH APH5PHQLP1H "E18H1PLWMnH5H1_AXLh1ɺh1H5Gof.HupM1LeW`1H5GA/HEpHA[[rHMup1L%WAfD8HM1PL-EGn1LWLAYHAZ AąL=g1ɺp1L f.AVAUATIUSHHH@dH%(HD$81Ht$HD$bH|$w7="v1HT$8dH+%(H@[]A\A]A^Ll$ 1HLA|$ N+LH|$ N+@iHl$LHHHŀH HHl$|$ N+IHD$LHHhH HHHl$|$ N+Ht$LHLt$D$D$ LH |$ HuHHL$ HHid ISM CH3D$(HIntel RaH3T$ H uHfg Sig. H9D$0}Ht$HT$H0HHHH9H@Hl$HLXUPI1H5=XZMf.K`1LbdH5=="HHHxH5FHH]H5FIvfDH7HH+H9"LHLS1HtHHt H9L !LlS1H5<M1I,$K`LLc1ɺ,H5<@L$c1ɺ,H5Z<y@LH\HHHH9H@HIPLRL !@Ht[HHtSH9tNH@HIPLR@Ldb1ɺH5;@HY!L,b1ɺ,H5b;#@H!!.@La1ɺ,H5*;I-La1ɺAH5;%La1ɺIH5:Ht[HHtSH9tNH@HIPH5:LQ1HD$(Y^MHE!HH=ǚ!HtHxHHHL5VHHH"D$ f.H8AąL|$81H5HHD$0LHD$8HD$@HD$HHD$PHD$XHD$`赿L|$8D$tH5LjD$tH5LL1HT$0H5HV.$LL$8BH*AUL.1L褷XZHD$ %AąL$ AAD+ tGAHYH([HNE1ɺAH1PL01H53XZH虷4@1LH5H|1HT$0H5H^$LL$8H=AUL-fDHL$`HT$@HH5@tg$LL$8H3AUL(.L71ɺO1LCfDHHD$HH|$01 H|$HIHT$P1H5HfHT$X1HH5'PHM1t$PL .L1t$HYt$pt$pt$X訵LL$hD\$DH0Et!LH5qLL$LL$D$ $u&HL$0LL1H=->LL$8HD$M=!L !uUL31ɺ1H5E1)H$hdH+%(HxD[]A\A]A^A_DIH\$`HJ8H<$IHHHLL$ALHL$L蟾L$HIpHl$ L@H H LH5rH1ݳAƃLɼ( 8EII1PH3Lt3PH51XZ1ɺE1L2H5[fLl21ɺ!1H51述f.H1H5 IUL*A1E1脰Y^D3E18iI1PHIL2<PH51<_AX诺LD$LD$8H$t>I1ɺ*PH/LD2PH5W1AYAZE1HT$HLL `!tHL$LLHLAtFLH耼IHH$8ttI1ɺ6PHL1P_L01ɺ21H54ff.@AU411ATUHHdH%(H$1ILHH0t|}@1LD芰E1䃼$xAċE@ED~1EDt)H$dH+%(HİD]A\A]fHfDAL/11WH5v<f.8$HUHH9L !H OH5iA9HEL !H9tLJHZE1PH LۙPH51Q諭H fHEHtH9uzL ;!1LH5gL.11cH5FLJH NA9:H ?LHfL !H rHNA9HDifAVAUATUSHH $HH ]~!AIIHA AHվdH%(H$1A@AA H1L8`L許IHELHPLH.uAytۀx.uAy.u AytdHI1SL5^LL۫AYAZL1ML1ɺ^L觫1H$dH+%(H[]A\A]A^fDAymf1LHH$LL5muiHL1IS1ɺ\L_AXbIٹ5L$1H5R٪1-f苴L538轱1LMPYHPL,1蔪Y^TDL5@L51ɺR1L+LTx8ASI1L[S<H57辩[1]DH$LWjDLL6HAWfAVIAUI1ATMUSHH(H $H|$ >dH%(H$1)D$HH(`L|$ǺD$ LH|$ H蜪Hc1LLH5LD,-TH-LH¯HH$LHZ9:H<$)AMtMH-LHzHALLH9H5L藫D˱8I1PHL8*LPH51ק_AXIL1ɺNfIL1ɺF1H5茧1H$dH+%(}H([]A\A]A^A_ÐIL.!1ɺTDI1ɺ`L2!H51&H$f.I1ɺoLAH5 A$UI1ɺZL H5 趦H$9f.I1ɺuL H5 ~A$H{1IATL 1ɿH5I >XZA$fH1H5) ILt$LD f1AVAY^qAWAVAUATUSHH $H8dH%(H$(1HH= IH?IL$ fDL(IHA.tIoHyH uE1۹LHLغHULL L踱L$1LD$,HH|$0D$(H|$IHLLAZA[HT$Ht$L $a9ML $tLLEL $HL $ƯIHAoGT$L $@ oMH0D$ tHH H H%H IC$ |$ AL$L11t$M麻AVH5 H;_AXL$HCILICLL[xIHP@LMHXLDHE1H9tHAH9uH11AVL H5p eXZH$(dH+%(H8[]A\A]A^A_DI{A1ҹLL$YL$H|$ AƃfHt$1ҹL$IL$HAƃ@f.k8褩1H5 L PHPL$1sY^ǖ1ff.ATUSHH $HL% H|LdH%(H$1HHIHL%1ɿ1ILw LϡH藥u#H$dH+%(}H[]A\[8t菨I1PH;LPL#1fXZfHML1SH5I17Hl誫f.AUATUSHH $HL-H{LdH%(H$1HIHIHL-I11L\L蚠Hﺀ1薧Dž'AH$dH+%(HD[]A\A]ÐA$t5HML1SH5E1H또kSLE1AUAH51Ο_AX]fD{H1LILkE1P1葟Y^!f.;8tI1PH/LPL!1KXZ迩ff.@AWAVAUATUSHH $H>H-[fLf8H|$LIHH$H$ML$HcydH%(H$1D$<D$8)$HHL]DEE AHE1DD L$ALL$l$( AÅ>H $H1HcD$1H)HLD\$A1A,HHD$HHH9HHLt$@1DD$,HqALD\$ sD\$ LcD$,x-HHqH9hH@HML61PD$8'PD$,PHt$81CH 1L;AƅPu)ŅHcLD蘪y详HHHt H9L ~!R1ɿ1AUHt$(L"5谜AYDAZT@DAt^HI AWLH5k1YXZ1H$dH+%(H[]A\A]A^A_@蓠AWLUA 1H5 ]1A\fHt$H HH9LHHHH9LH=!D\$ LH1ɺt$D$8PD$,PHrHHD$81]D\$@H E1DhfL |!D$(L1H5#PD$PfH|!@H |!,@HE1HD$f.苤D AHL$H9HH9wLHAT1LxAUHt$(-mA[1[Ic1LLH4H)LDЛ|ӣ8 M1ɺAPHL@PHt$(1_AX@Ht H9tHXHi{!$HLAD$0H5PD$$PS1~H DHt[H9tVHX͝HLuATA-AUSHt$8fLHUL z!@Hz!L z!M@}M1ɺ8PHLPfL$@1H$LHT$8HHHt$H9t9HXךHLATAbt$SL w!Hw!詠fATUSHH $HfL%HHpdH%(H$1HH$H$I)$HLHzL%I11LsL{HH谚IمtA1L1ɺzLL1H$dH+%(ufHĠ[]A\1ɺwLL fDHo1MSLr1ɿH5הX1ZLff.AWAVAUATUSHH $HH $HfH oH4$IH$IdH%(H$!1D$P)$)$)D$0)D$@HH$HH$H NH|$޺L1ɺpH|$H5?נHD$H?L|$`H\$0iD$LT$M11UL~H5t$茓I<$AYAZLT$ID$M"IBLMT$HT$@LҗH fAofAoWH) )S?H L$H1SLmLL NL$0H$q1LHHIHLLD$<D$8XZHT$(Ht$,/H$Ht$ tHL H蒝IHfofocT$,X `0D$( tHH H H%H IB$ FIzA1ҹLLT$6LT$H $AƂf1ҹHLT$ILT$HAƂ@L&1ɺ@H51E1rH$!dH+%(Hĸ!D[]A\A]A^A_fDI$E1I9t@HAI9uHL!11t$H5A_AXH|$Xn蛚8ԗ1ɺH5PH(LPLL$(1襐Y^,fDL$1ɺ1H5wI<$HI9tHGHCHXHHI9uH|$賛AąE18)1LhPH}H5PLL$(1XZL|1ɺH5яUAULs 1SLL$H5蠏A[[!L$1ɺ1H5wH s$H5H=Ιff.ATUSHH $HL%WHiLdH%(H$1HHIH辵L%1ɿ1ILL迎H臒u#H$dH+%(}H[]A\K8tI1PH+LPL1VXZfHML1SH591'Hl蚘f.AWfAVAUATUSHhdH%(H$X1HO`@HDŽ$(D$T)$@)$0H9u1H$XdH+%(Hh[]A\A]A^A_H )o!HHL$ Ht H@HD$ H|$ 11eD$i|$Ht$T軓{^H|$XLcL詎yH\$X1Lt$pH{HH\$0HHHǃH)HLH\$xHD$pD$DŽ$0HDŽ$$D$TDŽ$$DŽ$Ƅ$cHD$0L$@oHhH@xH$(H$PHD$HHL) $)$@fD8HH9uH$(L$0HD$(8WHL9uH|$`Ll$L` 1ɺ1H5w賋HD$8HD$GL$ 1ɺ1H5;wHD$8HD$0HD$@H|$8NH|$0DH|$:|$x81ɺ L\ PHԽH5PLL$01ZY6LL$ L 11H5~躊DHt$`1H~HHt$8HHHHdžH)HLHt$xHD$pD$DŽ$0HDŽ$$HH$DŽ$Ƅ$u {PH|$hL腋Ly 1ɺ1H5̉HD$ffDsH1ɺt$(D1LH5K臉[]HD$8HD$0HD$ H\$h1H{HH\$HHHǃH)HLH\$xHD$pD$DŽ$0DŽ$$HH$D$TDŽ$$Ƅ$趎$Hl$@fDHc $HD$Hp@?H\$(fA)$HA)E<j<4<HD$D$1o\)$@H$1 fDHuuI9uHT$HLfDHH9#8tH|$@L)L$ $$=$wD$1<tF1҉D$t@f.E1)$H$DŽ$uuidf$)$)$)$)$)$)$)$@AHc1A)GL=HLAIcH薓A9~qAGt AGu'AHc1A)HH>Ic=A9~8IIuHD$@HƄ$HHY@HL$@HHtCH9t>H@HH5)M1PLU1UQ^_af.Hg!HD$D$ 1HDH$(HD$D$HTHD H$0H$8@HD$(HI98tHt$(H|$@_f.Ht$(HCfDLH轍b3H1ɺt$(D1LH5 GAZA[HD$8HD$H1ɺt$(D1LH5AXAYL~1ɺH5ӄHD$m@ATIUH-S1LH1t]HuLH=AEt)1MSLH5%N1[]A\HcHvH[]A\Dff.@HUH51H胎tnH5RHpAEtRH5HTAEt6H5H8AEtH5H]1DATUSHGauHoHHKPHGv ǂG1LBI1HH]LܩxPHSPHGDGL[]A\fHHH9HH@pHhHa@HCPHE1LLU1H5S聂XZff.fAWAVAUATUSL$HH $L9uHfH|$H˹IH$p!H$HdH%(H$xa1)$`!HH5L59|H=gLL|$@RL^1ɺHH$`!H$H@HIHtZI}HuI}?/uIE8/uL讆xH$H9D$@uIuH<$1ҹ臌H\H$`!PH<$ HH4$H$`H$`HHH<$HȹHH$`fH`!H9tD p uHƄ `!\HƄ4`!0pƄ4`!4Ƅ `!0H9uDID$PIT$H1HHD$HxIHH$`H c!1HZH|$L1ɺ?LH=HHyH$`AE1L|$ HD$L$`1fDHL@Ho$`1/uL$pQ1MLHL$LH5@uLH uHt$H<$H|$LD$L$݉L$T$@Ƅu @at @uLDAUh1Lt$LL$ H5^A~XZL`H1t$I1LG$H5~_AXtL(1ɺ<H51E1x~H$xadH+%(HĈaD[]A\A]A^A_@H谉ugEtL1rH5~ILv1E1H5[}jƄ$_1-La1ɺo1H5-}st$1H51t$bL LL$ }Y^L1ɺBfAWAVAUATUSHH $HH $HfdH%(H$ 1IL|$IH8 IHLHc)D$軣Lw1ɺIEPMMHH$HzzHH0L1HhnL*1ɺhHs"H8HD$ HIH8 HD$(H@HD$0H=Hl$HH\$8HD$@tH)L|$XHD$P@ t!UH=HcHKH| HcHL ƒ@tH=HcH|  tH=HcH| DA At%H5L(uH=HcH| AHcHD H$HL8 A$A$$I|$jM$LE$H +H,$IAU=V|!L-iPLG1L1zH LHT$ Ht$ XAąEIL={!LAH11UzXZH$ dH+%(SH D[]A\A]A^A_f.H5dHcHt ybL1ɺfH51E1 zH( L$HL  1蛠xEH=@ HH5H| E@HHt HcL| DA L1LXyLHH=贂HuH`Ho"藃AWAVAUATUSHH $HH $HLNHdH%(H$ HFPIIIHվHnvHL1HhH$H_L1ɺ Hn"HHD$HHD$H9HD$ H6HD$0@ H\$8Hl$(tH5(HUHt$@HT$Hƒ@tH5HcHt{ tH=HcH|DA Ast%H5 L@uH5HcHtAHcHDH$HL8 A$A$$I|$jM$LE$H CH$IAU=nx!9L-PL1L1vH LHT$ Ht$pAąBIL=x!LAH11SvXZH$ dH+%([H D[]A\A]A^A_fH5HcHt jH( L$HbL  1CH=A@ HH|C@HH=/H|HcL|DA 2>L1LuL HL 1ɺ(fH51E1ZuDH=~HuHpHk"ATUSGHv LJG1LB4HiLZ藛xGDGL[]A\AL/1E1H5P~tf.fF$G$FPGPf.HGH@HGH@H ff.@HHHRH9t%H HH9tHPH9J@u1ff.fHFHWE1HH9 t DDHHH9JuH@E1H9BADHGH@ATSHHHVHt HHtH9uHBD$LDH-L1ɺH1n1ҾL:D$HCPL11HHsH1LhPnA^XHCPL 1HL1%nM1ɺLH1nH1MLp1ɺmHIwHt DEHHCPH8 LMGIMLLD$rLD$LhLLiIHtLLH{IHLH1AT1=mD^_Ek11LHLE1mHHL$1H^fDL1ɺ1H[^,fDt$H5 NH]SUDO HEuH]RfDL11H5MH]RUDO HEuH]RfDL1)H5zlMH]cRUDO HEuH}FRH]=RDL1MH5MfUDO HEuH]QfDL1DH5LH]QUDO HEuH]QfDL1/H5|LH]sQATHWIHtHH,b L n1ɺiID$ L 9H5n1ML$(ID$aLLA\L1ɺc1H57KAWL1ɺAV1AUE1ATUSHH5HH|$KHH$H-TL%L=@L3HLUtnLLUt_LLUtPH5LUt=HD$1HH@H@PHxHtJH $HtHAMH$LDDH[HsHD$LH[]A\A]A^A_LW1ɺ H5JH1[]A\A]A^A_ff.HI1HIH1fAWIAVIAUIATUSHHD--~!Et 9AHkADžH]HAMtH{(LTuLLHLAąt H]HHuAHD[]A\A]A^A_HXlHW HHIUHL9LJHH5PL1AGIHk^_H]H#^AfL8XtIDžBAH6W HHIUHtL9u7L *!HLrPH51HXZLJL M*!"AVAUATUSLnHtKHHH9t3LcLtMMuLI IvLHtA.HH9u[]A\A]A^@ImHtHUuHHM(KHt*@H@H@ IE[]A\A]A^Lc1ɺ>1IEH5[]A\A]A^GfDAUATUDO HLoEuGMeIT$At$L!LiLIEHPLWLH]A\A]JLf.L1H5Gf.AWAVAUIATIUHSHH^HHHTH9L5|(!HSH~(LGQM;$$5LKM<HHxM9LL~KHI9HCLLHHADžMAD$dH-N"M,$M9uMmM9MuL'KH;HLHLuLE1H5DELpHH~(HGP HsLLHHH[]A\A]A^A_L51'!HIT$8HE1L}H5A A%A к\P1"EAYAZHD[]A\A]A^A_@AT$dH-M"L eH1AVH5(LADY^r*HGHHM"H9H M"H9HACL5 &!HL X@HA1AVL}H5m D_AXfDHWbML.1E1eH5(CMk1LH5ACqff.@SHHt$HH?HHT$Ht$HTHHL$H9tJHC@HtgHHt_H9tZLJ1LH5 CDtuH@HH[H@L $!L ^AWAVAUATUSHLvbdHHH#H=L:HL9E1A@IwI~$x Iv#AM?E1L9uDEtlHKd Ht H9L #!1LH5"A1(AFƒ <fH[]A\A]A^A_@Eu@uH=zS!uMOx1LH57/HAIGIHBHHHII_LxL;{LH"1Lt1ɺH5G@ANB1L1ɺH5@AFAF6fDUSHH $HHNdH%(H$1HB0bdHHtf@uULC8H$H$HEAAA AAA 1fx?HHJuXH$dH+%(HĨ[]f.L1ɺ%1H5&?DHHtH9u;L D!!1L{*H5p?Kd1gfLHIDAUAATIHUSHHEDLHh HIHtnEH'IHH HKLHD1exHL[]A\A]ù]1E1L/H5>L1WH5>f.t DD QE"ATUHSbdEt'1HHXt t^x []A\HEHH9LHLG1uH5p=Md1f.DHEAAHH9Hp1L%jLDL|=_AXHEHH9LHlL1L+1=J@L !@H1j5!L%LL<Y^lHK HHHHUHt>H9t9LJQnLLP1<XZL 0!*L $!ft DUSHH 5C"bdDEtQAH`J I<IL1H5;H[]fHHH9LHL81ɺ/1H5H;fDH[]@HH5}=HHtH5HEtH5HsBHtHuYHH9LJLd1UH5;Kd1a@L !%@HH5I HHHtFH9tALJQWL(PH5C1:XZL A!a@L 1!ff.@AUATAUHSHHHdH%(HD$1bdHH$su+HD$dH+%(HD[]A\A]fHHtHH9tCLHL-L1!L9KdCbt H<$HuE1L Y!HHH9tDHPHtH;z8tHH9u|HHH9HrH$L 7  HtH8HH9LOHL1VLQ1R+8D%nA"H E$HlvmdevicH98,!tDL1ɺ/1L8'A"oH5C!;L 7!qf=+!esu=+!Bt DATUSHHHz8bd%Dd$E 9tBE9t;;U Cbu^A~EHK8 % 1Au)%9EtMHhtL=k![]A\fHfuC8%HXtHE HHHHHt H9 L !Q%LPH517XZKd1[]A\fDkZfDHDHL`H5GL8HC8%;E t/LH5/8HHH5DAHHtH9u1L !L1#H566 LHf.LJL1ɺH5e5@Lz1ɺ1H5?5ATSHH(Lfz8dH%(HD$1bdD$ @tA4$HT$ H&AątRHt$HKH~!AH9D$HD$dH+%(7H(D[A\fDCdL$ €t HSdHH9LHLn1=H54fHHH9LHLP1H5as4KdE1/@HHtH9ucL !HH#PL1H5 4XZL !m@L !@LHe>DSHH $H1dH%(H$1IgdHLHLH?<$HD$tB$HpH9$H$dH+%(H[f|$MuwHHH9LHL/*DHHtH9usL !L'1H52Kd@1[D=AHHtH9u;L D!Lk6릐LHf.L !L@LH<DIHAt fDKff.HHw 6HATL%1 ULLSDOHE1CH{4?Ht"SH1H<2Hkc[]A\1LL溃w11ATSHHGP;Ww/HSA CHSCHD[A\D#Aąt CL1ɺ1H50ff.fAVIAUIATIUHSHHdH%(HD$15A1EHc](H|$Hھ 1HHuD^8H}LL5Mt7U(ЅXIHu 5~HuL8Hu 5HT$dH+%(uH[]A\A]A^fD1H|$`W:ATIкUHH(udH%(HD$1I)H}o$HAHHD$4x EP;Uv7HgAąt@AHD$dH+%(uxH(D]A\EHU Aąt0AL1ɺ1H5.DL1ɺ1H5y.xM9ff.fATHFADHxD]t DA\AL11ɺbH5l.DA\fDATSH>tAHD[A\HFPH~ HooNAąuHCPHL6H5LsH1-XZAVHHAUATULE1SHLIC LkHLPAXAYIHu Ht}t [L]A\A]A^ÐImHH1IŋC )HHEH$H9HLHRL5211LLp,HEY^HH9LH11LwL,MIMME{H)$)D$uTIrL1H5e1H$(dH+%(H0[]A\A]A^@Ll$ IHLex/H$H$HHtHII)IwILHLHBD4 H$HLL]H,$D$ DI}Ļ!fAVAUATUHH $HfdH%(H$1L$IHH$IHLHD$HD$<xe$Au-H$dH+%(uhHD]A\A]A^Ht$ LxHHLLD1ɺ1H54E1 ff.fAWIAVAAUAATEUHSHH(HtHxJI(fH@I?HHt_fH@I(}AuHD[]A\A]A^A_HHCHtKDsDkD#f.L11ILJ(H5ϵE1돃9E1LݥH5ig@AVAUAATIUHSH0HtHx6H0fH@H}HHtZfH@AH0A<$u[D]A\A]A^LHCHtKD+D[]A\A]A^1E1HDž0L׷H5~땃E1LH5Ym@AUIATIUSHHdH%(HD$81HGHpH$HD$Ht$ HD$HHD$(HGD$ P`HHHHH@H9HALE1E1LHIHtTHLI9t fHSLHHI9uHD$8dH+%(uuHHL[]A\A]L1ɺI1H5GHEHE1H@Ph@C1E1LңH5G {ff.@AWIAVAUATUSH8L$dH%(HD$(1rHHIHIH9u!`RAąpHH9tAH{LH#G`tۋL$ML1ɺ1H5u7IIH91fDHPHHHH9utdHM1E1Q)LH5XZL=HD$(dH+%(H8D[]A\A]A^A_ÐIIhHt$D$HD$ HD$HGP`L̢HH LI~ HMIIHD$L9uO!ImIFELHAdžHxHGPEAąMmI9ImHE`@atHu@HHH@|uI~(bHfH@ @ImIHhIHL$HPIHHIL1ɺ"1H5-+f.H- L51aHLE1ɺ1HE1@HE@HtoHHtgH9tbLJH-L1fHODL!H5d1E1!]@L L1ɺ1H5%E1 (LGAąLAąAIEH@@HHHH9LJL}1H5` IdžLH5i1E1& bL1ɺ1H5> HCHHH(H|H1H5~Aą:ALHAą2H H; HHt :yHH)H5'H1AąHHH5 H1AąL=|1ɺ1H52'fDL|1ɺ1H5 gH$dH+%(HD[]A\A]A^DAL{11H5fH(AąL{1ɺ1H5~pHH1H&AąH5H1AąAH5H1bAąwCPhHCXHt HPH5ݞH1*AądH5ʞH1AąAfLz1ɺ1H5sf.HCHiH@H5A\HHt8u-HH;?2H5RII5 f.Ly1ɺ1H5ј/f.Ly1ɺ1H5f.L|y1ɺ1H5qcf.LLy1ɺ1H5A3f.H5H1oAąkLy1ɺ1H5SfDLx1ɺ1H5ɗ'fLx1ɺ1H5f.HU AąCP1҃H5H1Aą0Lx1ɺ1H5 gLw1ɺ1H5ALw1ɺ1H5Lw1ɺ1H51HH#xHT5FѸʸÐAWAVAUATUSHH $HH $H(dH%(H$ 1IH5*IUAG(IH\$9OAG(ML9Hl$L5I\$ HH{zHLx$LAW $1LL AG(1HLfo aH5(fAnG(f89fA~G(HC@H_HHSH9JHRHH$jH$H=Hu%6fDHȃ\t2HHH@0t<"u\HA1HH5ЙL~LAW uIUHC@twHtrHP0HtiBft_HfwVLBHHHtBML$t91H5gLjL$1LH5]LJHLHH;H1HLHwH1H5 LAHLHH1*HHtHAG(PAW(Hs1LHaM$$L9d$:AG(PAW(1HL*AH @L($Ls1ɺ*f.LlH5[AG(,1H5їLIH1HLH$Lr1ɺ4$Lr1ɺH51<D $H$ dH+%(H( D[]A\A]A^A_É$Lr1ɺ Lr1ɺ1H5zE1뛉$L\r1ɺn$LFr1ɺX$L0r1ɺBLz1H5mE1-$Lq1ɺ$Lq1ɺ$Lq1ɺ'$Lq1ɺ,$Lq1ɺ/$Lq1ɺ.$Ljq1ɺ8|$LTq1ɺ"f$L>q1ɺ#PLlH5}AG()H^$Lp1ɺ<$Lp1ɺ3AWAVAUATUSHH $HXHn`dH%(H$H1IHW sHSHH5'L1AŅSAG(fo nH{ L$@LfAnG(f89fA~G(tAŅiLH5L1eAŅZHLAŅKHH;OHHH HtH5RL1AŅCtk  } 1҃ H55L1AŅPL,o1ɺ1H5!)DALo11H5TH$HdH+%( HXD[]A\A]A^A_Ln1ɺ1H5DLn1ɺ1H5yDHCPHHt:u-HHM?DH5u&0HH5DLn1ɺ1H5WfHCXHt HPH5ՑL1"AŅSxtGH5L1AŅu/Lm1ɺ1H5fS|xCH5UL1AŅu+L/m1ɺ1H5$)DHH1HL$H9tfDHH9uH5L1,AŅLAW AŅHL%H9l$kHD$@H\$(L5pHD$ fHD$(D$@E1HD$8H@P\$ HD$HEL``HD$ HD$0AEIH@IHH@tItHHHt$81H|$0H"IuLk1ɺFH-݊1H6Lk1ɺ1HE1Lk1ɺ1H5f.LvAŅLYk1ɺ1H5NSH56L1AŅLk1ɺ1H5 jLj1ɺ1H5DLj1ɺ1H5HHIkHTCT$ 1H5LAG(1Lfo yH5fAnG(f89fA~G(U AHD$M$HgLH1LAW M(t*HD$H9LH1HHEHL$ H5LHP(1HH;SHEH@ H@HtLHЅAG(PAW(|L%1LL HmH9l$AG(PAW(mLL1kAŅADH-Lh1ɺKH>fALH5lL(AŅHH5YL1AŅLvh1ɺ1H5kpLPh1ɺHeH-BL6h1ɺLHTHH5L1AŅLg1ɺ1H5FLg1ɺ1H5† H-Lg1ɺSHLg1ɺ1H5uzH-_LSg1ɺNHqLrH-(Lg1ɺVHu:Lf1ɺ1H5OLV{lH5Ņ(AG(UL'{lH5AG(dH-}Lqf1ɺPHH-VLJf1ɺZHhH-/L#f1ɺ]H|A1\Le1ɺ1H5O,"AWAVAUATUH(SHHxHt$HT$dH%(HD$h1dHLI@H@H@ HEHHD$L91Lt$8Ld$@DM?HL;|$LmIGI}LLHD$8ZILLHuL%փLd1ɺL#Ld1ɺL1E1LeMt"IT$At$L蘐LHEHD$hdH+%(. HxD[]A\A]A^A_fDE0EHD$L%ވHLH1sAŅHE(fo HHt$fnE(f89f~E(0AŅHU AŅ4Ht$HwAŅHU AŅHD$LL;I1H5HE(HL$9O‰E(HI9tqDH{wtHsHgAHI9uHD$HI9t/fDH{wuHsH'nHI9u׋E(PU(L-$1HLqL%Lb1ɺ)LLb1ɺDHD$HT$HH8AŅLLb1ɺ1H5Af.Lb1ɺ1H5ogf.La1ɺ1H5?7f.La1ɺ1H5f.La1ɺ1H5L%k1ɺ1HELNaLHU AŅHL$L-HHD$(H;1H5~HRjE(HL$9O‰E(HH9L$(Hl$IHD$0IGE1H@LhpHXpHD$ LI9)HE8uH@HxHMtLt$0HmH9uMI~H|$0/IHHD$8Hl$0IE0uf.D$]LHI.11%1H-QsL_fH|$ryH0LcI}(H3lHu@HM0LSrHU(IEuHVH5RcQ R[PLT$01ARLH0AD$ E<IuI}EH 01AUL=M^LLgLHs_LAXH9Aą^|$ Ut8HʼnHsL AąHs MCL1Lf蘻HsLY^2A.f.Lm1%H5m]LH$ dH+%(H( D[]A\A]A^A_ù1E1LlH5]BD$LDLl<1ɺA1LúE1oA.Lt$fD\$ f1MLl3L}Lt,H<8^ML$IH[HHDH5APL:SP1H DLKL-[L%aILH dLA9:IEHAPLݥQP1费H L}LKL<A9MDHPH;PATL1]H @ 8DEMLPL`1sXZL%ZHn8HL= [ML$ILARHEH cAP*QLӤP1譸|$,H P}萿$,LIDAQMPH:PSATD%s USHZF(LEt^H1ɺTPH-=ZLj1HH{ܻAXAYH{AD[]A\fH \PH-YLVj1H贷YLK3 ]H1Lb荷H{H3^_w28kLKH_PL^13DXDZ[]A\f.LKHL7b1 W 8LKHIH~XHSA9H HDHXE1APLڢQP1豶H D[]A\DATSH8HxdIHt0ooKHoS P HC0ID$0HL[A\Lka1H5MX,f.HLVM2 001HfAWAVAUATUSHH $HHjdH%(H$1HcAąt8Lm/L軻LHL`MDLLu:AH$dH+%(dHD[]A\A]A^A_LM)UHXJ#H=ILLLL-0W贶K<&HL%H 1AVLML_L۴D% LEt,L`1ɺ1L说 f.H}LG8耻L\LP1AVLMYXLZf.HM1AWE1H53VLfY^脾@SHHZdH%(H$1H{?u\H;?u,H$dH+%(HĠ[fHظH;x\H;H谸xH{3t8SLKHTH IHA9HDHAPL8QP1H5$UH 16諼8L HnTH IH9A9HDHAPLʞQP!ATUSHn HLe |H} Ht*HL9t"HGHCH`HHI9uH}0Le(Le Le0Ht+HL9t#HGHCH HHL9uLe8Le0[]A\AWfIAVAUATIUHSHHZpLrhdH%(H$x1D$`D$0)D$@)D$P)D$)D$ Ht8H56Hu o)\$ocT$)d$ 7fDHHHo)|$o)|$ oMoUHD$HD)L$@)T$PLl$@HM@ILIt$ jLPL蝶^Lx2_H1ɺ~HLH@XHHD$HLc`H HCpz} Co] oe0)\$@)d$PE1H,$DM LLIHLhIUIEIMH H HSH1HGH9>LNRL c PH5'R1HC`EL$ HsIMMEHxpIUAH$,ZYlH,$H{0Lk0LH'Mu;Hu1I9t,HHHL9uHBHRH H HHL'L9t$HGID$L GLM$$L9uLL I I 蛲H<H{0L`LpHS8LL(Lk HPHS8HH{ HC8HaMu&L9t!H@HHI9uHBH HL'I9t#fDHGID$L 至LM$$I9uL I H~H{ L`H@CHS(L(LkL|$pE1HPHS(HLcHC(H$M9H$LIHL9L>fLH)D$pHCHPH$C t DŽ$HpH8L4u1ɺQ$H-OL/H脭L/11) H52cL.11HFD $H$xdH+%(#HĈD[]A\A]A^A_fDomou)l$@)t$PL @TL_H5X贬L@.11 H51蓬L.1ɺH5N1rE1(f.omou)l$@)t$PH$H}pDc|HtH5T1莯ADEtDH}@Ht$C|Cx"AL^H5W轫LI-11 H50蜫L(-1ɺfLk8Lk0?Lk(Lk 1ɺ$L,H5ZM>D $$L,11H52MD $胵^ff.t=ATUSHHv@Ht#HI"HHxxvpE|t[]A\øf.HC@HtHHt H9L  L]1ɺ1H5oLNA$@HC@HtHHt H9L ϋ Lh]1ɺ1H5LA$AHC@Ht HHtH9uZL 1L]<H5K诩1LJ(LJhLJf.AWL]1ɿAVIֺ$AUATL%^KUSHHLndH%(H$1HFLMHD$P1 XZMMH-MIF@HtHHt H91Hz HMHPL^1ɺ1襨M^_Mu8H|$IF@Ht=IF`1Ҿ2HxtMIF@HtHHt H9H H1ɺHPLX^1IIA_YH9RH,LL^PI1ɺ<1ܧIA[A]H9 HKhI~@L)L9LKpIHMH1IIIHt&ILH)L)L9 HIH)IMHtHHt H9o H HM_LPL^1Q1U H S|ACxAHIIHDH9HSHIfHBHBIHD$II @IN@HtH1Ht H9~L RL\5P1L%X1ZH$dH+%(n HĘ[]A\A]A^A_IF`1Ҿ1Hx蜃D,McM\MH-MIF`1Ҿ/H-HxZLYHHII HLD11MM^艫 AM9ZI~@IF`1Ҿ.HxqIF`1Ҿ0Hxoq7MML&Y1H1MդMfMHPHHDH9;H@HL\1LP1suHCh_AXH`HK`HSpHt H4H9H9H)H9HIHDI@HtHHt H9ZL L,[H1Lۣ1@LNIH(HHH9H@HILY[1PfL1rAYAZdfH @IF@HHHH9LJLS[z*@A#@A@A11LeWHM͢I~@M|MIF@HtHHt H9L 7 LYBMLnV1L*1PIIF`IV@H5NH@H<1҅ILcMIF`M~@HH H@LHHD$8HD$8IHD$H|$HHL$8MIHL9LHQ11LLRH5]rA[XHD$8H HD$ 8LT$@H|$LH EMHO/LT$(D$8MLT$(H%/IHL9LHARL1ɿH51LT$0RˠHT$(H|$81H5GL#AYAZDT$8EDT$(pL"LLD$H|$LLH D$8XDT$(LK0T$8MIHL9}LHDT$LK11RH5ASHcD$H_AXDT$A yH xDHcH>IF`IV@H5vKH@H:IHtiL1IHt\IF@HHHH9HBPMLT1AWH1MPMAZA[DIF`IV@H5JH@HA:IHL1IHIF@HHH H9HBPMLT1AWH1軞AXAYMIF@HHHH9HZIF`HH@DL$HxjY+AHIF`H@D$DLHx$AHIHt2D*Y^ISL6VUH@LJ(LHHA @H1 @L ! BMIHL9LHH1ARH5 LQ Y^HD$ HD$ HT$ H M<IH0L9'LHH11RLQH5轜XZHL$ HL1HHyIF@HHHH9HBPL|$(M11ɺHAWLcQNA]MXMHHD$ HD$ HHD$ HD$ fL } @L } _@H} n@H} @Hy} N@L i} L ]} {L Q} RI7ff.GGvDSHH8HtH;[Hff.fUHHXHtJH}p!H]AWAVAUATIUHSHH8LvhdH%(HD$(1~ D$ oF oN0)$)L$L9utQE1ID LL0IHtH}D LHAtmADHs@HH诞HfHH`HPhI9H¨Hp LmAąI LLE1HtH@HtLhI LeH{hI9tMtAD$Ht HGH@PhLchHHu\tbAHHLHHD$(dH+%(mH8D[]A\A]A^A_f.AuƋAtH+1L)HHH Hoo^)$)\$*fHC@HtHHt H9L oz 1E1LDH5:蘘#HELH8qHHsH}E LQ@HI(HtHHtwH9trLHH 1QLPH5:_1AXLH5:1E1yfLJL yy HEH$DLHxj$HS@Y^HtHH Ht@H9t;LIHE1PLP1H5d9CXZ@L x L1ɺ1H5(9L1ɺjf.AWHAVAAUATUSHHL~hDL$(dH%(H$1Ҁ~ D$PeoN oV0)L$0)T$@dHI LLHt$0 MH Ht$HD$HI H HD$HHD$ HH H${Ht>o+osHT$`1H{hA Ƅ$)l$`)t$pڞA…?AÅusH AEH|$H57L;,$HC@HHHH9HBHA PLO|fM틓E ȅH jAHHHAH HDLEL;,$H$L9HL)I9fL$$M)LHC@HtHHt H9L `v D$H 1WLaNH56Q1AT胔D\$ H AMBL9H{@LD$I9IF1HIƲD$*HC`HD$LppHChH8AIHfH@@8@@ @0HChH8AH fH@0t$(L@@ IVIGIWHS@AG HLhL`H@H@0@ "{o;H{hAHT$` LƄ$)|$`o{)|$p.D$soof)\$0)d$@HH(HC@Ht HHtH9ujHt QALKPH541ʒXE1ZH$dH+%(,HĘD[]A\A]A^A_fHBf.H >pHt$1ɺ LD\$ AwD\$ H x>HtH@HtLhH o>LhHD$HIH c> @Ht$ LD$,}wD\$,Ht H@HH|$L,$H =t L+l$H =H53L;,$ IBH9rIcH1HHH)HHEL|$J<&MH1LD$ II HMtMJL9J<&L9MI)EmLt$K6L9I)1J<&HIHt MI)J<&I9AH H|$HLIE2HIr $@HC@HHHH9HBD$HAPLI1H5[2:AYAZD$hDH582@L$$M)H|$1LAH1Ht$HIH$LH99H)LL9@II L9vSMI)EdLIfO 'I)JL9SM1MHt$H#J<&EILhH Q;HHHLI[LJWHC@HHHH9LJAVH501AU LI貎YE1^LIDH9p @HH50MPL}H1 Ht$O_AXH4$L`ML o :@H5 0L I1H4$H4$Lp1ɺ 1ʍE1fH5/LH1H4$蘍L萒H4$IMH|$E1eH8fAdH%(HD$(1D$ )$)D$w>oH~hH oV1) $)T$ HT$(dH+%(ugH8@HF`HH(HF@Ht HHtH9u:H{n QE LGP1H5.袌X1Z@HB ff.fAWIAVAUATUHSHHxLfhdH%(HD$h1~ D$0oF oN0)D$)L$ ILl$LALJ LqHt~HPHtu@ Ao'1AAooIh LrHT$@D$ D$`)d$@)l$P贔DL$ MLI HAAHt$HHtHH5ǎu3HD$hdH+%(HxD[]A\A]A^A_f. LLIpHtH@Ht H@H HI)A@IG@Ht_HHtWH9tRLJ 1E1LPFH5,藊Bfoo^)T$)\$ JL l fAWAVAUIH=6ATUSHH~HHHH8IHfH(H@@@(@8D3LhLhH@(@DpLhLhID$0ID$(7fHH@ID$@AI<$H}7IH1fH@@@@ @0HLsIGI$H$MIH55HTHHtH4HDH9H<$6HHLHH<$HPHHT$6HHT$HHMFHEMLLD$踍H<$HXH6HHlHt$H蟖HI^H}HHsH<$LpLC6HLHH\HHMI|$IoAG ID$8ID$ M/IGID$ L8M|$ 3ftLkH[xID$8HAHL[]A\A]A^A_@L5)LRD1VL艇I<$E14L 11 L`fDL$D1H5:p4H4L1ɺ 1H5,)E1=HH<$Hp4Lw1ɺ7HHteHD$I1H -3HH|$-fH<$4HHHEL 1ɺ@L5(1LZH<$H1CL1LSBG,HLHHXHhH9u4f.HH9HChHs LHu1LN H5 襅L111tH5'脅L1ɺ1H5bnW&fL5`'1ɺ^1LL,HEL1ɺ2DL5'MiLALȄ:1fL<1ɺ/1H5&菄Uf.HpM1SL@H5u&YXZfIL.@11)H5C&'fHEL1ɺ<`xATf1H]0USHH@dH%(HD$8HH1)D$H)$)D$ HD$H H@ Ht8tT61E1L I0L@H50nHD$8dH+%( H@D[]A\fDHxH5/ȍfAuH11HH)D$)$HD$)D$ HH@ Ht"uHxuAlf.L /L?16H5?/襂2L /L?E16H5/t6L 6/LS?H5.?赌DAWfAVAUI1ATIUHSHhH$H<$1Ht$ LL$L$HT$L$dH%(HD$X1)D$0HT$8LLD$)D$ )D$@LD$HtHx tD$AHD$XdH+%(HhD[]A\A]A^A_fHXHuDH[Htt$MLMSLHH|$HD$AXZEuL1ɺ1H5-D $D $`M1L-H5[-E1*4@AVf1AUAH#ZATUHSHH@dH%(HD$81HI)D$LH|$1)$)D$ 7HHH HDHѺfAt~11HCL)D$)$H\$)D$ Ht$HH HtDH肺AąAHD$8dH+%(H@D[]A\A]A^DL,1H5,f1E1L,H5+YL,1H5+,V袉fAWAVIAUATIUHSHH5},H(H;dH%(HD$1HT$D$ &tzLl$LՃLxLL,HHtLLHHI $H;HT$ H5$%%D$ HEHD$dH+%(u)H([]A\A]A^A_fDL-ALl$迈ff.@AW(HAVAUIATMUSHXdH%(HD$H1L$+HrfLHH@ @+HH;HxHHHǀH1H)HHkMvM|LHL*L|$11fLL)D$ )D$Lt$()D$0L*HLH5L$,LH5L$bLH5*L$I|$hID$hHID$pHCID$pHI\$pHT$HdH+%(fHX[]A\A]A^A_fDHC1L1ɺ>H5(W|1Ly91ɺHH5(1|@HLLV#L_91ɺLH5({f.LD$LLD$ހLHPHH$)HRH$Ht$HHEHLD$LLD$莀LHPHH$[)HH$Ht$HqHEPVL|$LCLLpL)HtOLLH1HEX01L|(CH5v'z1,DHEXLI81ZH5>'zHEPLQ81UH5'lzuHEHLQ81PH5&4z#誄nDAWHAVAUATIUSLHhdH%(HD$X1L$'HfɾLH'HHgHxHHHǀH1H)HHULh'IH$fH@L}MEEIGpI_PLIGxIGpLD$A~LHPHH$'HH$Ht$H$IGHM}MsHELHx #AHEEHPPH5%SLooHT$X tMLl$HELH$}LHPHHT$g&HHT$LH~HH$HHHLl$ L11fLL)D$0)D$ L|$8)D$@Ht,L`HT$LLDHEHT$HPXL f11LL)D$0)D$ L|$8)D$@Ht,LHT$LLHEHT$HP`HInHIHAIFHL0L:HELY61H5#$wHLE13HD$XdH+%(tHhD[]A\A]A^A_ù1E1L5H5c#vHLHH1L 5H5##vXZqL41H5"\v3L1ɺ1IGHH5"'vfLL$L4&H5"u@LL$L4.H5c"u@H$1ɺ!L<H52"H@H1uj i@AWAVAUIATUHSHH5#HXdH%(HD$HHGL|$H;LLp`Ld$L3zHPHLHT$"HHT$LHHHE8HuDH[HH{ uLLLD$yLL`L"LD$HHLLH讂H[H|$ HEHAąFfoD$ foL$0Hu0HߺEMAąLH5HH t>LD$LLD$&yLL`L!HDHt$LHHE@LH5!Ht7L|$LxLL`L!HLLHHEHHUPH5^!H*AąjI}L BLSL9!11UAj%H uML)!1ɺ9H5.s,@LM1La2H5sHD$HdH+%(MHXD[]A\A]A^A_f.L%]Ld$f.HEL41ɺH5#1E1rLM21L2H5ZrUD1E1L2H5)r$@LM$1L1H5qHE8Lt1ɺ ;HEHLY1ɺ/ HE@L>1ɺ+|f.AWIϾ/AVMAUMATUSHH$LD$HH@dH%(H$1HD$HHHHL$(HD$4wMHhHHDM9u`M6M9LI^HHCHxHp{AąuLhHD$11Lt$PfLL)D$`)D$PHD$h)D$p L0HtH|$HT$HLc4HD$f11HeL)D$`)D$P)D$pHD$h+ HBfHHH|$HL IHfI^AHD$H8-HD$8Ht$8H|$HL@MMMYAMAHCLHh|IxpI@pII@xIFI@xL0MpxHAH$dH+%(HĘD[]A\A]A^A_@HD$11L)D$`)D$PHD$h)D$pHHh HELt$HM,fHL%HmHJELMH|$LLL$LL$H@LhM3IHuLZHHfLhIgH.&t$(L0.PXHD$ LH51 nY^H%t$(L.PHD$ LH5_1m_AXMLLL*<@H%t$(E1QPL/H5HD$ L1imXZLLD$@HTLD$fL@HSIHBhIIIIIIFIL0MpH/HHD$0rHPHHD$HDT$0HT$0HI9uf.HI9kLJHt$0HT$ MALL$IxHLD$vLD$LL$HT$ uA@Ht$0L-WfH$t$(L-PqHD$ LH#t$(L+,P`HD$ LHH#t$0L,PHD$(LL$XH5,1kH L-17H5p\kH>#t$(L+PeHD$ L HyH#t$0L+PHD$(LL$XPLt,17H5j%_@uAVAUIATUHSHWDLsLoHL`L}IHtLLHxILLHVNAątGH[Htn;t1E1Ls,H5*j[D]A\A]A^fD1L1ɺH5i[D]A\A]A^A[]DA\A]A^fDAWHAVAUMATIUSHH4$(L$dH%(HD$x1|HcfɾLHH@ HPHH,HxHHHǀH1H)HH]M>L'nI}xHLHo-MvM`LH%ADžMLLD$mLLxLHwHt$LHvHLHCpAo[xAoADžHD$@L=11fLHHD$)T$P)T$@Lt$X)T$`HtLHLHADžL|$8H5 LLLH5LDLH5_LHH5LADžHH5LADžHT$(H5{LHD$0HD$(HT$0H5TLnHD$(HH|$0LHt$11HLfHLHH)D$P)D$@Lt$X)D$`Ht$HP Ht:tLLADžAHLǃHǃH$HC`&ADžAHLAA1DHEL1ɺH51E1eHD$xdH+%(WHĈD[]A\A]A^A_L\1ɺL"1H56ef.1E1LH5ieh@L'1H5ELLH5ELLH5|DmLLH5ND?HL)LL$HLDXZ Lo1HDžH5LDNfHLVM2 001H9FAW@L=iAVAUATUSHdH%(H$HLVM2 001L$HHFFH_ H,LHCpHHE HChoEoM HS Hs HChLM(H9t"fDHJIIIHJHIIH9uHSHsIIAIAH9t(HJH;uHyHIIIyIIHH9uAAS|H{0IIIAQHS0IAH9t @HrHHqHrHHqH9uHIQE1HAHuIy ELE(M1H}0@)A)HcAHHH~(Lf0HL Ht$H 11HD$H$IHD$0HL$ HL$HL$8HL$(EDDL]0I H-KD$lLD$`LI LD$pAL\$XLHl$HE*Ma LoL H LT$xH-ALL$PI fDLePH}HLH Ht$E1HcHHHq(HI0II L,$L-xH H Ll$Ht$H5[H $H ЌHt$ I H L-7Ld$L%7H|$0H=H|$8Ld$(ELVE1D$lHD$`HD$XL\$pL\$HEH-1E1E1Hl$xHl$PLKpLL$@HtLMt I9L " Q1 t$Vt$8t$(VLt$Ht$pt$PWAU$W$$$APAS$APL $$ ATARURAR$($ AV?H|$lH$dH+%(H[]A\A]A^A_DH 1HD$HL$ HL$WMIL-11HD$0HD$LH$Ll$8Ll$Ll$ Ll$(1ɺlLL}>Ƅ$EHChHt HHtH9u.L c 1LL >1LJIAWfIAVAUATUSH(HT$HT$pH|$(dH%(H$1HF)D$PfoaƄ$HD$ AD$`HHD$@)D$@Lo oSHD$8)L$p)$AQIPCA[]HIHC I|$ Ml$ ID$pHt&H/L9tfHGHEH(BHHmL9uMl$(LMl$ I|$0ID$0HD$Ht)Hl$L7H9tHGIFL0PBLM6H9uHD$Hk(L{(L5ID$8ID$0HtSf I_@H I|$ HhHXb IT$(L(HPIT$(HID$(IoIHuIOIoH1Ll$8Mt$E1L<$ALLl$HD$%DAuHD$8HD$@<HMHtKID$`HLEE1LLAHHxpSHAYAZAuHD$8HMH$@<HuDMDL<$EAELuAD$xEHmAD$|Ht^$Ll$f I^R?Hx I|$0HhHX" IT$8L(HPIT$8HID$8InIHu$MHt$HCHHt H9$L  L-1 LH$LLt$4!;1 HHH|$ LHH$LD$4H$H$DŽ$ֳ$E1$H|$Ht$HHDT$Ht H9>L / 1 MLL_:1 HHHt$H|$ LHH$H$D$4DŽ$DT$$$D!ЃH$dH+%(H([]A\A]A^A_H|$$E1L-H$H$Lt$4fHt$HJHH>H95H@H PL-L1L-9_AXH|$(HL%Ht$HHHH9H@Hh1LPD$1L 8XZf.fDHt$HHHvH9mLH1 L H5U8[LHLHH H|$(HL$IIGHt$HBH$H/HH#H9LH1L1ɺ*L7D$4D$4AG@AG<u AƄ$I|$@ID$@AIID$HAIGID$HL8M|$Hf1Lʸ1ɺH571(L  @Ht$HHt H9L  L1Lg1ɺA6Ht$HHt H9L Y B1L;1L6IGIHBHD$4AG@AG<pI|$@ID$@*IID$HAH|$$IGID$HL8M|$HsHt$HHt H9L  L1L_1ɺs5Ht$HHt H9L i tL11LF5Ht$HFHHBHD$4F@F<xu AƄ$I|$@ID$@2Ht$HID$HHFID$HH0$It$H>fDEO E{HD$E11LHFLHLHDLHHt$HfHHZH9QH@H1L6PD$1L4Y^E1$HD$Ht$HH@HBH$OHHHH9~LH1L1ɺ[L4D$4Ht$D$4F@F<AƄ$AƄ$AƄ$t1 MLL n DT$LB3HD$HH Ht$H$HH|$ LH$D$4DŽ$`DT$FL  1ɺs1LL/3jL  L-w1 LL|H$2HD$H Lt$4H$HLHH|$ LH$H$D$4DŽ$衫L B 1ɺA1LLu2H H  rHHHH9LH1LU1ɺ-L2D$4sHtlHHtdH9t_LH1L1ɺ^L1D$4AƄ$IL i zL ] rL Q L E H $H5H=˶$4LLV1uLmH5/1;%AUxATUHSH(dH%(HD$1 H5d.fL1ɺI H5]A.^@Lį1ɺO 1H58.48L4 H5 -LE12l% 1LH5-E"AWIAVIAUIATMUHSHHt H:*6!u#HCH 6!H5!6!H$LοHH$H8HH,E1HtHET$x9dM{I$HL9LHH D$pLLTLPD$hP1t$h,HL$`LjHjAW$P$D$L$H$舙H0LYEH4!L%4!HoHPIvI$HLH~PIHHxI$HH$H$PD$XD$hI_8AG4HtHUHt HBD$xMtAEHL[]A\A]A^A_fL$XT$hE1ʉH9PAMHLi1ɺH5RQ+_L [@MtAEMtvI$HtmL9thLHLE 1H5*H{E1d+ID$IHMtAEL Y H?Ht$~IHfLL$HEDI$HtL9u*L  L1ɺ1Lֿ6*ALHf.L1ɺ1H5) f.L|1ɺ1H5E1)HEL 1H5)ff.@AVE1E11AUIIATUH1SHH dH%(HD$1HD$PHD$PjjjjjjH@IHHMtHL3uVH1IUL H5(XZHD$dH+%(H L[]A\A]A^@AFLE1TH1AUIH5Ls(Y^HLnM1UH5X<(_AX\2ff.@HAHHHf.ATIUHLSHYHHS_HtHH` []A\DHL[H]A\6fDAUIATIUHSHC0!H$0!H,H0!LHLIuLHPIHHHH9t[DHSLLAHH9uI$H9t2E1fHPHHHAH9uEu"LHL[]A\A]Li1ɺ1H5&DH =H&/!H/!/!HCHHE1z1Lʧ1ɺH5%&HL[]A\A]ÐAWIAVAUATUSHHHjL@dH%(H$1D$|HEHuHD$HtHHt H9HX HD$HHH9u[HH9LHHH;q@uRDIxHL$|H~IH IHD$ H!AGEo D$@AGD$THID$ L54LFH|$ LHT8RPC(Wt$(LP1$M|$ H0IHH-I9/AD$<ID$(It$0HHD$0H Ht$8HT$9HD$(AHD$8HD$0DO\C(LM9LT$HHLM{LU LLm(t$0t$Ht$0t$PP1 $H(C(Lj LAULAWLT$hARLT$pP1#H0LT$HH|$(L;T$M9LT$L L0KDLT$G|LPC(gAUAARP1U#D\$`H ESAL\$0HD$LE) LARDLN<*JD8DT$0PH)кPC(P1"L\$PH DT$(M9H}Ht$It$ 7jC( AWLl$(LLLWAUP1"H}H LHL$ L3 HE?V 9XXu0V H)V V D$TE0AH$dH+%( HD[]A\A]A^A_fDH@HD$Gf.HD$(AHD$8HD$HD$0IM9MBL9|$0LS(HLt$@ID$ H-PAUt$(RJL1Z!H0HCE1HX@HcH;6&HHCfC0HL$HLBK0,LHALGfC4H HDŽ$)$H$HH@)$H$}'!$)$u %H$ƿ+H$HH$LH.<$$DhH$T$@HD$ HMH|$ D$@Eo I?AGHH{HHD$1LHsHT$H; HT$HCHHz>H{HHt$ DϦD$TAGg@PC(LAULt$LP1^H HI9HD$(HPHT$L+|$K(LIHItH)HLRLtLARLT$XP1Q M|$ LT$hH II9NH LhC(LbARPL1M|$ H ALL\$hHLL)LHHL$` HT$PRLL)RAUARL$P1C(Lm(L L$H(LLLU t$0t$Ht$0t$PP1H(C(Lt$P LAULt$pL$ARL$P1}H0LT$`L\$hH|$(HD$0Ht$XS(LH9Ht$H9I9HD$Ht$HLM)HO/LHLHHD$@HHHH|$ L\$8HPJDVAL ASP1ARLT$XWRmD$H@ELT$(<LT$XLL\D)L|$HL\$@LHD$8IωL$`LQPH)HL$8 PC(P16HL$HL\$`H LT$XJ)L9M9LICL9C(HLhASAWARt$(LPkH'L1BM9L9|$0L;T$H$ LL1}H5|[L)HHD$(HHT$HLLASL\$8ARC(AWt$(LP1L\$XH0HD$HLME1HD$0L\1ɺ1H5мTL61ɺa1H5.HLIchPQ H}Ht$LT$(It$ /AWLT$0LC( LARLd$(LLT$ ATP1 H}H LHL$ HT$a+;MsHC( LAWLd$@LLATP1HL$@LLL+l$hH}H L*LL$LL]L|$HM9LIB8ASD$hLWLL\$@PC(AWARLT$Ht$(LP1L|$xLT$XLM9IBH0L\$8LL1H5ԺXLL$L1L.L]H5d"f.ATL%!!UH- !SH]L9t)HEH}HCHHP(HHHL9uH ![]H !A\H !ff.AWAVAUATUSHH(dH%(H$1H\HHt H9L DL5X11ɺ{LLpC`̐C`HD$E1Hl$HD$1@HMHI HLHr# HLABELONEH9D$uAL9|$tvIIuH$dH+%(D$H([]A\A]A^A_Hq!L I9uM$$HU!I9tI|$LHHtHHt H9L H11AWLL&AX1ZLH4]H|$HxHH藬fHHt H9wL HL]L1AW_AXf.CHHt H9}L ?1L1ɺLrsXH=(( #H;SC`̐C`fHXD$HHH9LH~L1LfDLHKLHkHHtH9uSL dHL1AWLCY^D$LHLHfL A@L 11ɺ{L5LL%%`LHf.11g1gAWAVAUATUSHH $HHt$AAT$AMLˉL$AAdH%(H$=  %D$ u(5r& u(ADl$ tKD$ K?!tغH5Lu!D$   t$tt f6 u5\6 H=d,!oHCLL$@ML$HD$PLD$@%-5 EAƅH 5 HHL$(L^HL$(H=5 HLIpH;55 ZHteIL;5 sXHtHAHx5  Lm5 HJJ) t$@0* IL15 EL=5 M_LLP։T$(T$(LLHHAHx6L*!ME1D!6Dt$ Eu E1ۃ *!H#Hx*!D4 H=*!H Ћh*!H9L5r*!L c*!LT*!HHƒDl$ H5EHjASH$PWLAVLT$X讖H0LT$(ABH sH3 IHL)!MD!E1ۄH)!HHt$T$1ɉL$Ћt$ H$dH+%(7HĘ[]A\A]A^A_@D 3  EL(!ME EES 2 /D$`M9i ![l2 Lt$`;3ƒL4L$L1HL5fD! *o;HCL ?HD$P|$@AL$t # 1 @L5Q:!H=::!M[HLL$ .LL$ LBLL1HrILHL$@LL !D:1 D$`E9- Xu D$/D5 ED-0 E0 Q|$`FLt$`L艈0 0Lq&!HZLH=X HPD$$PLL$ 1RAYAZoHCHL$@LH= HD$PT$@H HtH HQH H9H5 H= 5 t4 / oHCHL$@LHD$P\$@D$ AH I8!H4H=OJ/ E1ۅu;2Eo MHCLL$@H bFHvD\$(H5xHD$PL$@MD\$(H=4HtW50uP_7!TfDDl$D#-. fDD|$ E>DfHHLt$`ƒLH=  L L1H fDHcH5VH4DT$ 3fD^ $D|$`Lt$`(D- ELy#!B@AL#!&fDL8LLPHH= L H?PDD$,1HL$  _AXD$ HLD$0HD$8H5$- HL$(LD$0HHT$8H8H - ksLH L so#LEHCd$@HD$PD$ H=5!IHWH5!H8I9H$H0I|5H|0HxLHH)H)HL, L!!L$HLD$$HLLPLL$ 1\/XZDHHL$H A!!1HL/~L_!!Hpo3HCL %HD$Pt$@|o+HCL HD$Pl$@HGL0H8HH9L0H*H8r$ɉ0At tAt ft LH=LL$ LL$ H * H=* 'SHLL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H2!HtxAAADH2!HtfH2!H$IHD$HD$ $(D$0HD$Hj2!HD$dH+%(u&H[ÐHHyHHff.@ATUSHH0dH%(HD$(1JtHD$(dH+%(upH0[]A\DHLd$HL$HLl$HD$ HHL$ LLD$ D$ HsH"tD$ )AWAVAUATUSHL&L9IIHDI\$I1LHHPIc`HC0H9ufHH9tH;XuH@LHLX HHt{fAGM$$M9nH[]A\A]A^A_ff.@HHBdH%(HD$81uHD$8dH+%(HHDHL$HE1E1j1jjd6H tD$tD$ Hc|$HHH H H%H -Ht@atpXH= HD$H|$Aajf.USHdH%(H$1HD$H;6HHHHH aHt~HH HHHtax8}8wt#HE8H;z tHHt$HstH|$uf1H$dH+%(u:HĨ[]ÐHT$  t|$LVM-u< ff.AWAVAUATUSHHHT$HHX IH1f;u H{rlH[HuDmtqIcp HHt\I^ HtKE1L5 H[Ht3;uEIcHK1E)HLIceA9~ H[AHuHD$H(H[]A\A]A^A_ff.fAVIAUATUSHdH%(H$1IAx\LHI@`L0MA/@HL/IE HI9sL)1AAHH9uL IHt^HtTH]H9u8H$dH+%(u{HĐL[]A\A]A^fDHH9tHLI uMeH$dH+%(u+HĐ[]A\A]A^DL` IHf ff.fSH5" t&(!t!uG [Ð!u- [HLL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$I$(HD$HD$ HD$D$0HD$dH+%(uH f.AT(UHHc IHtHhHELHPHL]A\Ã1LH5ff.AWAVAUATUSHdH%(H$1HHL-pGa[SXHHE1L|$H9L<$fDHhC`0ĀA@L5MDH1?ADžu AĀ~HS8H1LPLYAU A%A кP1H HH*H@HH9t H9HS8HLLbA A%A кP1[AY1AZH$dH+%(mHĸ[]A\A]A^A_@A@L5fDH4$DHC8x H9D$8!L %I鿄LY 1R$P1YD^]A@L5LDKTHH9tLHQLk1RLQ_1AXHHtPH9tKLHL-L1Lc`a@L y@L 1|Hc/ E1K`L4$EH D{THHl$LIDI̅HY/ E1@AHA9tc8uLD0IHH9t HtLHL H1Lm1AV9LAWt$"D{XH H=. M$LKHHJ MHxHHǀHH)HHHq. ډa. @HH9t HtLHL &1LLV1LIHl$1LLD2$DuCT184I1PH,LPL)|1XZLL1LH50IHl$Vf.AWAVAUATUSHdH%(HD$1H= t)HT$dH+%(H[]A\A]A^A_fD9O؉H2#!H#%!;%!8cIHHIu IE IEHIEHIEHnsIExz XHnHPHHWHHPHPHP HXH8HHHHJHH9uHPIE(7$!AE0IEA1ɺ}LGH5/1LL1ɺ1H5!!06HrH=zHH IH8H=HnrHxH=zHxHPHH(HH HLH={#!AL%k#!LH HHHD9LcLh (DFHLxDpLpHH@XH@@LpLpHE`HEXHEhHEpHEhHExHHExHHH+HHLDH@HH@H@ HHDžHDžHDžL$$MLHHE0HsHP Le(LHHt0`LHEHHjHJHHEPL2HHBHHUPH@H9u) 5H~) HHt=HHH-P H*@ aLiLAULIT$At$LLAH91Aٹ'LH5H 1V!!L1ɺn1H5+fH !HLL1ɺP1H5+GL1ɺ_1H5t+_!HDžLAUH@1L!H51IE(L1ɺH5*LH $H5yH=ym8Hpff.@AWAVAUATUSHXL-G H|$8Ht$(HT$0dH%(HD$H1M/HD$8IDpXEIMHD$(1H|$0H HHL$ IHD$(H1H|8HHH|$HH$HI9s?fLDLI~I9uIMHD$(1H H1IHD$HHH$L9<$HD$@Ll$Hl$0HD$Dt$JfDHT$ Lt$@LH)H9HGI^IH1ILL)ML9<$LD$t$1LH|$uHD$8HHH;D$8LHD$0ZL(H5ǡP1t$0HD$H@`AljD$XA ZAt.H\$8H= E1sXyH/ AHD$HdH+%(HXD[]A\A]A^A_@@`Alj$A AH\$8HttiDsXL- L @HtHHt H9L L1E1LpH5EHD$8HHt H;D$8tLHL vD$0H5LSP1t$0Y^LHv@ATUSHH $HfdH%(H$1HH|$H)$HHEa1HHuHtHLABELONEH9$HLVM2 001H9$Htfo$ Afo$0H$dH+%(HD[]A\HAąu)Lp1ɺ1H5HfD1HHHtEaubLp1ɺ1H5ΞE1PAH@Ea6uXH= H,uXH=n iH,f.AVAUATUSH0DdH%(HD$(1EH= H?HIIHtG`t ĀPuXH HLHLt$H$HHD$HHD$?AĄ|H= XAĄ]AHD$(dH+%(lH0D[]A\A]A^De`ADe`A A^HuXFHEH#H9LHAULS1H5'uXX;5 H=Zu H  EaE1fHHt H9L x1LP1ɺpH5|uXH=]XHp*E`̀E`NHAHEHt H9L AULSfDL @H)OfDHtcHHt[H9tVLHj1E1L4H5fDLHLHXL QHEHt?H9t:LHAUH5C1S|L_Y^L fUHSHHdH%(HD$1HHt$D$$$DL$$AAt.==t/HL1ɺP@=t4=tiH1ɺPH5PL1wY^CXH-F 8 6 HD$dH+%(ukH[]=tHL1ɺP1H5XZDLk1ɺH5Zf.AVAUATUSHHVdH%(H$1HHx8LNHLH HH=xI1H@LLHLL$HHLABELONEH$HD$ PAąHt$ϦoL$HSD$H"HEHt H90QL RL51ɺ1LLY^EaLcHI I$gLLH\b A9EXuLM HF 4 +f.Li1ɺ1H5/H$dH+%(HD[]A\A]A^DHL1E1jH5_AXfDLHQRDHHEHt H9&L ?L,L1E1l81E1LH59@HEHt H9L LL1E1QL 11RL5LLX1ZLc1I I$S1LLV@LHLH@fATUSH1~IHu%U@H1HHHPEaLH1HHuID$Hth I<$LH-E8HEH}(H}0LIT$At$LBLHE HHyH=B m[]H0  A\H H#"1ɿ1LH5HBLf1ɺH5ff.AVAAUIATUHSHH@dH%(HD$81Ht G`C}XItHH=-HtZHH-u(H1L1ɺ]@Lta1ɺ1H1LSa1ɺH51]@ATH5=H=lwHtIHAuDA\f.1L`1ɺH50?DA\L`1ɺ1H5 E1ATH5=SHHHHt]HALuHD[A\DH1SDL˹1H5XZDH[A\HH5hE1QDLt1S1_^_ff.SH$H u[fDH 1SD1LJH5XZ[ff.AUH5;IATL%ULSHdH%(HD$1H1HHH$HIMHIAH1HZu6HAu\HD$dH+%(HD[]A\A]fH1ɺ.ATD1H5LY^DH11ATD1LH5XZn}H-1LD#HH1L[AŅ,WD L1ATH1E1ZAXAYff.AUATAUSHxND EAuJH1HAŅuTD-ٽHD[]A\A]1L}1ɺCH5E1HD[]A\A]fDD0Aąt4H1ɺUSDLZ@H1ɺISDL1H5E1'XZDH[]A\A]=HuN=ܼuɼHLL\1ɺk1H5HK1ɿLDh1H5Sg=e tfDLZ1ɺb1H5'AWL_AVH5ˉAUIATUSHXdH%(H$H1H$Ld$pH$HD$`H$H$H$H$Ld$xLd$pHD$HD$hHD$`#AƅLkAƅ A<i 1vIH f.LL%$IH*HtH$LxH$HHPHH$AGatAwXH=vqLL,Z1ɺ1H5TH$HdH+%(^HXD[]A\A]A^A_ALY11H5,f.IFHth I> LL15H5AL$M>I9@Hl$HLMLd$fDHIIH9HMgI1LLHuIIGHBHH$UHD$IH$IGH$L0A$L$tI$H{L9rLH=WL?11H5M$LL0HHtSmfIA$AF AFIHH9f.HLd$Hl$L<1GH54_AL$I9t(f.IIV1LHPM6I9uL$I9t#DIIV1LHPM6I9uH$D$THD$(H$H$AHD$X@^ H$L=uHLHD$0D$D 4DIAL=]Ht$0LEAt*H1L1AWH5A_X0D 1LH5կt Lt D$DD$DHL}HD$D$HD$hHD$`HD$p1L9tf.HL9uE11LILHr HH;d!DT$EH|$`L|$L7H;|$t@HGIFL0LM6L9uT$LE11L mH$L7H9t$fHGIFL0LM6H9uH|$pHL9t#HGHCHHHL9uH$HH9t DHGHCH`HHH9uA<SIH5H5H56HHD$ HHD$8H۴H9H$Ll$HD$0fƄ$HD$0)$)$oJT)oRd)PHjHBHD$LuH9H$I9H!MH5#LL$L$HEhHT$H@8H%;I$HL9 H@MMH H5WLDHLI1P1AW$H|$(H 1ҹL.ILL;t$ILehI$H~cHIbIID$pH$HzMMtH5LuHEhHL$H@8H%;jI$HHLl$T$DA^APt$DLc?fDH D ݳLH5jHLHH)HҺLE11lL11MH5HDT$E At`H$E1H9tfDHAH9u1Lø1ɺH5E11HILlHLIE7D$DD$pL I@D$ \I$HL9H@MH52}MLLDH1ɺPL#1AWH5KT$H IL;t$xDHT$8H ܰHH9HD$8fDHt$(L#qI$HL9LHL`1ɺ1H5S1I$HtL9tzLHH11AULH5tSAWSLH HAd$`dH|$1LHHPHt$01$ZHefDL L 3@HrIH5alQ|I-hL1ɺ 1H5Y}A:L٩1H5(}SL1ɺ^1H5-D$Dh1L1ɺH5HH9L1ɺ1H5LMN1ɺXH5wH11AWLXH5bvXZ 11LjvH5?Niu 0xL^D$DYL1H5{iL1ɺlH5 LrD$DHt$(HT$TLD$DLpD$TD$D'L11H5;OH$L7H;|$(tHGIFL0-LM6H;|$(uI2L:D$D5HH9D E1HD$HD$ Hl$0H\$8Ht$LIHII9tL=.HtLxHl$`H\$H9u@HmH9tH}LuHttAFb HIƨHLHL$HHL$HD$ SHD$Hl$0H\$8H@Hth L|$I?LL|$`HD$I9tL$Hl$0LLd$MIH+DHNHFI3OI3GH HmH9tt<-tL1LVLIHfƄ$I)$)$oA)AocA)gHPI9t7fDHBhHHI3HI3GH /HI9uHEHuATLVASHIH VH0I ȁA1PA Ѻ?H5R1_H D$Ld$Hl$0Lt$ kL$VL1ɺ1H50HEQ1AVL9HIH AWH0I APA H51H D$HEAWLH5gHIH H0I ȁA1PA 1H_AXD$HEHuATLASHIH HI 0V A1A P7|L1ɺH5L_1ɺK1H5Lߣ1ɺH5qH$L7H;|$(tHGIFL0cLM6H;|$(uL>HD$(H9$ug1ɺH51LL?D$D:H $H5KH=*KHt$(HT$XLHD$XHD$H$H0HD$ Ht$H9Hl$8ILl$0Ll$(IVHHH9H$LxL9uHmL9t}H}LuHthH|$Ht<-ttHu?IIFHAHH|$pHD$xHt$ M&IFHD$xH0Ht$xHt$Ht$ HIH9t HD$$Ll$0Hl$8H$Ht$H !fHHE1H9tqHH9uHD$pE1L9t HAL9uQLk11RH5.8Ht$8H|$H|$ A[A^D$x1`ATL%ڞ11ULHLH)t=1ҾHvYHt]Xt,H]A\@1ɺLLEmHLLD1]A\FfD1ɺLLD%1ɺLLDRAWAVAUATUSHH $HH $H8dH%(H$( 1HH5AH>HHl$ AľL5 1IHLHZGoEAAAALH1H5P&LC1ɺ<1H5E1H$( dH+%(H8 D[]A\A]A^A_fDHl$ 1IؾL% HHLx1HML1S7H5_t]A\E1gfDARAA L$ DH& L- DEL9u@HL9L{HLu|$ ML-L1Ƀ"L P1AV{DZYmAfHCeA~DAWAA L$  IHuH"IEIH/|$ LoAEM}1Ƀ" P1AVL5LAXAYHD E 1ID$H$ HHRHߺLYY"^_L$ Ht$HJA4t$HL$ HLHILL^P1A[[fHML1S2H5ԾA]A^L$ HDL11軆t@H= H IEH IEL(L-q @11wI}^LVL?11L9L$ LHt$H߉BYcLL?11H5ڽLa?1ɺ1H5ޛ贽ff.@V H_ S^ T HtwЅt C tkL1H53[   0tWDUHЃEeu;~xu5~u/@H5p{-t@]fDst3uu^~nuX~uRHH53>-]D~huǀ~u@uHH5]-I1{LrH51]D1La1ɺgH5pϻ]AU11IATUHAąuD]A\A]" tLH;xAątA]DA\A]D11H5Hmff.AWAVIAUATUSHHHiL'L9 HvL9 %HVL=AL9 D萾ŅL>fD蜻D9t,PH5HAAULX1腺Y^,LDiHHH;6 pH;9 SH;< 6HH[]A\A]A^A_1LH5H1[]A\A]A^A_AL=D{Ņ|8HML¥PHPHP1H5)yH 1H[]A\A]A^A_@8TA?MHZIHHDHH ;APH5L.QP1H D׹;8A?MIHaZH6HDHH tAPH5OLQP1蔸H 9 <8uA?MIHYHȑHDHH APH5LOQP1&H DL=ȖE1!fH @H @H 8ȾA?HQYMIH H bHDRAPLQPff.AWAVI1AUIATL%%ULSHdH%(H$1QIljLtHŸjHc1LLH5ԕ_u,)LHtHxLH513t*1L u1ɺLH5F薶1H$dH+%(H[]A\A]A^A_#8\M1ɺPHL8PH51/X1ZfۿL-8H 1ɿMPHӔLPL581L臷;;ȼM1ɺPHL7LPkfD[8蔼1MPHOH5PL71gY^Vۿff.AWAVAUATUSHHLwPHwXI>1IHChHHIHIDL<@HI H9HHphL9sIHDL$HxjAHHD$A[X&1HHHD$IDL$HxjjALIXZ1L\$"ASLT$ARL(L ILDL$Hx$@HIIDL$Hx$@HHD$Y^.0AWHT$LIL1LR&l_1AXM9rH[]A\A]A^A_HCPHHshHDL$Hxj$@HIXZ/HHIIDL$Hxj?Y^AWATIL%1L.Lb蝲_MAXL21LwHCh1I>HID$DLHjD҃HC?LHIHDL$Hx$?LL-I41H$ͱAYAZ1H[]A\A]A^A_L^LHLLM9MAARLIHRH| HH9to8uHPI0HJIPH31H3QH u'IpIPH3qH3QH uADIP@HtHI@HtHI8H9J8tHH9uMM9XfDH1L621ɺH5苰1H@UH5UHPHt H{0PHD$HdH+%(HXD[]A\A]A^A_f. 'HHP`H4H ʃHHH9ŸHDMHPHEHT$EH@PH8wHPHHEH@PH8HPH1ɺ*E1L_#H5ŀ HE1E11fHt$11H,)D$ )D$HD$()D$0`;HH\HE1H@PHxIHXIHnH-1M^ID$HD$HD$HFIMM3IG 8uHxH莫uHD$L9@HH@HtI9uIGHAf.E1E1McHEHT$FH@PH8tHHtwLhMI}t I] HMmMuLXE11@L̏E1IH5-1!l@LXL!1ɺ61H5~LE1'Ll!1ɺ@1H5~E1輟LC!1ɺ41H5~E1蓟HPI}ADžHE1LH@PHxGHXIHH*E1E1I$@#1E1HDžPLH5~IHD$H@ID$Lr 1ɺ;1H5}LE1连LF 1ɺO1H5}虞LX18AWMAVMAUAATUSHH(dH%(HD$HGH@PHHD$kLLH%Aą"HKH{HQLGXHH @iHPIHGPH5 L8LD$HH@ H@XHt1HT$LЅL=|11ALjL]CHCI|$HPHH Hw`;A$HcEHHKDmTA A&DL1ɺ1H5{לHD$dH+%(H(D[]A\A]A^A_ÐAL911H5{茜f.HEaCTdHH{Hp`FAąL1ɺ1H5.{$HHLHI9I$P A$HID$L¾CH@PH8zy\ID$H5H@PH(HD$HH@ H@XH1HT$HЅD$L=@z1A L\L9HKI|$HQID$HQHh`;HH DHHHH9EHCH|$HHPXBxAHK_fDHH@@dNHHHH9DL$L1ɺ1H5y@~f{L=xIL1LNLM1ɺ1LE1衙@ID$H5H@PL8LD$H<H@ H@XH+1HT$LЅD$L=5x1A LQLHKfDD$H}AąD9mTLt$HDAEMA$D$I~j%H{ZYI HuTI~IAEMA$D$jJ%^_AWATIL1ɺH5w1AXAYDmTHwI$PI|$H}DtAąLE1ɺ1H5v蘗L=v1ɺ1ALsLfALL1>xfA1ɺ1LH5v @E1WL=u1ɺ1ALӆLƖ`LM1ɺ1H5u蠖AL1 H5{uqL=euA 1LL?#諠I|$I=ff.AUATUHG`HH-H4HHH9HRB@H,HHE`HEPH8AąHu`,1E1E1j1HjAXZE+HEPHL(HL D]A\A]HH9uH4sIfHLgI1E1H5sD]A\A]DHHH9HHzHH8LlIH5s1联D]A\A]HLIKHL4IH5%s1@Hj(AH1ɺUIH5rL1ؓY^GctHHH9t1HH9ut1DHH|$bHt=HPHR`t-H2r&HH|$H;xuHf.1HfHHH9t:fHPHt HJHtHhHt ActH9tHH9u1@fAWLAVE1AUATIUHSHHdH%(H$1ILHHH=rL9IDHD$@HD$8HHLLI9IDE11L$|$Hu\HD$PH|$8HHHPHSHPH@HSHCo?H$dH+%(HĘ[]A\A]A^A_ÐHHHVLPDL$X1H5Mq芑XZH|$8>1f.LGH5 qN1]H LLIH5p1H LQIH5p1ِLOff.@AWAVAUATUSHHLwPHdH%(HD$81HM>H9HCH@LhMHH@HD$HHLAąHu`Ht$HHǃhJrAąH|$eAąjL2LIu`4LTL1ɺ1H5To葏E1fHo`,HL AądL5> t vu? H5GJHfHT$HL)D$)D$ ,Ld$EH^LH胧Aą#Hu`,DC LIH5Qn1E1艎HD$8dH+%(HHD[]A\A]A^A_L1ɺ1H5n?D胲fDL1ɺ1H5myfH LtIH5m1эC@S LI f.+ LIfL 1ɺ1H5"m_f.HL-l LLI1H薋LH軥AąoH LlLI1ՌGHL-lQ HELPLǀ1虌XHZLH4AąH L?lLI1NfL-kL 1ɺoLHLLI1HkLH萤AąDH]LkLI1誋H-LIH5;k1vff.AWAVAUATUSHHHoPHdH%(HD$81HEH$HH9dHCI@LhMHLhM~HL{ADžIv`LLHǃhlADžAH sADžLHD$HLH'j1ɺVHIL1IH<$LADžL1ɺ^1H޿Ht$H<$fHT$)D$)D$ $ADžL|$EHdADžLP1ɺtHIL1蠉H<$LADžL1H޺{IL1aLهH<$HIM`L1H޿IL1H<$L蹡sL1ɺHILh1وLAADžLEIt$`4L/HqtHAUcLH1E1jDH5GhADžkLL|)IH5g17L{IH5g1E1HD$8dH+%(HHD[]A\A]A^A_Li|1/H5Wg蔇fL|1CH5/glf.LA|17H5fED1DH-Z H蠠FH~LM|L'IH1LHzLHL "H "LHDLDH1ULD$ H2*ZYHt$LL\(H$AD9hLWL|$@H$HHD8AAcH\E1SpH߉T$,+D$(HCHHHD$}T$,If.1DHXH gLs1fH5WL|$fxHCH@HHCH@`H!H"(HPHBH@@HHHt{H9tvHAHD$H$DzH|$PPT$,|T$,IHlUpHT$, H}HD$(H$H|$HD||T$,IjfDH!YHD$f.1 L)H5HWPHBHHRH9HHfH*fHWP-HJ 1HHR(HH9gHNfH*HfH*IfDHP<G2Hk@HHHH9LEJT1I@hHDHHHHH9H1HH9HfH*HfH*fDHWPB8HJ HHR1H~fDOHOPHQHt]HI1HtRH9HpfH*HfH*^YV,=D[]A\HG@H@@GpᐅHGPHPHH+HHbfHOPQuH1t 1H9qHQHo1HdH9t/HfH*6fD&fDHЃfHH H*XfGxHfHH H*XfHȃfHH H*X{fHJHHR1Hf.I@PHHDL$HxjHsPIHEH6H@PHDL$Hx$AH}HXZAT1H5/NSILj1nY^HJHHR1Hf.HJ0H~HR 1Hjf.HȃfHH H*XfHЃfHH H*XffDHfHH H*XfHЃfHH H*XfHfHH H*X{ff.ATUHSHH0dH%(HD$(1Ld$Ht$HD$ LD$ HD$ڻt1LHʻHL%zLLti18LCmHE@Ht HHtH9umH ND$ HQLLKH LxMHHDº:P1lD$ZYHT$(dH+%(u.H0[]A\fHJf.L%Kawff.@ATE1UHHu2HE`uu H"s-DH0^IHt@L`HL]A\fH!rH.rH/rH&rH'rL1ɺ1H5KkDHW`HULH%rHML@t f.u t HT@HA1EtHTHÐHHH9AUATUH HH9t8@1 tH9HAHpt&Ht}H]A\A]@E1]LA\A]@HF@HtgHHt_H9tZLjHLoHL`LIHtLLHx]A\IA]LHHhs@L-1L@bt9HHH9{HH@&HHhg1Lzf1H56IjE1ff.fHHH9tYHtTHPB t HBfu-HW`H%rE1H-rL@HL@hLÐL LDE1LfAUATIUSHHFPH8HHCd HkPHEHh:nHI+nH{HHnIl-LHHIH1HH3jHCPLKHHHfLHL1Hh膏xrHL[]A\A]@LIHtHL[]A\A]f.LI1H5mGLhf.1E1LHH5:Ghb@ATSHHHdH%(HD$1HH9tOCbtIHtDHt:HpHCPHL$E11H8萨AątaE1|$A/E1E1LcH5FigHD$dH+%(u4HD[A\fDL1ɺK1H5HF'gqATUSHHdH%(HD$1AąCdHHHH9HxXHHPBHL H1HVDH9H;uHxHȮAąH$E1<(AAfDHD$dH+%(HD[]A\LKH^LbH5E1E1eLKHfLbfH@HkE1LbLHHsH1H5DeXZKLKHuLbkfDL1ɺ|1H5pDOeoDAUIATUHSHHHt\H,jL`HEPLHxHHtLLHsHHHt8HH[]A\A]@ t&H 8 HHu1sHL%ю LfuC f+n8dkL IH5[C1=dL0LH1f ff.AUATUHSHHHGPLhhMLgHMt_LhIuLLI Wdu3LKHL`7H5BcH1[]A\A]HCPAmLhhHkHMtNHtIH}hHHLHEejt<E;eu"LKHCL`/fHsHH[]A\A]@LKHAL`1H5BbH1[]A\A]AUATUSHH $H(L-HT$HdH%(H$1uLGH|$Ld$D$LgHHXH\Hts:H$dH+%(H([]A\A]HT$HxLHHILHLHH) H)։H롐H|$foHHMLd$LLoH44T$PATfT>fDT$ۉATT"kff.fAWAVAUIATUHSHmuxHFPL%?HHXa`LHL%AąBHzL^IH5?1`rAƃA Htjte(L=?1ɿIL1L2Aq`HLpEAHD[]A\A]A^A_DL=C?1L]IL1 `H^LHxAąuL~1ɺ1L_L%rHEPHHDADHEPHH7_*HgHL8$ HLI]LI15_HL==>1LIL?1_HLLz1ɺ1LE1^zE1ATIUH SHG`H*H-sHHH9II$Ht HH%A$H"rH!sLzu]ID$` uSI$I$H9t>H$M$AAHrHNHA`EtH$rH29HH9uL[]A\ÐM$M9qnHI9uHH9uDA$%HJXHA`LuI$I$H9uDHH9sHCHxtLL=IH5<1\HCL`&ff.@AWAVAUL-;ATUHSHH8Ht$dH%(HD$(1HHD$HH9¸HEHD$HD$ H$@H4$HdLd$ Mt$AIH5:nfM~(I<$Mvh M]lAH E]}HE11PL'Z1L[XZEa}HD$Hǀ`:XHEPH8,Dmb Et6n \umD\EM\uy\p\R b衰G\9\ HL;LI1ZHD$D`EE1DH@ML=[LXH1P1ZA\A^ HLE1PLX1ɺ1KZ^_EaH1ɺLILX1ZVf[~fDLj12H5fY1ɺALMH58YHD$(dH+%(uH8D[]A\A]A^A_I<$AHLW1ɺIH5Q81EYL1LAĺ"YotxHD$Aǀ`HD$FHD$H Zǀ`7AąLO1ɺ1LXH|$wSAątEHEPH8$D e_ Et.k YueDYE<|2L1ɺ1H547*XwbAWAVAUATUHSHhLdH%(HD$X1HI9ƸLDHG`H0H2HGP]9L I@e AL~HEPHm`,HH89H )Hu`,Ht$ HnHEPHL UHLoLeV1ɺyH5 6W_HE1E1jH1HjLLl$8AUH D$  LHH55tLMAŅILxLLH8AŅaI@I0H5HD$I8HD$I MHD$IGPH8II9fIFH/LrOAŅ_E11H1LMAŅPEpAGpHEhIo`2IGhI0HtDHD$I HD$I@HD$I8HIl$`4AFT IH11LLCAŅH1L.4AŅuPL1ɺ1H5 4ULS1ɺ<IH531TL?AŅtxH@QAŅA4DC6LZSIH531E1THD$XdH+%(!HhD[]A\A]A^A_L1ɺ1H5I3?TDH[L?SIxILL`]AŅLH'6AŅ|LDPAŅLU1ɺU1H52SHHH9edLHEPHL QHLlH5W2u#L1ɺtHt$6SHt$L1ɺu1E1SfDL1ɺQ1H51RYfLl1ɺ}1H51R1f.L<1ɺH55R@L1ɺ1H5q1gRfL1ɺS1H5I1?Rf.L1ɺ1H51Rf.L1ɺ1H50QQf.1ɺE1LMH50Q fL,1ɺ1H50QL1ɺ1H5c0YQ[ff.@HG`H0sH2szH$r;HHH9aLBXLfDHHH9LBXMuLMuʩtJHHH9}aHL@Lf.HHH9WaLBXMj[Z@E1LÐH%X fDHATUSHHdH%(HD$HG`HDH HHH9HH}AHHHEH}@*HAąWHK`H DMLEaHH!D1H"1@tLI;\t,tLI;\tD@HHH9uE9H$E1<DA4H9BLKHLKH5.1E1NHD$dH+%(HD[]A\@LOHLN믐H<$DE1WHAfDHLOHsH1E1LMH5j-NNXZkL1ɺ1H5@-N>LKHLK{Xff.AUATUHSH1HLoHt-H]PLHAątOHA[D]A\A]AL)11ɺQH5,|MHD[]A\A]fD1L1ɺTH5h,GMHD[]A\A]fAWAVAUATIUHSHH8HHH $HH@HHHHH $H@HHI$HtED(Et=H3H{MH/H$HMHH0/DHID$`HX OD$HHDHHu E$EtLH $H'L3L)H&(H$H%zE$EiID$`HHuLID$`u H $H/L)H HL$H.L5TMLHL.tHNLH.L1ɺL%=1L$KL1ɺv1LK:fH $L;L1K HMLH.tHRLLH-;L31ɺL%1LJL11gLfJL-KLHL- HMLHq- ID$`D$ĀLLHE-ID$`L|1ɺa1H5IH3HD$D$H8[]A\A]A^A_fH1KLH,HLLH,D$ID$`f. LH5.IH1LHUH5ID$AfDH $H"L3L)H! HpJLH+I$I$H9YLhIE }@&HHfID$`fD LH5ԀHH$LGZH5H1Gf.L`M}L5IM9| L|$L5IfDM?M9\ IwLRuL|$HIH\$LIHI9|HsLQuH\$HILHm*8 MD$`D$I0Ht$LH=*L1ɺfHHLH*tH;JLH)L<1ɺcDL$1ɺDHAHLH)tHILH)L1ɺ`L%E1L,FL11qLFBf.HGLH.) D$ID$`@HGLH(tBH+ILH(t,H-ILH(tD$ID$`@L1ɺe#DL舱ID$`H08tHt$HJHe(L]MD$`I4LI-'fLLHHAH$AAL(AoL_EtHH{JLH'HGLH'~H$D$MD$`L(H`I_I(sCHGLH~'L<$HGHI7`'D$M/E$L3EIM}HEM9H\$LIHI9HsLHNuH\$HFLH&ID$`t H$7A$ ID$`H7H$HHHH0&1L<$HHHI7k&HH;w M'HH I$H CHHHHL`D$HBI$f.HiDLH%tHELH%hL1ɺ DHFLH%MD$`D$I0VHt$LHv%MD$`4@HyELHN%VD$MD$`@HELH%tHCLH%LL1ɺL%1LAL(1ɺl1LAf.HDLH$MuL=FM9 Lt$L=FfDM6M9 IvLKuLt$HCH\$LIHI9 HsLhKuH\$HFLH#^ MD$`D$AHt$LH#UL1ɺ6L1ɺDELL EHELHa#( H$MD$`L(L1ɺL%1L?Lh11{L?f.I$ID$`2H$'MuL=VBM9uT @M6M9D IvLIuHUBLH"L1ɺL%71L?L1ɺ1L?4@L3A@MA {HBLH"O H@LH!5 H$MD$`L(6DHH;M$I$I9H\$(E1LE1MD$ID$Hl$ THh(H5p`HHtYH58]HHZD$f.HL9<HC@t{LDEDDD$fDH$T$L HHdI$H l>HHHHL`HBI$L1ɺ1H5K7=jfLLHb t1M}H#?M9f.LH5 Ly1ɺf.H\$LLHLA1ɺ nfHiBLHt:H>LHt$HUBLHf.Lܽ1ɺKDH=LHfH>LHLI|$`H$I$I$H9E11@HH9nHPL;bXuAHl$ H\$(EELt$L$ E H3H!<HLݼ1ɺH5A2;eDD$ID$`fDL1ɺ1H5:"f.H<LHtH#>LHuL@1ɺ LȦbID$`fDL 1ɺr+DH)<LHfH=LH|LD$EHHH =I>HH IVL0LHHPIVHHN=IF H$D$MD$`L(U@IGPH1L9H5LAwH1t9_AX|@MuHm;IM9uSM6M9DIvLCuH;LHb0A$:H;LH9 L}1ɺfDH\$LH<LHt2H#<LHtH%<LHfL 1ɺ7L%u1L\8L11L?8rLƹ1ɺ)H5p8L1ɺ2L1ɺTDLt1ɺDH3H8H!LB1ɺH57fLLHt'MuH9M9cLHL1ɺ @H3H8HnL1ɺH57:fLLH2Lv1ɺH99LHGLB1ɺoD$H3H7HD$H3H7HLܷ1ɺH5@16d@LLHZDHt$H7H4OID$`fL%Le1ɺL5fL|$HD;HLtH;LHuL1ɺ.1L)H5nI5Lն11H5<(5[1L)H5m5L11H54H8LH LP1ɺ"L|$H6HLtH:LHvL1ɺ/L1ɺDtlM}HW6M9H\$LI HI9HsL>uH\$H06LH=A;I|$`H$I$I$H9HHxXlMuL=s6M9u<fM6M9'IvL>uHU6LHxL1ɺ~H7LHuD$L%(L1ɺL3H\$LL}1ɺLj1ɺ2L|$H4HLtH!6LHL"1ɺIH6LH)L1ɺ%L1ɺ H\$LLHpL1ɺvL%L1ɺL1H6LHL`1ɺ(LM1ɺH51L)1ɺPH5LH0L1ɺ+LLHHMH5LH]XIEH5LHLW1ɺ;H2LHL"1ɺyAHt5LH-IE@ H}5LHrL1ɺIeH4LHEL1ɺ28H4LHL\1ɺ5 L%LB1ɺ.L/H4LH#f.@H$HHH9?HH@HP`H0ruH%r@uuff.V9WrfDHHNH9ff.H 1H9H9~tDFF;BHLL9tAfALt)H1HRH׃:u HRR9ALwH L9uȸfAWHAVAUATUHSHLL>HD$LfI9NAFL1ۅu)A9^LIH @HHʃ:uII9t%HRHz1H9xHDL9uu(LH $IHfH@ H $@IHDH@IEH@@HHHH9HRHEP L3H5LR1uH\,I?ZYIGM}IEIGL(MoA9^L@M6L;t$H[]A\A]A^A_fDH e@1L3H5+H1[]A\A]A^A_H $H5H=L.ff.ATAUHH軅tHD]A\@H uHE`H&rHxHE1qAfHHHW E1Hv1Hz j1jjLdWH(ff.@AWEAVIAUIATEUSHHFD9F I~H 8HHAVIF9v/)HHTHHHHfHHH9uEMUPIIMI}IEPI}HP HH0]I}H5aIEHPHH0LLMH HlHH@0IE@8H0HEGD1L"7L H5)H1[]A\A]A^A_HHH{HH@@HtHHt H9H I>LeH4LT$IDR0 L h0VL7H5ATUWQPHN0AWLD1(LT$HH@Mt I}LIAnH[]A\A]A^A_@HNGHISIEHE1HH@0@8$ H-\L5HC(H1Lʩ1ɺU &(H1[]A\A]A^A_DH@0H- L5@8* H1'ATASHHHQH@@t"DHHBH8t1AHD[A\HQHtAHD[A\fHQHtHsD9fvD9fvHSH{EE1ɋJ MAąuL¨1ɺt 1H5)'uAWAVAUATUSHHDaH<$@EuOIH$ztA@IIΉD$ T$ Dt1HHIFH8t H$AD9`wf.E1hHHH,$H]H9u-ɐHI E11j1jjRH uHH9tIELCH0MuI9uD$ uAHD[]A\A]A^A_ÐAM H<$EE1LLAąuL1ɺ 1H5%ff.fUHHHWtFpVH96HEHFH@u!FP1F$E8NTHFXH]@Gau2FPF$EL1E8NTHFXH]fHt$Ht$FPF$tfAWH1AVAUATUSHL?Ht$I9LDtIHD$L(L9t|AGL1E1uAbf.ILtMtIuLӶt EuZAA9_Lv#H@HuILtMmL;l$uH[]A\A]A^A_fIEH@@HtXHHtPH9tKHZL誠H{SILI21H5#ZY1H[]A\A]A^A_HfH AWAVAUATUSHdH%(HD$HG`H@H4DHEL6LfLq(L}HLHHL&AŅuL;_t]HM`AWL11H5$E1 #XZHD$dH+%(HD[]A\A]A^A_DL'HI'M|HEPLHxIH$HI1LH\LbIx^L6~H]PHT$LHZAŅEa@LH:AŅA)@L)1tH5  "H1AVLMHyH5L0!^_ADLMHE1L+)H5!L901pH5xd!TL$L (HLY0AV>ɹLDL1ɺJ1H5!w+AWAVAUATUSHH $HfL~PM7|$HLT$1M̉L$DD$dH%(H$1)D$ )D$0)D$@)D$P)D$`6HD$ MtA$Ht8uZHL/I1H5?+ 1H$dH+%(H[]A\A]A^A_Ë !H'AHD$(=~Hz'HD DAT$tHi'HD DAD$tHT'HD DA|$LMHIhMtpHHHD H$1HFJ\ Ht$ LL贖A-H=6H| HH$1H|$EH|$xIAD$Hl$pJ| HA@HH1eEx9Hl NHL-I!1L.H5H41(AWAVAUATUSHH $H(L~PLNHMdH%(H$1Ll$HHIHhLH|D11LH4bIHHHH5N%rHtHLH5K%WHurML-H5Q1E18H$dH+%(]H(D[]A\A]A^A_@LMHL,룐EEVhHup$H{DT$D)L\$LjIDH詩ZYDT$ L$1H޿ML,MI ARP1c^UpAFhA_AD$`uK)‰LHHH H O-Aąu(ML$H1ADM1L+H5?&ff.@AUATUHSHHdH%(HD$1t1; LV,Gc S5HE`H"rH!ssH˗EdH@#L ;ULDHL,PH51E1ZYHD$dH+%(IHD[]A\A]DLLM9+IL$HQ@A|$L(DAD$(;AqHEPHH9Z=L- H5911&*L1+H51E1@L;H&MH'HH 8H(LM9*L*E1亱H5_KOfDH'H$sI$H@p9ChI$@蟼Aąl1L+H5DID$@BH`Aą/H.L IH51w{fHIT$HHB HHHLIHSL)@LH>Hx 衻(LEdgM9H% DHXL)IH51E1fLJ(HHL/)IfL*;f.L9)f.HA D$H@XHt[HMP1HT$H9ЅtGD$t@HE`DL8)HYL)IL9)!DATUHdH%(HD$1HHG`H@@uaԓHtwHג}LV*IH561E1HD$dH+%(HD]A\fD胒xL)IDHHAąHE` uw@AvsL2)I?fL(E1nH5_K)fDHzttHE`tH`HzdH蘑L)IHpL/)IHHLT)IH51o@HL|)IH5o1Y7ff.@@ u AUATIUSH 5tiH-@j *A$A =,HLk11H[]A\A]@HFPIHHHHtU>#tP%g t1& y{IEPH~P,9HH HHK4LL[H]A\A]f=IHLj11@=HL 11A$@ =HL11qA$@ aL1ɺH5PA@=HL11@Hx@P, IEP}fD+6{fDH4%AVIAUATUS1ҾLAZ1ҾLD,EAD tED9tzCtX ډ Љ ‰ Љ ‰!AAAAL&1ɺ^1H5D ؅u[]A\A]A^ÐE11A1ɺdL&H5ž[]A\A]A^fD+11L%CH5s_rfAUATIUHSHHHH9u/HH9t H9Xu@H[]A\A]fDHC1ɺwL-L%LHHC At$HLP1XID$P ZHx螽HtYf@I$@HXt_I$H(HPI$HI$H[]A\A]fD1{LLj%01 @AUHATUHSHHH9tH9ktVHH9uyDe H}HiSATI1L@%H5üXZ1H[]A\A]ËCvCH[]A\A]f Dm H}IAT1ɺAUI1H5^L$CHCHHBHY^H[]A\A]AUATUSHHHHHH9t#H;uXH@urH[]A\A]1H9tfHH9uH=HL$SI1H5 XZ1H[]A\A]fHxDh HIHLH$SI1AUH5>AT( H 1;D1L#H5 1 ff.fATIfLHtL`L'uLA\DLE1-L)$IH51v LA\HHH91E1#fD u'xLv&DHH9t"HPHPHRuуuHAH9u޸tE1Et>A9tDffI*H*^Y,t=Døf.f.AWAVAUATUSH(HFPT$ Lt$hLxD$pL$DD$,@LL$H|HILh9IH-HxHHHHǀ`H1H)hHLHKH1H> IHC2D$ I]MeAE D$AE$D$AE(HD$IE0D$`AE8D$pAELD$xAEP$$A$AET$A$AH$IIIIIExIIExIIIMt*MLIN`LLnHCĀtIl$`1t IL$`H(L[]A\A]A^A_HL肷HIH1H IDŽ$HC T$p$DŽ$C$fL1ɺ1H5)f.1E1L H5Ͷ@IDžLLjL&1ɺ#H51E1v1ɺ?E1LH5]NfIDžLLL1ɺ)f.HWGLB u+BDAWMLAVAAUL-ܵATIUHSLHHGLHHQ1rH*SG P1H 9]L~M |$`H[HI!M|$`rEHL`DpLHAąt~AHD[]A\A]A^A_fDHL`Eur@뱐H}E1蔃.ALPELLP1XZL\1ɺB1LffDLL1E178ATD$vUASHGHLH@PHxGHtRL1HHCLuHkL[]A\H@HHH)H@H{臂LCPIH511ff.HGPwpHHGhHtsSH7f.HhHt3SpPPP$H@PpHShHPhHtHHuǸ[L܆1ɺH5@11[øAVAUATUHHHGPL(Ax GcHL8Aą}HLL5ڲ;EduAHD]A\A]A^HAąuHLUIH5x1bHL5`LL@ I1.HL蓍dHE1蠀LL I1HD]A\A]A^fDcLTE1I1H5HD]A\A]A^f.ATHtuHHttHxA\+wph AątADA\D1Lʄ1ɺFH53DA\f1E1>LH5DA\AWAVAUATUSH8H_`HH|$H\$ Ht$T$H\$D$,D$(H9xHD$ H\$HHt}H@H LH5VLHHsH19HA]A^HxhtHxnHH`0H@hHD$H``HǀHD$l$E1LtL;|$ifIHLEA9o$IGhHt|IWHL H5LJHpH1lI_hA[A\HHxhtHx蝽HH`0H@hHc`HǃIHt IHt itDT$EIGH@ IHxIG@fL7IMH@@MML՜uFAL11*H5aMH8D[]A\A]A^A_IGH@H%8MML`TIHO Eg$t^IH@HtN@pD9tFAG$II|1ɿLSIJH51IEg$HOfIIGHBHAwL t 1AWDE1AE;wLDL uH-L1ɺHLf1ɺU1HE1hD)1҉D5ÅkAG$D)AG$uAGP)AGPD)ML;|$tHD$|$(ppt D$D$,D$H|$+t$uAą`HD$HHtH;D$tt$()P$L$Ht$HFPH9hHt$VpHxHGH@H@HHtHt$AąUMtAH HD$ tQHD$HxPLhMt6HH@HrLD 1fDHyhHHzhHypzpQpP$PPI9HHHH9,H,HHIHuLQJH5ז1E1Z@D$01LEDt$(H$VDD$L*^_uT1ɺALjH5qbH$XdH+%(HhD[]A\A]A^A_fDAD$aA ADŽ$E|$(*DDgpEIHHHTmHsLE1LdLDAt$`LD$ L9AZA[<L֣ID$PHT$8I$Hx D$4fDL(xAD$4S$|$0S$ISPt$0LAupQAąSt$4AD% ImPIm`*EMHBHL1ɺJ1H5KL1t"HH@HHx#9kLwDd$4Iu`*fD1ɺE1LgH5E6HCH@H Ll$ MHLMKHAĺAuHH5A]A^y1t$(CPLL?g1ɺ41H5+CLL|$@L|$HH4@HCL|$@HH@PHxRIHKLtJHH II4HPLH H|$@HHL8HL$HHHHHHD$HHH9u̾L(H}L贡FLE1H5ΒSLAf1ɺH1H5E1*MALaLJIH5m1WLl$ MHLMKHAĺAuHH5-AXAYLxuSVL-L_LH}L裠L_e11ZLOHtH]t L-뱃X1L-LLLdLd1ɺ1H5UAfHWBtWLt H:t fHRHH9tHHtHJAt̋BLfAWAVAUATUSHH(HRH$pH|$Ht$pHD$(H$DD$ HD$HdH%(H$1HHH|$(p.H|$AEHHOHIHIXHtHхHSHH$xH|$D$|$8H|$pHtp|$H|$H/0L$ t EDDD$ EvAADDCD$A A9w D$Dt EAD D$4T$4H=hL$PHH`HT$@HT$@L$PH*HHljL$XHT$PHD$@LL$@HI,HT$P1HUD$L$XI/LL$@EwAG $`MOAG4$xAG)HCu"%)S))9ʹBAO$1H?|$ D E$h|$@T$AG@HCE(E9t'L5VL1iL,L$ t$DHL$ t$D$hHADD$8DH$`1Eo,AG0AWDCuAG$D$\$ \$t~\$|$1ɺL5LALP1SA]A^AH|$P$xSy'@,'Eo(E*Eo0\$ \$uEg0EtmHDL5!L$Aw4H}jlAXAYLEO0P1ɺD$@LP1AZA[D$t$@|$4؅EA_t$\$4IG`SHITpH@HHH9uHD$H;HIGXnIGPHt#HHx E1E1j111jj H 1Ҿ<H蓪AG<$AG1H|$ptHD$p@pEO$D9r AO(<'AO$vA)1D~#HD$xAG($AG$HD$pHtHHH9øHEHD$xIoHsHD$HH&H\$(HH@L3L9=$IL|$H"HH!HM6L9t$(WHIVHH!HuuHR@H(HEL`H9u!f.ID$ L`H9I$H;P@uM~ MII9unf.HI9XKSLLCu1ɺ|LL%L]L|$LUL]1ɺ1L8HD$LLtL1 Ht$HHϘL51ɺM 1L{]LIRL^]1ɺ D$4=LH51E1H$dH+%($H(L[]A\A]A^A_HD$HE1H-WLHH@H@LH(s(1^L_H1kLX"L51LL\\1ɺL1E1LI$1LLA=1ɺtLL%L[L|$LO0L-IH fA$AD$AD$ IFI$ID$ID$H}ID$ID$  %HUIl$ IT$(HUHHEL|$IGXMgPI_HD$HHD$L(L9L|$L5Hs$ImIEHD$H9 HEHP@HHHH9LxLNHLH0MtQH5H2"IT$ HuH !H5]Hڧ!HmH9l$ H5H诧7L|$ L1L=1L6L|$ LOLQHC0C8LY1ɺP 1L%H\$HHH91HH9D$Hu$AG AGAG(9vAt EW@Es"$H|$xtH|$xGLƉ$HHH$HAGD$"D$MDŽ$$kI~PNHHiYLLw HL?HD$@H1ENANE$AEf1EN$A~ A)D$lD$DAA1҉DEFDA1EuAV,EtAV0HHD$HL H0LVLH91LB BIPL9D$HuI9}$$DŽ$$HD$xH$HB'D$tH\$x9CLi$$tI~Pt $$t$H$H$HD$+D$lD$4IFXHD$PHDŽ$D$$$t5H$HHHBHf.HHHH9uL\$HLH9t$Hf.HGLOHpI9DF HVD9FtvLHN DFAjHJMjHIJD)ARHQI9uHSHI9t HZD;B vHzHNHJ HN HJ HHB AjHFHpI9kHG HxI9BHD$@AA@51$HD$8E1Ht$@L1 AF1+$Av$EfD$$AAF AFEdA^HlEf0L=DE)LD$H1IHBI9tHP HHBI9uDE^LuL Li EۿMDHVQPHt$`16HALxAUAF  PAFPHl$`1HHAAT HLrtHvIDLP1AWD$8H$HHH$CHH$H D$8DL$8D$\D$XD$Eqt$X$ H\$HH|$HL`H9ED|$\@Il$ID$HD$(H9/AV(+D$8HD$PHHInPM,$H9uE@Ht)HH} E1Mj11jjH RHH9\$PLHsI9uIE@H&HHH9LJHt$@1LR CHD$@$;D$ID$ L`H9D$H$à E;D$vH\$SD % \$$|$B #49 |$8f|$OA98th9tdt$H$H\$`HLD HI9t8H>uHHHL LNDIDN$HI9uȅ D$B4 9t$a H\${yAN ANʉT$D$41Av$AŅt*H$QHHFHLA9DGHH9uANDD$t AVHuI~x}HD$ HM~`EDl$(E1MD$H\$ EAnHI$F At$LHAF0HHl$ HUuEA;D$ HJ@H HH H9 HRLT$8HLP1VRHt$`|DL$TuH L誛LT$8LIRHHLLHx`E^DDL$4HUHPhEHUH*Hhh EVHDEuA+F0CI$At$HsHJ@HSH HH H9 HRHPL1VRHt$`DL$TsH LϚI}L+IEDL$4HCHI]AH ID9L$ AFAV D9u|$E~0)lj|$D$DȉHH$L AFDDDD$8$\$B89sJ)H$H$H$HHH|HHtHI$H9HH9uH]H9l$(H$D$hHD$ sL$tFD$X$qH$HHTHH9KH9uHkH]H9l$(uHD$$T$B48$9D9|$\(D$$D9DL$8D|$\E$D|$\\$fAFHHLH0H9HHz0HVL>H:tjjjH0AUAЃLENЃmHL$ 1HL蚠AEJD$41AEDAV AVD9AF0HL$ HLNPHD$Ht$@ LH1ɿ/AUD\$hA~$sEI$A1EDD$4Jc|$t$9D$EtH|$G9D$$L$|$EN@D4E99DD$8ERD$ LE PHt$P1J_AXD|$\\$D$8$H 1SDL$ LHt$PZYD$8$EMLt$@1ɺI L]GLLIG1ɺ 1LL,G1ɺ L1H$vA@wPEf0L=&AD$Ht$@1L HD$EtD$L fHt$@1L HD$@ƉD$@H$1Htx$x EF$D$l1AHD$PHH9WB$B 9;E~DAEEnHEA~0)+|$l9F|$4|$4HBHD$PH|$W|$X|$XJEF@D ADA~0LE1HH$ AHA9t9yrE1E(D;L$D$AFEFDDl$(EtAFHEF$En8ED$D$DŽ$$ƒBB࿉$ EEDHt$@1)Ll A6H$H$H $$hHt$@L,11KD$0$[A~ AFD$$$DŽ$ AF<ƒ$9L$lx$k$Dd$\D$EfA~ D$lHD$HH0LVDŽ$D$u$$L$D$L$L$D$ Dd$8l$8D$$\$9l$H$HH*H\$9\$ DRHHMIVPE1Hz jDjH0jL$(H uH$I^H(H\$PHHHHH|$(H9tGLkML$M9uTM$$M9tDIt$LRuHH;\$(uD$ 9D$tH$Ho*D$ H|$PLL軟uMLt$@H-)1H1TL=K1L1L= .L=11 LOH-1ɺA1L=HMLt$@sL$L$bDd$8;D$ vD$ HH$H$tbELD1HH$A^09XsHD9tHxuAF(4D9D)ƋD$)Љt$ȉ$D9$.wL%1ɺ1LL|$LL<AG|AFT11zHMLt$HL!P1L觺XL2<Z1ɺ| DŽ$bDŽ$aaD$OH< 1QL5OhLNL1XZOMLt$@1LyLL;1ɺ 1L#E11HMLt$@LJYL谹H ǝ$H5>H=>?QG=16MH$ZDLH9t$H1Hz BHWH9|$HugIGXMgPI_HD$HNDŽ$H|$xt $&L5fL1f LH5OH觇@HCHS0LEM LH(HHAE$ HC0C8UP1UA[HA_HuMmL;l$L|$DAG4Eo,1ҾAAG4HAG0eAG@A_0AGD\$AG4Eo(1ҾJAG4HAG0!AG@uAG(\$AG0 \$ t9ED$ Eg$H1Ҿ?D D$@Ń$h|$EAELC>L|$ L1ɺ LHC0L~8L|$C8ڶL|$ L\L1ɺ6 1H5d虶L1H5$d`L|$ L:1H|$pHWHtHGH$HÿL WLDHL PL5c1LH$պXZD)AGH\$p1Aw$HHWHtHSH$L 0WPH9RL LD넋$MAGL5bc1V LL8L1LX 8L LL|$FH H5H=w1ҋD$$hAw$L$8A41HHDHHHHH!1HH HDHIH EH1WL5RbLALA.XZL5*bL1HLLL$H|$qaL]4fDAWAVE1AUATUHHSHHH9LEt-AHIE1HH9uu I8t<1E1LFH5aaMHD[]A\A]A^A_HCPH5JbDL$ H804I9FDL$ tLDDL$ HIEtAD9E~LLCƉD$ NAąEt.IAOH IHBHL fDHHH j`H9uD;|$ r!`I}AIoD9|$ tAIUI1DLdAąuL31ɺ1H5@`,HK`AL31ɺ1H5`E1HEE1 PL1H5_輱XZhLA31ɺ1H5_蔱Bff.@AWAVAUATUSHHHHD~IͅtHAąHHt CdLHHD$L9iILHDtAą`ILHDTAąfILHD4AąlILHDAąrIhLHDAąxILHDAą~AVL1ۅuuDA9^LvgH@IHЃ8uHxLHDAąuL11ɺ1H5]߯HD[]A\A]A^A_DIFH@t M6L;t$fA]HxXGcOLHDAą6L01ɺ1H5N]:VDL01ɺ1H5#]+f.AFLD1 A9^L3H@IHЃ8uHxHtLHD6AąuL;01ɺ1H5\莮L01ɺ1H5|\hL/1ɺ1H5V\B^L/1ɺ1H50\8L/1ɺ1H5 \L}/1ɺ1H5[ЭLW/1ɺ1H5[読DAVL5[L AUATUHH0dH%(HD$ 1HFPHT$H|$LvH1L?XZHILt;LH1HAHD$dH+%(u6H(D]A\A]A^DALy.1L1ЬIfAWAVEAUAպATIUHSH H$`L$(1DD$D$XLHD$ $h$pD$dH%(H$1wHLN(H5EZ6ID$ZY H‹MpH E1Ʉt H}PjDLSD$ HPt$0AWAVDD$8 H01ɺHLW-HKpID$H‰t$(H t HƁHHt$0tĄL$L$@t AAL$L$@}p|$hD$hT$(HE1HH)‹D$(PDD$˿Y^AŅ> AD$R|$GHt$1H؅Hx'LIH5X1T$hHt!H}PtH}PSL,1ɺf.H5sX1E1Z^DHg,E1Ʉ1DL$E D]pES @LEHn`HMHLDL$1HL  HEPH5\XH8*IH D>Et"H@ H@XHtHMP11H9Ѕ HAMHjDHeAXAY = 5UH}P HMPL L*1ɺ6ILH HHLs*1ɺ91HMHDjDL$01HAZL=*A[1ɺ=HEPH8HGHtH>HHEP H8AD$@HHU`HH ڲHD芎L)1ɺRILβHA LHLI9ƸLDLL)1ɺWtRMfLL#CLo)1ɺ\t1LLAALD)1ɺ_f.L5LL\$臧L\$D EHL\$գL\$tH}PL\$辏L\$D hL1L!@H$dH+%(HLDH[]A\A]A^A_ fADK0K$)Ήt$(&fDHHt$PH;/ HLM`HD$8HD$XIHLM`E11j1HLjAVjjjD|$xAWjD$hP蛚H$HPHg ElH\$`E1\$@L$Ld$@Ld$HDl$lLl$X1EM辀HL  UtHMPLHH<LD$81DL誝RHD$@H@t AD9HMHo1MHL rL&1ɺt1H51SH\$`H!LIH5R1@Ht$HAH8'D$hAD$EbHD$p H H5gRIL[1GH H=H1{ET$pC@At$pL+uh`uމD$L1ɺ!D$L1ɺ(L1DL$DAWE1AVAUIATUHSHHLvPH|$dH%(HD$81HFHHD$(HD$ HHt DE1EAH@ H#E`uH*AąHT$LL\AAąumHE`@@MEHLmHH@LhHAHD$8dH+%(HHD[]A\A]A^A_DL$H5AL AUH5ALɺLD1E1谓^_@LMH1LH5A耓XLMH1L H5dAP(L{tLmL1ɺ1H5A fDH84HHHH9$H@H@ H@XHtHMP1HT$H9Ѕt D$TH)LUIH5@1rJDLpL`HD$LHx;@HLLHTHL$ 1HHSnHD$(AąHt$(H-AąHHtEduuHhXH31HpAąL=1ɺ01H5?萑hL1ɺ&1H5{?g?fL1ɺ*1H5S??f. 1E1L2H5?HD$(vfDAVL#1ɺAUL->ATUHSFtHDvhLgPP1AVDNpL訐DKpAXAZAH3DHcH>f[]A\A]A^fChA$slHƒH(\(HPcHHHHShA$Ep9ǃQslChA$HƒHPcHEH(\(HHHShǃDǃH5ԚHޚVELLRPHEH1P1wH []A\A]A^DSh{lstH5UH0pdHI$H9 STShKtslDKpAADAuHHt Ed"1LLL肎1L1LU[[1]A\A]A^H(\(HHHShǃShH5EfGA=ǃH5H5ShslKtA$AHƒHPcHEH(\(HHHShfDI$A$HChDHLD$HzjDHLE=vH$L11 YslSh_#DA$ʉAHƒHPcHEH(\(HHHShDEpHƒHPcHEH(\(HHHShAH@XPpChHЃ{ltHcH(\(HHHHShf.EpAHƒHPcHEH(\(HHHSh@H(\(slHЃHBcHEHHHHSh@DAWAVAUATUSL$HH $L9uHE1HH|$IHdH%(H$RHFPD$xD$tHD$ HH5tH9HD$(IDމD$8HB$HHD$0}H$`D$rADžc|$8D$`MAL9,$ELrADžHT$xLL輟ADž ET$hEA$|$8t1ɀ|$`L \LD$@@ƃ@t$8LD$`RlADžH$@d YEP|$@EH|$D$8Ht$H|$HT$tADžD$L& 1ɺEHt$H|$kADžYDD$  $R# H|$0H5VlhAt$ [$RKA|$?HnL VmLD$RLDʄIH ImHIm uH 1@H5mH!HDPHH=1AWe8ZYL 9D9rE1$$n$RLJLH)ȃ=}^H$RI1AWQ1]XZ=S^LdL11\$`2$`2f%f=tv$`2]@x G$`2$a2=]uLL)i11[\L$P2H$X2I9@H|$0H56hfM >]`L1ɺ^1L[8L1ɺi1L[H$H@PHHte:#t`H|$O=bt\n \u=\/ H$H@PHt P,tHx@P,aTH$H@PHH|$#H4$H|$IL$4L]H$H|$H@PHH|$1ҀH$H@PH[AH<$1H?+ H$82L$RH$X2I9SLLqP1oZ]LA\1ɺL1OZ[E1$r2t=}[LL11ɃZ$R=L[L]L11ɃY$R=[LԋL11YA|$u$`2 $`2t @$`2$`2H|$0H5D$H$`2cIT$4ARL LRLL$@G1.YA[[L1ɺh1H5Y.=IZLL11XXLL،Xf1HپL$H?)$LY H$H2H$ HH߉  1 H=NHNH|$H$H$H$H$H5H$H4H$HH$L$HDŽ$NLH5 W=XLKL11mW7ML6L1GW6$t2$RL=kbML1hH5oVl$(3LL1V1ɺLL=V1ɺLLVE=WL^tL11\V=WL^pL113V=wWL\^nL11Ƀ V$`2W=FWL׉RL11U=WL5^rL11UHH5DbHT$P'`HT$PD$`|$HD$H@SD$H $a2y=VLɈWL113UA|$ID$`>$`2Ht$hHL `L`H `HD$a2WH=LDȄLI VLHDȀ@H^`HD1+AXAY$ DATT|$RL={\$Rj= RL UL11PUL$1ɺ1H5wPLL+VP:LLz5P$DATfTLL14OL3L10OALfLDATIUHSHAHYHVH9uHH9tH;Pu[]A\H(b HtMfH@ @IT$H}HPtUHUHHPHUH[HE]A\f.1LH5N1pPCAW$fAVAUATUHS1HHLgPdH%(H$81H|$)$Hf7I$H(H#E`HvAŃHHD0EAAD$,L6tL(L1ɺ2Ht^At$Lg1ɺ~H51ME1H$8dH+%(HHD[]A\A]A^A_E1HtAEf*fAL=HEct:HHt.HxL=2Hd2HH1s DHH=}MAD$aH HcIHDEH5HDEHDH1SH=#ZYHg)AEIL$DLL{: HU`HHt H$9 LH-r H4} HH9H+H| H@HD$HHD$@f HD$Lf{1ɺR H5ELHHAR1uH9HD$A[H@PHXH9Ht$1H LAL1ɺU 1H5EH9HuH1ɿHt$(1L L5|`9AZHA[w5gD$ HI9JDHH9_O Ly11H5oD8D$HU`HD$D$HU`Ht H$HHt 8HD$8HEPHL86HLP 1HL$8H[H腆H腴H|$8L }HHtlIVL)zSp H5[17_AXL>1ɺHI9FIHHD$HL1ɺ 1H5#CR7H5LNHCHHH@@pCLCPC$EpH(HtHPHR H$HE`D$HU`1I|$H5oH|$(HAtH|$(H5o3A^AN,Ht$ 1Lomt6{H$@d H<$S3DT$HDT$路 LuIHL d:H@H@HHdPHt$(Lv12^E1_=D$LO11H52DT$HEHL !HHD$HUHLHH$ <LBvAS1R H5>152AYAZH HWHuHHU LABH蔮L[rIHH L9HH@HD$HYHD$) 1LrH5a=LHHP1uH1HD$H@PHXZH1Ht$1HLfLѲ1ɺ, 1H5<$1jH觭LhhjIH5H>10H<$AoHt$x=2ILRs1Ƀ10?DH'LgjIH5=1r0"HH.LHHtiHE`VH|$ fH|$ AHx D$L1ɺKDT$wLqIHD$TLr@I(:LMH11L2hs H5O;/HEPHHtm/tdH HL#uIL۰1ɺv 1H5:./tLD$譫LgIHD$HU`D$OLx1ɺ H5:.SLg(ItI~H0 HHtI~Ix3L 1ɺLEHH L1ɺ H5M>.E1Ht$M1Lo.E1L=9LMH11ɿ LL|$(L:g-HEPHH.H`5HLyp1ɺ LL-HIVLq1RH5&9 1S-_AXE 1LnH58)-o诩Ht$LppIu1,E1jHt$L{1ɺW,E1EL[1ɺ% 1H58,H|$D$+LIeI@L1ɺ? H518e,L1ɺ' H5 8A,AWL=71RLo 1LL|$8,HD$H@PHXZHtf4,t]Ht$H3Lu@1ɺ LLP+HD$L'o LHHQ1uHKHD$QH Lmj IH51U+Lܬ1ɺA H561+wff.AWAVIAUAATAUHSHXdH%(HD$H1uHHtL~`I$vEEAFcIDLADžL(HH$CLHl1ɺHILp1=*AL$DHIHpADž'EL?tSLcDDLHADžxAHD$HdH+%(*HXD[]A\A]A^A_@LЕuAIF`H%@H-II9upIIH9;H'HHAIH9:HHx'HHAIF`H(sqEulINPHHH9tUHfHH9t8HPHH#Z`tL#H=$oH1rif蛨SHE1訛LYgLId1 I}HħHdVLILf1L)HMmD%6fHD$(D$H$D$D$D$Eu@H=Xt6Lԟ1ɺ^1L+ fDLH<H=WA&6Eu1H艚LeLIZ1E1C(AVLW1ɺ AUL-ATIUSHH(dH%(HD$ 1wHLNHLq_HAXFHLpHM9tYHAt$HLKHLe L1E1!Y^HD$dH+%(@H D[]A\A]A^IMI91HI9u}LH8JH9XAvp;spk1LAąHLCAąIFPH5>H8eHH AvpHAąHkHH57VH?#HAL萘HDMLLdP 1LE1XZDLPIE1I9t HAI9uH PL&d@HAt$HLeULKH 2DLH IHAPL7dDIL谗ENpL`dPCp PLE1腗LdLI 1LY1ɺ 1LL71ɺ 1LjHBzLc(HH!HtUHL9uJL1ɺ 1LCLʛ1ɺ 1LE1IFHHH;1LH,$HD$xhAąLy1ɺ 1LF$fDAWIAVAUATUHSHHHT$(Ll$@HSHL$HNHLﾀdH%(H$18@ Hs`HKPLH>yIH2H~H5L3 HHCPH1ɺ MLbHHHD$01YH^H5;ϙspLHq~LHM$HD$L9u$@M6L;t$IVH}LRuHt$ LbE1 !;H$dH+%(@HL[]A\A]A^A_@H HD$ HML$HsH1Ht$0LR1'!_HAXL蓀+HH5T輘HHAL$pHE11jHjjjjQjjjLL$x HP1ɺ4!HLHE111LHTlHHKHEHHKPHEHH(AD$pHCpHHChHAH@@au/H-XvLmA\ZIH@H* sH|$t AGe lEEhLH|$HIGPH8sD Et urD)E:"AM!AuIg`H|$H|$ANxLWpaA^H."H#"AV4Ht$H|$xH|$zL?[&I1L81ɺ$H5 IHX1Lc81ɺ$H5ӫIHXLw81ɺ#$1H5fII9>L#LDJDD$4L HAT#H5&EL2 LDȿ1Y^HD$IH@]H*XDIIAvxAAH9ǸMMHD^L%|L}1ɺ$%LW1L81ɺ&LA4HD$u<EAA IGPHHtL?tCH|$DHLu(Lhx1ɺ&LIL651IWHH}HIO M HD$ H57Hxt/Lt#HtHL"L1E1&-`M MtIWHH|$IO HL|1ɺ~% @H1ɺs H\$L-L-JLD$7PD$?PD$@PDL$D1D\$DH ET$($ H$HL$L Љڈ$ ЈfLhuAF4cZAEd  L:Lj{1ɺ$H|$MHL$AFxH9AhKHD$H@ DMN`L-D11L LJ`I^`HHAHLxMIGPHHbzH|$HLѽYHL3Av`L <@LF1ɺ#1H5æIFfH)D$$E1RH$IIH9] HyX RAN|AE1H};;AF|AFA$jILM1ɺ$H5LH(1H $1L$(pHD$ HL; E1PHD$ LPGPD$@PDL$D1iH Ap%LXE1HLMFE1P$H5"1 []=IH4IH9$HCH@MII9ID$I|$@HHH9 1HHH9BH9uDJA E1D $L1H5?D $DEI$HHD$Ht @d11LHHt$HdHE11LL1ɺM%E1LH|$HD$$LMG@cH|$艈AVxAH> H|$H5%rHD$H2H $IFOLLvr1ɺ %L_m$LEIH51E1L8VE^D$$EuWAEd tIH9H H|$Lqn I1H9HDF IHPH LFG1H51ɺQ%E1LiqH5ٝL%ȝ11LG%LIGPHHobH|$HL7ALG%LAt xpH$HL$L Љڈ$ ЈKMN`1L1L>P M~`HL諙H:HXH-HCPHHH|$ HH;LKHLE1L>X >qH)ILJ HD$MGHLLD$HPHD$HH$Hx؛ HH$Ht$HIFhHD$A1ۉG@AGDHHAF4H|$LsLiL:F%IL%:1L!@H*jAH}H5mHD$HH $AF( L1L=LH(H1L`>3$AQH5x_AXLh?$L>ILhL#jIH5v1 =AH*H,H|$LIG`j Iw`,H|$5Ht$LsCHH HL1AAAvxL9MMHDL 1HIVL%aLkG1ɺj&LR$$HdIHD$HHH9HGHP HHHvAT%L@1PMNP1H5ݕXZ1ɺ$E1L?iH5LL@?HHL%1ɺY&1LiL`}L;$AV4H|$LхKLcL"-&IL%1LH,H|$LIG`dL%ٔLA&LW AL H!LX":&LDhIEPLH8HD$8dwHT$8L;HD$8HPH8L:詓 IH9EHLI9bSLA9AWI+H5*1AYAZLag1ɺ[$fL{HLLhHD$LHx菓 HHtLLHHINhH@(La_$L 8I1ɺe&E1LfH5@1dLE;1ɺ$1H5 IFh11LLf%HD$LhJuVL$$HED$$HttAH|$LbLSJkAEd \LVKLe1ɺ &(L%>Le1ɺC&L61ɺ$E1LeH5%HHHH9L9H^IHt$H|$l8Ht$H|$mAEd 1LshLd1ɺ%ELH|$HUL_L>&IL%MOHL&LLn_d$L6IZL1AH5ǃL#d1ɺ:%HHLL9nL9UHT$1LHL$L$HD$HI9>HH31ɺC%E1LcH5 Lh^L|4IH51L4^$L7I^Lw85IH51aǃ1ɺp&LLb7]L=p1L4IL13IEPLHwHHLl]8LIL411ɺ$E1L3bH5L]L=&Ia1ɺF%E1LaH5]N1L7H5'2L%%Ld;'&LLl$@IwHHLKmH|$LLI%1ɺ&LL3E1aAVD$ LH1ɺ'D$ LH1ɺD$ LzH1ɺD$ LcH1ɺD$ LLH1ɺD$ L5H1ɺfDATUSH dH%(HD$1HtHW`HtHT$dH+%(uYH []A\fHLfH.H5HW`HH,$Ld$tLHHS`HHHS`mff.fATHG`uADA\H%HH5HG`wAąuL,G1ɺ1H5ff.fATSHHHH7dH%(HD$1D$H9tkFLtYHH @HBH fHH9t0H:uHRHRtHK`HH9ufDH6H9uHT$H5tHAąt3D$AuHD$dH+%(u8HD[A\HK`LF1ɺ"1H5laf.AW AVAUATIUSHHw H8dH%(HD$(HGPHl$ H{HHD$w HD$ L;d$ 5M$I$L=֬HD$I9AFLE1uAE9fLDH@IHЃ8uH@H{ H LhL HED$ I9tHD$HIE@HHHH9LJHL1QL*AZYD$ E9fLLfDM6L;t$HD$(dH+%(ufD$ H8[]A\A]A^A_HH5HD$Lf)ML$H1^_D$ L 9ff.@AUHATUSHHdH%(HD$HH9HHt DHLEu'HT$dH+%(H[]A\A]H8uH@H@L`@MtAD$`uAl$PH$tD9+s+@Hu1L(FH5wl1c1LA|$@1HcH$I$AD$PHL9LJH1ɺPL-W"1L LXLZ*)1ɺLLOB m8I$HtCL9t>LJH1ɺPL'H5!1n_AX_L ML  8EI$HtdL9t_LJH1ɿPH-}!1L'H YL^P1ɺHLuAݿL Jf.AWL=AVAAUE1ATIU1SHh._}Cըtv:fDAtfH1AATLS'LE1A8XZL9H9s4AHHPq:t:DDfDHD[]A\A]A^A_fDHLAATL&1E1謾Y^oDAWIAVE1AUL-ATUSH8HdH%(HD$(1HD$$H$H9|2fDAAGbaHC@ AGf HHT H H#P`UIW`H0@fH{HH9t2HR L HPBIGPsTH8iUH{HCGgHUHP HeHHYHH{I9HLh%IHATLP1AVD$DPT$DH d-HH{HCGgHP Hi,HH],HH{H,9HL$IHj%UPAV@D`E0HIW`HT1H-aDHHCEDLE7HPtvHP HtHHt HHHh(H{y8HL$IHUPL1AV跻D$DPT$DH dHCHXtvHP HtHHt HHHh(H{7HL#IH\UPL1AV7D$DPT$DH d_HCH{GgHSHju AGfH@H"@bu{HB HHHHHH{87HL"IHUPL1AVvD$DPT$DH dHHHtHH9t [H9txHCHP HHHHHH{6HL8"IH#UPL1AVֹD$DPT$DH dHSHjzLcH5L$HT$I|$HHT$L$H&A1HB Ha"HHU"HLcHH"HP Ht HHnHh(H{5HL>!IHbUzPAV1LܸD$DPT$DH dd@{LE1uD$DPT$DH dfHCHPuHHBH4HP HHHHHH{Z#HLIH UaPL1AV蘦D$DH @nHJ HH HHH‹CLHh(6Hh({L`(}HB H HH HЋIH{"HLIH{ATLUP1ӥD$DPT$DHSH dCLBHP Ha HHU HHH{ "HL IHUPAVHj(HCHP H HH HHH{!HLL IHUPL1AVD$DPT$DH d" HB H HH HHH{3!HL IHUPAVHP HI HH= HHH{ HL IHUPL1AVD$DPT$DH dGH{HCGa[;L`(Hj(-Hj(>Hj(Hh(H{O HL IHUPAVHj(H{ UIH1LPLM1^D$4PT$4AZHSA[dHCxH9Cx{L1E1Dt$L|$AEHD(D`pE9PHB HHHHHHHD(D`pH{HT$OHLHT$IHLR8ATP1舢D$DPT$DH dCLAHSA9DHH,IHH (9t|HB HHHHIH{ATLI3HLP1D$4PT$4Y^dHHSH (HIAdEHAHD(DppCLA92HDt$L|$H.&D$1L$@IJ4!( 7 HB H HH HIH{ATELIHLP1D$4PT$4AZHSA[d HjDHB H|HHttHIH{*AT5LIH| L]P1mD$4PT$4A\ZdHHSfDLb(Lb(HR([HP HtHHtHH{HHh(HL0IHUPAV1LΟD$DPT$DH dHB HtHHt HHHj(H{HLIHUPAV1LWD$DPT$DH dHSHjL`(H{HLUIHATLP1AVD$DPT$DH dBHSDt$L|$HjHB HGHH;HHH{$ULIHLXP1hD$4PT$4^HS_d{HB HvHHjHH{H]HP HHHHHH{HL%IHUPL1AVÝD$DPT$DH dIW`^HCHP H0HH$HHH{HLIHaUPAVHP HHHHHH{HLRIHHUPL1AVD$DPT$DH dHCvHj(Hj(MHLIHUPL1AV苜D$DPT$DH dHSHj(Hh(Hh($Hh(HHB .@uHHu kuHk8Et{HCHP HXHHLHҋk8IH{CHLIH)ATLUP1聛D$DPT$DH dmHt$$HlkHv'H{HCGg HWPiHCDcLHPD@HHZADt$1|HB HHHHIH{FATLIHcPL1艚D$4PT$4Y^d;kLqL$@HIL8t}HCHP H HH HIH{AVLIHLP1D$4PT$4AYAZd HLHxGatHC@e? HSHB5*HHL8HSBeHx/HCHP HHHHIH{ATL IHPvHP H HH HH HP H` HHT HHK IHt(H;<$t"{AHtxLuH8uL9xtE1EHT$dH+%(H([]A\A]A^A_DHML$H1VLLQAUcE_H AdHSEDfA9j(FfHHH911H9XH@H9utx}LJHAU%At$HL9fDpHML$H1AULLS莀XE_ZAdEfDHBHML$HLLAQPP1AUAE_H Adjf.1M9M9M9M9h1M9AtM9eXJM9=IMAF9t\D\$HAu LRAU$ML$HR]VqHP1HgD\$8H0ACAdAIMHHH9uQHH9DI9uM6I9[I$I$H9:L-dbI$H9BhtGML$HD\$LAQrHx1L~D\$Y^ACAdAHH9HC8HPuHHtHH9tI$H9x`tML$HD\$LmAQrHtfD=HQHAE$D\$HAM ML$HL'AQRPQRVoDAU AE$D\$HHLIHAt$HL4йP1Rm}D\$(H ACAdAf Gpt8PLOH31jLLH56}XAZBHHHT$H5XE1ۃu5ML$HLH11:D\$H5W|D\$ML$HL01<H5)|AI|$HHT$D\$H5~D\$iML$H1L<D\$H5G|D\$ACAdAqQff.HC=@tlA'AtA uHfDAt1L1ɺH5d{HHfDUSHHtiHHnH_HHHFHH0HHH}hH9tHtCHt HGH@PhH]hH[]no ff.ATUHSHH0HdH%(HD$(1HFIHBHHFD$ HWLoHp@)$oH)L$HRHRXH~Ht!HpHC LH@H@XHx趄HCHmH@H}hH@XHXH9tHtCHt HGH@PhH]hHD$(dH+%(u H0[]A\莄ff.AVIAUIATA1UHLSH?HdHIIH9uHH9HSH9B@uL\t[1]A\A]A^fDH{\uHL\HHHCA)A+A+[]A\A]A^@Eu[H}1LHfHtAHHH9u,@HH9t HJH9A@u[]A\A]A^HAM1L4H5da^xX1Z[]A\A]A^ÐAVIAUATLUSHI9EL1ۅu@9]LH@HHЃ8uH@H@H@@HtUHHtMH9tHHRIvI>1AŅu1LI1ɺH5`w[D]A\A]A^fH9YHmL9IA[]DA\A]A^ÐATUHSHHHdH%(H$1AąH1ULhHALH肃=+XZu/AH$dH+%(HĠD[]A\HH{xIٹ!1LH5_v럍@A,HHcH>fLI1H5HRRME1PL1H5YzpXZWHRzfAUATAUSHdH%(HD$Hu"HD$dH+%(HD[]A\A]HHHtH5&`stHHAH9tL-Xf.HH9tHCuHx@HtHKH$HH9sHI@Ht>H1Ht6H9t1LNRL1PL1E1KoXZL PyfAW LAVAUIATL% XULHSHLdH%(H$1D$\nHQD$@HLD$DL|$HI9t_Lt$THCD$TD$XHx@Ht-Ht$XL膁tD$TtL$@9QHL9uD$DHL$\IIHL$HL$THL$ HL$XHD$0HL$(H9r@HCHH@@H@HH4H9+LJH12LQL mXHCHZHT$Hx@KHCHT$ D$THt$(D$XHx@|t$@t\D$T9tTtPHUuD|$DEHLB1LPDL$PC1lA]A^f.L{IG@HOHHCH9:LrLmHEHM1ɺDLHD$L<1Ll$lAXLAY(i IHfH@ @IOpHt&HϺHL$H5noHL$HMMQLL1lY^HCHH@@HHHH9LJHL1LQLzE1kXZ6L IM@L59M@L&PH $IG`H;At|HMp(L]*@HCH@@Ht;HHt3H9t.LJL1ɺ?1L濄jL L=zLt#IG@HtHx8u LLLL$8oH|$HPHHT$y HHT$Ht$8HxHLIGpoAOxoAIAH$ALJHxHGPPH}1LH苮HH|$HHH9HHH94HrH9F@uLl$`@LLHMAULlfDMLvL1HUiOMLVL1W-i'L1ɺT1LifDI@H謃1HMLPdM~LLqhf.H|$HfH H9t8HqHHFI3I3GH uHVHFI3WI3GH H H9uȋt ;H|$L](vAHH9M}LHXAH$H@HHXHHfHPHHI9H9uHH;\$0HAHt$0H;[ H$dH+%(HĸD[]A\A]A^A_AHCH@@HHHH9LJ7L1Lf{fDIGpML1jLfL<1ɺ1LE1f 1ɺLLmfD$`L HI@L Gt@HD$@L9HLE1PDL$PE1LheAZA[D$DHMLjL>P1eH HVHPH1ɺLLe~PMLMH9off.AUATUSHHHGH@@`ItfHjH{LhL HLLHsH{H HHAŅAHD[]A\A]DH L H+I9uHEHI9tHHsLouHHCHBHѐ1yE1LLsH5=M2dHD[]A\A]@H1ME1LxH5LcXZ"DHM1H5LL cY^AUIATIH5USӺHHftAD$`t4AHD[]A\A]AtBI9X t6AL1E1H5KbvAL7DAL|1H5KE1bHD[]A\A]AL1E1H5\KVb=cAٺLR11H5(K"b:ff.fATUHSHH6{ L}tfCLtNHEh@`tA[]DA\HSHCHu{HCHt~H=vL1E1H5eJ_aD[]A\AL11ɺH57J,aD[]A\@Ht HvH{HCAoDAVfHAUIATUHH(dH%(HD$1)$Ht$HH=HD$$ IHHtID$`I}hHIDŽ$ADŽ$ HGIDŽ$AD$PADŽ$dP`HHxLDI|$HGH@H@PHt LЅt)HD$dH+%(H(L]A\A]A^fDL5HI/L=L_HtK}#tEL-oft9r ``MtAD$,HL tLE1聋3@1ɺ6LL _L5HILL^;L5G1ɺ1LTL^L5GL1(L^@I|$@AD$,fW[fD蛂hAUHATIU1HSHHHu-HH H)L9HL1[H]A\A]HIDI)$HjLL =^_IAX1H5FLQ@1]HH H)L9hHH{$DjLQ H{H$DI$L H{L$DH$L H5EIXZAUU1LE\Y^1H[]A\A]fDAWIAVAUATIUSHHt$T$ dH%(HD$81{a IHL* l$ +l$LAA))D9l$DLe1҉)9wпI4ًtDDDI4 Ll$щHk1 L[ L`LLHj* JLH5KD@[LLE1 HD$8dH+%(HHL[]A\A]A^A_úH5xL) IWIO0LH5CHHH  PD$IG0PDL$1AG8ZXZgL1H5C0L1H5\CQZLdAWAVAUAATUHSHLGIHIpH9sH1fDP HH9u1H9tDH H9uI@(Ip(H9t1fDHH9uAEuHD[]A\A]A^A_fDdAUAԹ LA)LH5aBP1RWLYHEH}DH DHGIHHuL~(HN(HILI9A!@HEH HIHP(H9HAG tADDDA# t1LHT$X@HuI?AIOHT$HLNHOH9H~HN MIOHN HH^ AeAfDHXHH9t[AHHFH9tDC tADDDA#t1H?AtHuHHFH9uH1EE1L0H5@WXZH}Ln f1L1ɺ1H5s@E1eWK ff.AWAVAUATUSHHHt$L;H9IHIID$@IMLI9tfIHCH@`HI~HLЅuHD$HHtMH5,Zu8HCHMLHBHII9uD$H[]A\A]A^A_fHHCHBHI<$t=ID$L#HCID$L(Ml$=DD$+D$J f1'SHHC CHHC@HCXHCPHHHHHHHHHHHHHHHHHHHHHHHǃHǃHǃHǃH H[ATUH/SHHHdH%(HD$1ZLchHPHHEMueLHL9uHM$$I9t7ID$HHxH&_uHD$dH+%(uIHL[]A\fDE1HpYHHLH[ tL$$MtIĨ^@SHHH3dH%(HD$1HFH3H uHVHFH3H3H Ht'E1HD$dH+%(HL[LWpMuWHHH9tH^ L^(H HBHH(L@ L1I1L uILFHNL3@0H3H8L u4IH LH Z HE$IYDHH9uG]ff.AUATIUHSHHHtHHHtHxAtHD[]A\A]H/LXHHPHHEI9u ;HI9t0HCHH@HxH]uMtA$AE1AtDAWAVAUATIUHSHHHHt$dH%(HD$81GZ@ATt*HHH9tHPHHb`H9u1H5cAątADA\1LB1ɺ8H58ODA\ÐATUHSHH0dH%(HD$(1xD$ t`Ht:HLKH`LD$ H538P1*OD$EXZHD$(dH+%(vH0[]A\@HGPHxO E1LHHA1C_AXHH;\$uILd$L9H-,BHCHMAL E1pH1hCY^HL9KHKH|$P Hq CJ t؅J HCL$@LHx u1ɺ HLBUHCHt @dD$8fDMLVH1 E1BLkfHCHE1L LHH1eBLkA}tFMMHLH1 E1/BLkfDPLHAVHD$(` L1AA_LkE1XhfMMHLH1Y E1ALkHMMHHHD$ S E1L1zALkZYIE`1ɺl HLPAU1ɺi HL-A DE@D$<1E1ML)H5)@IL1E1H5)@MLnE1? H5)@I0M0I9IIHD$H9?AD$@E1L PD$LH5)PD$LPDL$@1?H 4 1E1LH5(HD$`?HT$@H5d{Ll,MLl$M9H-( M$$M9ID$@a tHHH9uKft,LHHL1H E1$?ID$HHH9tHKSLAutHLHH1RL HE1>XID$ZIFH@@`wIhHt @e EE(BHX I@H@H@ HD$hHfH>VI AFaIHt 87 H5,HHt*H50H|HtH50HiH IH%}IH;\$H-&=LcL$L AF,LcM$ MtzID$PH5bHH|$GH|$ H5TH|$GH|$ H56LG IH5gGHH;\$IHH{L Mt,HLATI H1E1pHH;\$uA9DHA11EL8H5*v;A\L,A]1ɺ H5$1};1ɺ E1LH5\$V;H{GfL Md辷HLATI ILd$L9:H-# HL9%H{<|uHCHE1L LHH1:뺿(!>HT(@H@H@ HD$H=HI@H@H@ HD$XIHD$H9dH-#EML$H AL1HE19XZHH;\$HCDL`E9ID$PL9uI$ID$I3I3H u!IT$ID$I3I3H L$@LLԾID$PL|$p@LH设ID$PHHML$HAWLDE1 1AU8H Ml$HL=H|$HLLH? t?\HML$H1 HE1AL<8AYAZMD$ H|$XL LLD$t? tbLD$L$@LL躽6AMH1At$HL/E1 8_AXMl$HL=ILHD$@HxI9HLHL$< HL$HH9thI|$hID$pI9D$pML$HHAL< HAt$HLM k)uHGHHxHAH1M E1Lm7Y^@1ɺ HL6L1E1 H56HD$@ L1ɺ HL 6M1ɺ HLh6 1E1MLH5;56yHGL1ɺ 1H 66HD$P LzIH"H4 E1PM1LH55XZ1E1ML7H5tn5HLn1E1S MH5<65AYIAZHD$h L0LHH1E1L H546PL1SME1$ H54_IAXLqE1 H5~s4L߻E1 H5TI4HD$HLǵ1ɺ H5'1E14QHCL HD$L 9Ld$hILI|$I9,HLHL$8 HL$HH9 L8HLLHX: x HE1L3H5“=|H5L=eLׯIT$PLLAUPLZs(L蚯IT$PHL*LPaLkIT$PL2LAUP4HGHHH|$HLAUIq 1H_2HCLd$xA_E1L XHH@H@H@@HuH. ff.fATAFat1Lt*L˵1ɺ1H5<1+DA\1E1Le1ɺH5+DA\ff.H(DWLA9HD^H@HoHP) $HT$E9vKK[EBHljfDoHH IH LJLID9uA)ABLH@Hfo$HT$HPH(fDA1LH5O!*1H(f.HLIL9AUATUHSLI9AD$LM$H@I\%LnHNL3hH3HL uAII9tfA:uVIBHpM9tILH~LDHBHHL(H1M1L tH@@HtHN@Ht H@8H9A8tHI9u1[]A\A]M$$L9EAVAUATUSHH $H H&LNHdH%(H$HrRiMH\$HIHD$HhHH$HFPL1iO H.H1ɺSL-ILL1](YL^11HlIH@aL<1HL9'At$X;5[H=:AAD$aDH$dH+%(<H D[]A\A]A^fDH(AƅgHEPHLLLuH1k'XZLLE1IH5a11'L@ZHZZ @ LdfDILLE1 &ILL1E1&1UHAVAUATSHL&dH%(HE1L9ILE1DHAH9uEDHHHBHHHHH)H9tHH$H9u%H)HtHLLL$1IL 'IL9tIT$M$$HHPI9uIIH9<8DDLLq HUdH+%(u He[A\A]A^]/f.AVAUATUHSH HdH%(HD$1IHGLGL$LT$HHL9u>DH1HHL9tIH@ tLHpIqLH<$Ht$LHpHD$HHH1HT$HL9uH $HHL9tGf.HqIHpHHHw LHqHO HLHHW LM9uH_L9E1L-- f.H}AHHGH9tLC uHCH@ HtHHЅuͿ1Lr1ɺG L#H}HHGH9uHEEu7HE1HT$dH+%(H []A\A]A^fHHHHDžH9tHPHH!H9uH}@OHEHHEHHE@E,E,tgHxLxL- L5L9t4DLKML=*$j 11"HL9uрe,LLxH $H5̧H=ݧ6%-ATUHSHHNH}HEHH_HGH9tcL%M f.H}HHGH9t@HCH@(HtHHЅuL1ɺ~ 1L![]A\ff.AUATI1UHSHHXdH%(HD$HHGHLh &HHPXHt HRHHxhHH{@^HHH>u%HD$HdH+%(HX[]A\A]fDH|7HC@HWHHKH9BLjHEHHH- H@DL$Hxjǭ 1ɺ HI1L,$L A$HZHYH9HC@HHHH9LJHD$HdH+%(1ɺHLì0fDHH4H9+H@H1ɺ PLH51M$H{@^AXHKHLfH@HHtIMtA@I 1LxH5ZOHC@D$f.Ht HHtH9unL HD$HdH+%(L H5HX1[]A\A]DHy@L-i@LJf.L IO@I$HHtI$)AIL;11 H5D9(ff.@AVAUATUSLn`IEHh8HIHt5LHLAąHA[D]A\A]A^@LvpMt)H5ܢL!utL5"M1E1L1H5jd[D]A\A]A^1Lڞ1ɺ7H5:/[D]A\A]A^%1E1LH5$@ATUSHHHE1uuID[]A\ÐGauL1LH5At@C`u1A LLH5QK}fDL1H5'AHHATUHS>toIHHtRs&tW&LHt7HX Hu',fuH{?t H:&tH[Htu[1]A\[]A\fDfH9wAVAUATIUSHHtFI$M$L9t9fDLmI}hH9tHtCHt HGH@PhI]hHmL9uI$PM$PL9t;LmI}hH9tHtCHt HGH@PhI]hHmL9uI|$Ht HGH@PhI\$[]A\A]A^f.ff.@AUATUSHHLg8HML%VA͹HL_1J<#H)DH$@ tMLLDhD H}8LD L MtMd$HL[]A\A]f.H-1ɺ1HL9E1H11L|HL[]A\A]fDL1ɺ 1H5RGjf1E1LڦH5$<@ATUHSHH IHthooKHoS P o[0X0HC@ID$@HCH@8HtHsHtHID$Ht@Md$M$$L[]A\LY1AH5odfLHE1" AUATUSHHLoG C HCE1HPHHt LIHCHP@HHtLATL dPH_Lȥ LDH51XZH[]A\A]utmAWL1ɺ AVAUATL%pULHSLHoodH%(H$1LHHD$1Ƅ$)L$`)$)T$pHHI9fDHPHRHI9uH,$E1AfL}`HI9t4HCHhHA!H}`uMu1n%IfH,$E;LIM9u/'Hx>HII9HIGHP<tHrHLP+ L(=IL11IGZYHt D8EwL[1ɺ1H5L:1ɺ/ 1LL1L LףjH$dH+%(HD[]A\A]A^A_fDHE O L1LѣE`LLM9L1ɐHPHHHL9utHEq L5dL ]M9IxLLLWfDHBHHHL1L1H HOHGH3NH3FH H}1Ҿ9AƅHHH9tIHNHHH9ut@HH9dHPHzyHE H}DdHGHwH9HE1fDJ HAH9uEqHO(HW(A]H9HE1ɐH?AH9uH9VHE1DH?AH9uEE9E9 _E)H9HE1DO H?AAAH9u1H9t HH9uH9t1H H9uAVL1 APLˎLWARDT$ HEH}Dt$ H HGD$HIwH}HGHWH9L,$HEHfDHmHGH9E uADDA# t;HHT$ AHT$ <HzfD L1LZH0AƅL11ɺ 1LH6H9dHL9MM9,M9DL LL1E1En1fDP HH9uLuAE`uH}@HtCAƅp Dh#E H}:D {EtD# u{LE(LHM9tGH\$PD$PIvL9;HfDHL9$H;puM6M9uHII9u,{fDIEIUIHBHHL9WHIuH}uLU1LAƺ HLctH跜L IEHt L9L L1ɺi 1L濄벹 L1L#HL31ɺ#1LL1ɺ 1LE1jLH\LHDHD)nLɆ1ɺ11L fDL H51L 1L1Lf 1H1ɺ.LL3 L Lx1LLL% L-JH}H[HGH9u@H}H[HGH9C uHCH@(HtHHЅuM1ɺ L1뱿1Lf1ɺ LH}H_HGH9L-;H}HHGH9yC uHCH@(HtHHЅuM1ɺ' L1ZE1H911^Lτ1ɺ 1L& L1LLdE91E1H9j@L\1ɺ 1L6Lǔ1o H5M\ 1LגH5^HHLEL1)H}A[L[ L1ɺ41LnE1L|1ɺ1L, G H $H5H=XHzHLL,$e df.HAWAVAUATUSHHHGPHh@Ht-H}pt>HHHH[]A\A]A^A_HH[]A\A]A^A_fD(IH-L@H@H@ HEpHHD$L9oE1L=IN LHq K LepAt$IT$L-LuHEpHH2HH|HLSI1H50%XZHH[]A\A]A^A_ÐE9,$uL1ɺ1LM6L;t$LepE,$"f1HEprATUHHtPH5_HA+ t+H5_H tH5_HE1 AHD]A\ÐE1HD]A\fAWAVAUATUSHHHH|$(HdH%(H$1HD$`HD$ HD$`HD$hHHhL`I9ttLl$ fDLuH]M>L9u NfDIǾ HT$`Ht!LpHHT$hL(HPHHD$hIMI9uHmL9uLd$`L;d$ D$7L-fM$$L;d$ 4Mt$I~0tA~<uIFH@xHFLH8@XIN1D$TD$0HHL$8HHD$H H1HHHHD$H9D$6HL|$XH$HD$Hl$|Lt$@Ld$HfDIT$IL$ ID$(LHHAHA$IvLHL$D$|ID$H$ tA.ID$IT$ HxHHHHIL$ HHPIL$(HHPHHPPH9\$-HHD$L HHD$0D$|HCH$9 tLd$XMtAD$0urEt$4EL/AD$0t!fDID$LH@ HPAD$0uET$8EumIT$j<DID$LH@ HPAD$0unHAt$E $1L:-H5 31A[A\H9\$D$6f|$6Lt$@Ld$HHD$(Ht$8HL$T1HxhaTIHNDL$TEWDH8AF8A9H1ɺPH-_L?1HM_AXH\$(LH{ y|$7yD$7M$$L;d$ |$7eH-AF8HMN01H"E1PL1Y^H|$`Hl$ HH9t%f.HGHCHHHH9uH$dH+%(HĘD[]A\A]A^A_fMO(IF0I9uLH\$(LH{ .H-*1ɺ1LَH H1ɿPH-1L>HXZL؍1ɺH-1H|$7ALv1ɺ1H5AvIٹLH5v~LLЍ1ɺkLt$@L1ɺSH 5$H5C~H=T~xAUATIULSHdH%(H$1IH:IHLHp L,z1ɺLHHXHc HH~H$HzLHHILHLHH) H)ƉHLH_AąAH$dH+%(HĘD[]A\A]fDt$tADfDfLHt$L9III14ALL1LmALLHLFM?L;|$tLI<$L0HHu1Lv1ɺH5"H1[]A\A]A^A_fDH[]A\A]A^A_ff.AWIH1AVAUATUSHxMphdH%(HD$h1Ld$Ld$Ld$^H$HJ MnXIIHHH9uH~fH0HHHNH1H|$6 HL$L HHHD$HHT$H HHH9t;HLxAuIhHtHGH@PhH HHIGhH9uH\$IIADžIDžHL9Lt$ILfDHHCHBHIlIL{L3MeHCIhIHAIMI9MtAD$LHtHGH@PhHCMghH\$AAH9t HTLLt$H$HXHH$H9^LIHDHxHH1HH)HIIIIIIIFH@HzM!I$HL9HrLLЅH}LkD$`AoHT$@Hs )L$@AoW)T$PH}BLeIhI9tMtAD$Ht HGH@PhMghH}(訟 HofH@ @HLxHLeL(IhHPHHHII9tMtAD$Ht HGH@PhMgh{xv C|qHH;$H}Lch IH.L1H5L1 H5L:r1ɺ 1H5HH;$lIHD$hdH+%(mHxL[]A\A]A^A_1H5LLЅI$Ht L9L L1 H5tDHCXHH@fH5IHChIG@HC`IG`HCpAAGHShH IIwpoAoAg^HS Hs H9H1HH9uHK0LC0I9t#H1f.H6I9ulH9t!HHH9uHFH IL9DHH I9uHPH@LH}H IHH IL,p1ɺ H5IhHtHGH@PhIGhH}L) @L%H-:1L#& HIhHtHGH@PhIGhLo1ɺ 1H5sE1Leo11 H:IG@HtHHt H9L ?1Lރ1ɺ H5ynIG@HtHHt H94L Lރ1ɺ 1H57,HChHHHH9LJL 1 H5rLbn1ɺ 1H5/HChHHHH9HAE1H9tfHAH9uH PLF1H5uqKXZn@1H5LLЅfLJLJxL @HZ@ L LH5pfHChHtWHHtOH9tJHBE1H AH9uH PL fLH9H1ɺ E1LlH5+%H 9$H5GpH=Xp\ wAWAVAUATUSHH(L$dH$`H|$Ht$D$LL$xH$dH%(H$1AHtHL|$MtuH5oLu]1MZLH5ICH$dH+%(P/Ht$H|$H([]A\A]A^A_,@H|$I9D$dH|$H\$XHUDE]HHD$DEAHt$XH|$uHt$$Ƅ$\$dHD$HHDŽ$A L`h1L؛$t$`LL$Ht$(XZHt$XfƄ$H$)$HH)$oH$)$oN)L$ )$HDhD7 H=DHމ HHt*H@Ht!uHT$XHt$H|$t_$BH zH(LPH\$1Ht$(IA[]HT$XH|$H^HD$H$LDŽ$H$HD$XH$ID$P`HD$ Hz'HL$ ALqHqHt$0PIQI91L$L|$E1Hl$@Hl$Ld$PMD$h#@H@RML PH17XID$LZLLL$PHt$ H|$L$IHM<@(EM(D9<I$ISHI9HrH|$@HHHH9HRQLV1ɿVHP1R}H LMLt$@HDŽ$D$hHIH;\$0HID$H@xHLIHHIT$(DŽ$Ht L9H%PHt$H|$҃VLL$LqH5DHL$xE1H$dH+%(*H(L[]A\A]A^A_f@HKLHHD$14vLL$Ht$L)|`D$EIHt L9BHwHMLQ~1P1HIHHDŽ$AZA[H;\$0=DL$hEtDH\$LL$11Li~ HOL~11 H޿2MIMLd$PI9t Hl$ @HSLHHI9uHD$ fIH$hIE`$H$I$H$I)$)$ $Ƅ$H$IƄ$0H$)$)$$$AoHD$p)$Ao$)$ $oIHML=h1L}@LInIFIHD$hLUIH9jIF Ll$@MHH$Lt$PLHUhI9tHHHH9Q@HI9uHD$@AHHHHH9LHH 1QL|1VLWAH P4\LHwI} ='H$HEIE(HEIE(L HD$@Me(HHIHH9\$hOHH|$@HH7HH9HvHt|I9twHRQL {1ɿVHAQA1R.H Lr D$hHDŽ$fHV@H5@HH5yc@Lt$@I^L NL Ii@1ɺ LL{uMLy1H1PLl$@HDŽ$H9\$P?H$@H$H$H$pH$fHCHo)UoX)]HCHp@;IHHHPHt3LaHM H5dLHL$@HL$@MIFhHHHH9HBH8 LPL1@A_I}LAXH$:zIFM^L9t@ HL9uHH9\$PIHT$PH;\$Pt$HCtH@@HH9uHD$ HhH]H9l$0`HELd$0L|$ Lt$pH@xHHIIL)kH HP H H9u rHH9tiL9zhuMIHL9H@HM:LzPHt$(1 HUHEHBHAYAZHHL9HHEH@xHHBH@R MPLwL1zA[A\qH@H 2@H$@HCHxH@@HtHHD H9; HRMLZvR@U hH_HHSH9JHBHLv1ɺ1 AQIATU3IFhH#HHH9HBH@LB MP1LcvVY^-L|$ IEHHtI|IHt NcIHD$PH9NL$Lt$pIH$fHEHp@HHIHfƄ$)$)$Ao>);Ao~){HPhHYIqHHPHHqHHT$hHL$@Ht$0H|$ H|$ Ht$0HL$@HT$hLHCHqTH3A\L3ATL  HKHCH3NH3FH AxAG|f.HmI91|I}1ҾHILcMqMMIM9WLMIHIL95HIWHzHG`H9|HH)I9sҋcIGHt$1ɺ;LvH@LHH1HHt H9 HvHLLLu1V WPH$1H DLY1ɺ1H5{gIGHMLu7H@pHH\$(1H,A[Lu]1ɺH޿1 MHD$PI9 $Ld$XLDd$1L$1ۉl$ HLd$0Ld$dDHH9HAAWLDv1PLL$1L濄IFHXZM6I9I~@L[uƄ$IVHB@HtHYHH9HAAWLu1ɺPLL$L濄1M6AZA[I9j \$ t L訅LP IML9uHL9H{uHCHt$LV LHH1HH$HD$xbHD$8#tEH|$ID=Et 6 D5AE AE,B Ht$H|$ELE1 )IEHHIHT$@HT$@tzHD$ulHBHH5LpsHHD1LP1AWLL$@=AYAZD$ Hѵ@Hb@HD$@uHBHHZ PL-s1ɺAWLL$@L1_AXHt$ LJdHA@H1@H!HL|$LcLD`D H=MDLP HHH@HfH zHtLvPH\$1Ht$(IAYAZ1HT$XH|$HrILL$1Li`H5HD$ @D$0H|$ GHGH@PhHt$1ɺLS1IHD$8#t8H|$FDEt MuF=XuWHt$H|$BD$dLiS1ɺHt$1LLa/HD$HD$IHH uEHD$ ,Ht$LR11 $<EHD$3$tAM,MHt$11LƂHD$H|$L"IE` HL$ Ht$LQ11=Ht$XH|$\HHXLpL9HkhHEDmTH9H=HtHxH?/u}E`UXAu  RILTtAU1ɺH5Z1_AXDL Q1ɺm1H5T_Jf.HHU8LgAUEXAPA A% к PH5~1H wHHU8LtfAUEXAPA A% кPĀEXA G @1ADžHcEX;4{ I H'D<}T.HEUXD}TM`H9k Hb LHHL(g11AWH5}AURBH HL9HIEHHt,HM麂PHt$(Lq1Y^IE@Ht,HMPHt$(1LqhXZH$L(E1T$dH ЉHt$Lxd11$Ht$LN1ɺ(HD$HHx\HD$HH|$1=H5Ht$Ht$1IٹL~y@L|$Lt$LL\HD$XHA?#t4L@-)t au*@lukHt$H|$<H5Ht$D$dLqM1ɺHt$MLJ YI}@AE,H@IH|$bLr- HL$HH5 % Ht$LL11 >LL$Ht$1L|Ht$LUL1ɺHt$L3L1ɺ@=@DmT]XHEH9= H4 LHH1AULbH5zSR-1H H@YML=1O1LsdLIDŽ$HHH9LHHLf1ɺ WH$1Y^HLi1ɺAWLL$@MHt$11L^iOPD$ {HEIHP@HRHHFH9=LHHLfOQ1Ht$(1XZ'HD$pƄ$Ht$Po()$p)l$0oh)$IH9D$Pt.fHHHQ@HtuJ`HH9uH$pHkHD`Dܸ H=DHX HHHHHHH9ufHH9rHPB`uH=dzv IH IHD$PL9Lt$0Ll$@HD$PLxIo HHDpD' H=hDH裹 HHHXH|H+H9pE1]f L賕 IEHL9Hp1L AHmH9DLmAEauEtH5vLؕ uHt$L[H1ɺ= Lt$0Ll$@L%t Ht$11L(H H5)SHmH;l$p EtrH5(zLL  ID$IT$0LHHHID$0AD$8BS1t$pHt$(ILfl 1^_HD$PHHD$PH9D$0Lt$0Ll$@LDs -L hHEIHP@HHHH9LHHLcVQ1{HHH9H@HLLb1V WPLL$Ht$1Lv LF1ɺD$dPt2 $< HD$u \$  D$EHD$ dIED`IE@HSHt$L1vf0fDEH5wwL蛒  ID$ID$XE1H0Ht$hIt$0H0IID$0AD$8HD$pH9WDEL1EuD;]LH@HHЃ8uH@H@Lh@MAEauEuJ LP 5IEHt#L9tHp1L輑 XE|H5UݺH5qL菑 uHt$LD1ɺ_ Lt$0Ll$@dDL$XELD$>Ht$1LtbIQ 1Dt$XD$MH$1L^ H~xL rL fL Z#̀HE` f.HHH9H@WLL^1P HI"AULyYH5p1AXAY1ELYH5EXHUHH9LJAWL-pPL1Le3YD^MP8HUH9LHCLJPH4LPLB1ɺ61I^_Ht$L:"Ht$LA1ɺ@ Lt$0Ll$@DIEHHt.HMkPHt$(Lc1辿AYAZIE@HHMPHt$(Lc1m胿_AXHIPLzW,HL@1ɺiH5WD2L ֠L ʠDuTMXt$0L$ L$ t$0HEHtmH9thLHHLW1VH5nQ1R;达H rMHt$1L_臾ML +Ht$L@1ɺ9 Lt$0Ll$@RgHt$I1Lr_MHAL_UHt$(1ܽA\A^HM11AHt$(IL<_袽A_XHD$@[Ht$L?1ɺH Lt$0Ll$@aHt$L>1ɺb Lt$0Ll$@5L ٞIL9HNHHH9u KHH9t@HPHzyMHt$1?L4a跼jfH6I9uHt$L*>1ɺ[ Lt$0Ll$@|MP_AL^eHt$L_11N3Ht$a1L_{H1MUL\Ht$(ۻXZL`=1ɺx輻 MHt$1Lmv莻(H\$M1L]0H]1L]H޿18MHt$1%LHmHt$L<11 JWH\$71ML]H譺L]8MH $H5?H=?*Ht$L<1ɺj Lt$0Ll$@Sff.Gat6HHH9H1:tHBHP`u1Dƀt@HEfDATSHHH詫IHtiH@@tHL[A\@H{/6I|$E1H6HL^SI1H5hcXZH{5LS^IH5Xh1(lAWAAVAUIHATIUHSLH(DL$2ZH9tMHu5L9^#IH5g1辸E1H(D[]A\A]A^A_fHNtDED ED$D$EutL3LL9uM6I9|HEPIVLHxu܉D$LA^16H5*gDL$7fL]1ɺ)1H5fϷA @MP1L蝖YHL5BL]DEtPT$jE1jHuhHE1^L]_JHLbH蝵LH L+ t u*'HLHD$H9HD$LLpM<$M9u}DIMM9tmIIt$L uI $ID$HAHH}PΞtH}PL71ɺ=1H5Ve(E1eHD$HHD$H9RADL\UH eHD$H1ӵHLHD$H9tpHD$LLhM>M9u=fDIMM9t,IIvLuIFI6MHFH0IM9uHD$HHD$H9uD$tH诱5H}P螝tH}PHt$L\1yE14LZ1.H5c˴E1Ld[OHcHHD$1藴HLH4D$iL[Ht$1VDL$D$L511?H5Uc'DL$bH}PE1QW+D$sL][ff.ATUHLMt.HLJHLpHLId$`t HL]A\1ɺE1L 5H5bnff.ATHE11UHHdH%(HD$1HGPHL$H8 t-E1|$AHD$dH+%(uBHD]A\HA}/LZDIH5a1Ʋ?ff.@AWAVLAUATE1UHSHXLHt$$HL$dH%(H$H1HGPM9MDHD$,D$(HD$GaJD$iLZE.H1ɺmP\$1LZH5aALAXAYHL$M9MDHEgLAIcHl$LIL4@I"@L與u?IAxZHJ|0HG`tĀt@tLItDHZfIAyDHl$t\LYxH53`1E1H$HdH+%(HXD[]A\A]A^A_@Hl$HD$0E1E1HD$L=icHD$8HD$0HLI^IEPHxv^ HH|$0HXFHT$8HL$AHPHT$8HHHD$8D9$$ELH1ɋUPELHH@HHHXHc`-MH,1MIH5 _1ݯMdMtHT$,Ht$(L>qT$,A1LXH5]x=LX11H5v]MD$(>H}P訖tH}P LtX1H5-]f.{*cL"VIH5\1ĭ1ɺ$L5/H5\薭D $DLM`H5\fE1^fDLIV,H|$1H `LlHIIH9ȿAH\$0H;\$Ll$L|$@L$>tA $HLHHH;\$INH1H_LLkO H}PLLbHiLbHPHEPHH$Hx*Z H$Ht?MI $HxHHIt HtHLH)H)H4L^Lh-1ɺ6H5Z轫$LA-1ɺH5Z1蔫D $IL`Id$`LgLIHtHGLH脍HLHH!E`3:tMLH:L,1ɺ1H5ZE1A $҉ALLL蜹 MtL臹 MtLr HEPH85`t* ua g]L&LPSIQALfLXLl$Ht$L脃tg"Ly&L@SILX&LRI$L8+1ɺ$LSH5X1rD $i$L*1ɺ$L*1ɺ$L*1ɺH @$H5N.H=_.踫胳$L*1ɺF$LRO$L]*1ɺff.AWAVAUATUSHhLt$ H$HT$DD$$DL$,Ht$8dH%(HD$X1HHD$0I9DAD$LIIω$HtD\$$,$LHIH;[EHD؉+D$ D$(A$H1ɺVSILRAUH5W1UۧH At D$,AD$LAA[DT$ EpIcLt$,$H@1HA;@DL|AA$H);D$ I$H|HG`tĀt @tHD$LЅtEuH|${Ht$FclHD$ x#uLQIH5U1DT$ zf.ĀtH|$7H|$kA%fD$DLt$Et[$A)9L$(҉L$ !ЄtU@HD$XdH+%(F HhD[]A\A]A^A_f.DD$ $A9T$(E!ЄuAD$LT$(H\$@H\$HH\$@9rf1@I$H|$@JT*HPHT$HH1ɉLHPHT$HHAT$PHD$H衮A9l$LL,@I$IJ|(Hg`aIFPHHx"S HaLWH50TE1LO1\H5TԤE1@1ɺzD$ LD&H5S襤DT$ [D$(AD$Lt$(L$$L$,uLl$@1E1I9uMmI9I}HtHL?3I}u1ɺD$ L%H5 SDT$ 1ɺD$ Li%H5RʣDT$ LE1HHtHE`Āt Dl$,EuLl$@I9>MtLL2HHLe2zI|$.LnDHZD\$,ELl$@I9uMmI9I}ʱ uD$ Ln$1ɺH5Q1DT$ wLE1<LU1ɺIH5Q1舢LLHeD$ L#1ɺ녋$:$D$ T$(L$T$(@MtL HtH IFPH8DըEt  uD EuDD$,Eu-Ll$@I9t#I}Ht111MmI9uMt11L|1Ht11Hc1|$(HD$8HtT$ LH1PDL$0E1H5=PLyT ^A_IF`dI$LxIg`L%]LLLH|$,tHL$zMn`AHI!Mn`IE1H9D$0LEMH[D$$PLhHH'H$AFa tIH9D$0bHH0 HH;D$0uF1E1LL.L_!1ɺH5N1貟E1jD$ L2!1ɺ LHHI9B1LJIH5N1PAUL1H,$H݉Ld$ML|$iI$HRL<J|>Hg`R[I$H|$@JT>IUHT$HImIUHT$HL*Ll$HA9\$LvbIFPHHxL IHvL, 1ɺĀ@D$ L1ɺHLd$L|$H,$H61H$}D$ L1ɺAAFa tIH9D$0|$, Ll$@I9LL,1|D$ LQ1ɺ$IF`SĀJ@ALI|$HH>E1ɹHHIFPMH82iI$HHM`YLH׌D$ L1ɺ?4AFa CH9D$03DL-U?% D$ LM1ɺD$ L61ɺ(D$ L1ɺ+D$ L1ɺD$ L1ɺ~HD$ LGIYD$ L1ɺBD$ 1L/OH5KDT$ aHD$ eLG:IILzG0IH5J1蔛E1Lff.AWAVAAUEATIUHSH8H|$dH%(HD$(1Gat,HD$$D$ L|$D)HD$IIH9@LHELL9؍pD$ GE1Pt$A.AXZEtDL$$Av9wLIHt)uAG@D$ L|$fL1ɺf1H5IDL$ jDL$ HD$(dH+%(uH8D[]A\A]A^A_辤ff.IGa uWHHH9tAQLt2HHRHTfD8u L@A@a uHH9uH H9uE1LAWAVEAUATA1UHSHXL$LD$dH%(HD$HHGPL8RL1ɺH.H5xHLI`L1ɺIHH}PMpHHH9L$H9HHDL\$IEMHA$)HAt$j% AZA[ILD1H5G1肘UpH}PL\$AUE1Ej1AVt$(RLj脵H0IHBEa PLLM9I$8IO`I_`E1H9@AD$ D9wAT$$D9M$$M9uHMHLEEAUIo1H5E萗XZHLDIH5F1E1\DL$EL1ɺH5QF1E1HD$HdH+%(oHXD[]A\A]A^A_1E1LJDH5EɖI@D fDqAT$P9r,H AH9YLM9HHL$dHL$dAT$PDH@`I_`H\$0HD$H9HHl$1HD$ HD$HL$ HH9t@E 9w U$9wPHmH9uHl$HzHLrCSIH5C1辕^_ H|$W;UPHE@ut$H HHoDuLAwHDEGE1E\$(Ll$AE;gDHHLpHxC&H@IHHЋUP*XHCHuL%B1ɺ1LmLHl$ȔLT11L諔H3L2AIf.\$(HD$]PHHD$H;D$07Hl$HEPHM`HxHGH@H@HHt HЅKAZH|$4blHl$HHL^@jIH`L@\IH5A1詓HE1)L?IH5B1rOLf@1cH5]AIHEPH F HH8iyHkHI9HH@LpHHD$LLhHEPLHx@ IH|LLHLΗLAD1HD$HMPHp` HD$@H^DD$Ht$@HHEPH5AH8iHD$ HH|$IG`E1HHD$H|$(H9H\$0EHl$HD$HHD$(H9tfU D9w M$4 D9w5HmH9uHl$HgHL_?ATIHA E1jjjjjQjjjH$H|$pHPHHAOE1Hl$8Ll$DAE;wDEHHHRHLpHxHH,ЋSPEBTHEHuL% ?1ɺLLHl$Ln11LŐ2Hl$8HD$@HH HHHSHHUPHPpHD$AHHD$H;D$0IHl$HEPHM`HxHGH@H@HH HЅL1ɺH5> xfDH HLX<jIw6Le1ɺH5=躏'H= L<IH5=1膏L 1ɺH5q=Hl$]L1ɺ1H5K=7L1ɺH5"=L1ɺ1H5=Hl$8Lo1ɺH5<ĎLK1ɺH5<蠎  L1ɺ1H5<Hl$kfDAWAVIHAUATUHdH%(HD$1HH9IIA1f.HH9u|LED$IT$`H1H%ID$`Āt LALLHcAŅA+@ 1E1LH5<YHD$dH+%(HD]A\A]A^A_@HL$E11LLAŅID$`|$H$*Lx H=:H1c1yXHZ-bH;HD$ D$D|$EdHLIL!w1eyHVHL1ILa15yDD$ H;HEtU0tUD$H[]A\A]A^A_fL1ɺ1LxD$f;uHOLLI1xD$s1ɺLLmx AWIAVAUAATUHSLHdH%(H$HI9'HI9tX1E1Lb0H5$wH$dH+%(HĘL[]A\A]A^A_DLFHIH1H+L\ IOPHLHi IH Ht@IGPH5%H8UIHHLE1SDH. ZYthL`3"IwHWL*;@LE1mLy/ IH51vME1L/H5vL 1ɺ1H5E1\vnM1L /H5d)v;蟀ff.@AWHAVAUATUSHH/H9}(MLAE1[HDH@HLxMDu(AubDLD'II1II9tH@p 9w x$9whHI9uL1ɺDEOpDD)EtLDL$ CDL$ IMEHD9rUz$HHHxHzHH9HyHHxHyHHAtHD9rII9t11ɅuM(B B$J(HL9uAD9eL$L1ɺ1H5Ot1H[]A\A]A^A_fDL1ɺjL1ɺsH 1X$H5?H=PvfAWI1AVAUAATA1UHLSDHD$,LK1ɺUHH5"HIHHjAVIPEDjD$h1PAGpt$hPSD$莐H0IHDT$`EuDjDLESDL$HHXZYI~ H[]A\A]A^A_ÐIGPLLHDD9DFHPDL$hL$pAXAYHHD$LHEjDLSDL$^_L\$LL$nL$tI{PL$ZL$L1H5l!>rI~ H1[]A\A]A^A_@L1ɺX1H5-!qH1[]A\A]A^A_fDIML9LLIK`L$f.H<$HZaL.1ɺuH5 q`fD1L*]H5 Tq1=DI{PKL$I{P*jDL1ɺi1H5- pf.AWHAVAUATUSHLH|$H $L9t:LHMIl$L9t6M M?L9t(IwH{uAHD[]A\A]A^A_M$$L9$$u@MmL9,$tHD$IUHH@PHHx*TAąuL)1H5=pff.fAUATIUHSHHHGPL(]nHL肈HuKV1L=)IH51oMt4A$HA[D]A\A]ÐkAąt$HtHA[D]A\A]D1L1ɺH5]/oHD[]A\A]ÐHHH9DHJA BLGa ATUH@1SHHZ:L$t@HL9tLLI1\LHP L 1ɺ1Lc\L1ɺ41LE1C\fDHHH*H9ukD8LpLLWAƅIEHtH@PLHHxAƅ)MuHMHIH9pHIFPLbHxIHu Hf1LpIaL17H5c O[L1ɺRH5e1E1+[L%eL1ɺL[L1ɺD1H5eZ\Le1ɺ71H5^eZ6L%Ee1ɺ1L,LZI}LLI1`Z1LL1CZI}LLI1ZL1ɺ@1H5dYo@IFLl1ɺL%gd1LYI}CLLI1YLHU L 1ɺL1ɺY1H5cOYIv`$AIDžIEXIE`L1ɺe1H5cX{L1ɺ=1H5}cXUH HHfLH0HXH|L%)c1ɺ1LLpXI}LHLI1DXIEXHǀL17H5  XL1ɺ,L1ɺU1H5~bWVL%hbLX1ɺLWL81ɺi1H51bW L17H5vbWL1ɺbL1ɺoK ATUSLGIIH9HE1HPHzGfuMu=IHH9uMHI#@`tID$H@Ht_L[]A\f;I|$H.H{I"UATIL 1E1H5aeVXLZ[]A\LI|$HLIHPSLE1LIH5`1U6AWAVAUATUSHHGPL0HG`IH%H-D$ @hHHE1E1H9uf.HH9thD[LEtH:uHBIL$H@HP@cH5W L$IMtMHMH9uMGDl$ I w M90HAE MA$I~j AI~LMA$HE$ AYLAZIHI~LAEHMA$jF H$LAUIUH5^1TH H[]A\A]A^A_D$ ;H5 L$IIIH9g@TL9sHAELMA$I~j{ _LAXHIIH9fHAEMA$pTI~j$ H5]IXZUAU1LRIY^H9PfD`TLHLIH59]1RH[]A\A]A^A_DLIL1LIIIHuH1HIIL?IH5\1R1ff.fAWIMAVAH1DAUJDATHUSLHMHLl$@HI9IMH$HHDjL LIXZHH}H3jI$DLF Y^ATAWI7=lRLH5[11QL_AYLDHAAE\HD[]A\A]A^A_f.HD11HHII9sMqAMH$LHDjLq H}$$DILH39 =rQL<$I1ɺK1LH5ZOXZDL#MDE}EtH$HHDjL H}$$DILH3{ =PLI1ɺ=H5Y1L<$9OAZA[@H$LHDjL H3$$DILH} ^_LHGATLASIDH55Y1NAXE1AYL 1ɺSH5YaNE1}fAVAUATUHLhdH%(H$1ID$`H(TH(HIHLJhID$`LA It$H1L﹀YH_LVH1LHLL'AU=NAVL5XIL[1ɺ1LbMH}XLZ1LOAą111HVA=fDD$LLj IH5W1E1LH$dH+%(HĘD]A\A]A^LH}L IfLH5߆H9HL E1互H5W[LefDL1ɺ1L3L=VfAV>AUATUSHHdH%(H$x1H$HHHHH;$<HDH5lH$XDŽ$HDŽ$DŽ$DŽ$Ƅ$DŽ$H$hHDŽ$pDŽ$DŽ$H$XH$`RH$0HL1ɺ1L-ULC LKHHqIHH+HdIHHcI\$PHhHtI9H_oIL$HI澀1HLYq ML$HH11jAVLLf YJH;X1ZLLGLIl$`(LhH$xdH+%($HĀL[]A\A]A^LE1LQ IDeL1Lz IL<1ɺ1LE1Ib1ɺlLLmIIL11H5SDI1ɺaLLIhL1ɺ1LHiSfAWAAVI1AUATIUSHLhHHHHH9IHJLH#q`tIp9v ΉH9sHH9uEMtULH-RL  HI1HI<$1ɺLAąeDAHD[]A\A]A^A_EH9GMNIE`MI%I9MD$Ht L\HEMp1ɿUL=Q1LL: MGAMp^_9O|$DAD$L1E\$8)E$It$jAAUtRAVUDL=H AąLz1ɺ%1LF@L1ɺ1H5EQFf.L1ɺ1HsFfDL-P1ɺ1LALAFLLH;L1LE1 FHtD$E1rEHEMp1UL1ɿH5_PAEXZHHw@IH1Ht)HVHH9tJ HH9uHU1SHHo`Ht+HHpHtH5_HtH[]fEatHs@H^IHt @|H[]HS@HtHIt$LHD$ HHHD$LHI9HIFQIH}1LHjHHHH9ufH6H9HVH9B@uHT$HH;tPLD$L$$LHH9\$HD$H;L @H-L1HBL1ɺH1AHD$=H1MLH5AXZHD$HD$xdH+%(HD$HĈ[]A\A]A^A_fxLhL*HHHD$H9H\$(L|$8Hl$0HLeM$I$L9ufDM?L9twIwLKuID$@HtH;u:H-L[1H@LN1ɺLD$L$$1HL詾HmH;l$NH\$(Hl$0L|$8M1LH5'G@fLH51@HD$ZLH5?3H-VJH-f.ATAUSuD[]A\H0 Htf@,HHHHX@hH@ @(H@tvHHHPHHHD[]A\!1E1H-?HLH>L119H>473 AWIAVAUATUSH9_HHH9t&f.C9r DcAD9rmH[H9uHF@HHHH9HBHAPL1H5YG">XE1Z9E0LsA) H@,HHhD)LpDhH@ @(H@kHHHXHBHS HHtHRHsHHRP)AMtIHD[]A\A]A^A_H1HH-fFL1!H=L11mHz5XZD$D$HH[]A\A]A^A_DL=ff.AWAAVAUATUSHHH|$HDxBDA9DGHH9fIAfDAHHH9BE99CCPD9rH{ uH|$AoD)(D)A9C IHfH@ @IEH@@HHHH9LJU5AVH5=1L%4IMIuM,$Et$Al$ HAAl$Z_H9uDHBHH9t HP;h vHxIT$IL$HH IL$ HH HIMHP CAmCL IH@H[]A\A]A^A_@H-'=1ɺ31HLT3H11Lٴb73H1[]A\A]A^A_H ?$H5MH=^5HLHG HHO EYHAHD)AA9wzr H)rMQAIqz zHFL9uHAHI9t HH;x vHxHJtBHrHp E)Hr HP H HH EYHH ^H5;H=4& ufHHH9EUSHjL9u H[]HxS$UIL1H51XZ1H[]@HAVAUATUS9HAfDED9wD9HHDIHEPHDL$HxjA IHEPHDL$Hx$ 1ɿH5IXZAUAVL_10Y^[D]A\A]A^A[]DA\A]A^fSH9rҸH;WhwG[D HLK(LPm1H5N0X1Z[ˬHLK(LPsff.@AVHAUATUSHH9CHuHGPH8‰HuhHA9HEPHDHDL$Hxj膼 IHEPHDL$Hx$D HIXZ跫AU=n0AVI1H59L1.DY^[]A\A]A^HHH9HDGdDALESI1H 9YLv)H@Hǃ8u&H@Ht@gu׃9YLw׸[DLتHAٺPL$1H5W.X1Z[fDf.AUHATUSHLHI9ĸLDGdt^AT$LtUI1DH@I$HH|tI$HD@auIEA9l$Lw1I}H[]A\A]fHHH9@AVAUATIUHSH8tsHHѰ1{AąuCH蛩L/&IH5!1,[D]A\A]A^A[]DA\A]A^fDIHH9u@HI9tLkEcuLH賾tM fDAUATUHSHL.L9#H'fDIuH}[AąMmI9tGI}nAąuL1>H5.+HD[]A\A]DL+L9u)I}7(AąMmI9I}Le"*LHGDAąu1L1ɺIH5o+HD[]A\A]Ð1L1ɺDH5z?+HD[]A\A]ÐH}ǟ 2t= A,tNQ,AFO1Lz1ɺKH5 *HD[]A\A]輞f.AVHAUATUSHH99>HE@O}L HGPHI0HxM IHHHxI~HHHx AŅOHI<$ID$M&IFID$L0HMt$HxHw`"(HI<$HpIFIv(`IT$MfHIV IT$HID$ AŅ HAH!C`[D]A\A]A^DLqH51E1A)[D]A\A]A^DHP HtGHHt?HI1E1LH5+([D]A\A]A^@LH(f.1LZ1ɺH5([D]A\A]A^L3f.L 1ɺ1H5_( DAWHAVAUATUSHL/I9;AEL1E1IH@IHH؃8L`MLHt$ID$`Ht$HHIHtL ID$`IHDL x`ID$`HtL!ID$`AA9mLSEtAEHH[]A\A]A^A_f1Lʨ1ɺH5Z'H1[]A\A]A^A_ff.AWLIAVAUATUSH(DwLE HGHAH@t@ uG1L;1ɺ H5˪&H(1[]A\A]A^A_ t tD11DEILAHH@H@PHx HPL1Hi'IAD9ELDDfI A9w1҉AAB*MLA9wͅD1@A9I49tHHRH<HLH9Ao oHJ MZLZHIJAH IH HooHzLQH|$LRHy)$HI: >ML9aEt AɅ:H([]A\A]A^A_L2D1H5$1H([]A\A]A^A_H}#HUHHB HaHHUHIH1SH5LB$Y1^둋UL1tƒA9ELwD9ADE1E1E1tmfLDD΃A4A9t/H4RItFcuA9uىA4A9uD9tAAAE9vMt I~( H([]A\A]A^A_@}LwIEPH8 D$HEH@ZAEp1uLD$DMt I~ LƟ1ɺm1H5TH(1[]A\A]A^A_LW5H5H(1[]A\A]A^A_DMt I~: LF1ɺv{AUtAV11jI}PRLSPD$DPDD$HE:H01ɺ^ILH.D$fH@|$xpH F$H5TH=eff.AWAVAUEATAMuUSLMHL1H1HHH!H LIIĉ1IH1HHH!H LIAt!EtE1D9tED)A)A9DBHD[]A\A]A^A_DI 1LLH1HHH!H LIIQ ^f.tRHwtFu> tɾDΉHҹDщ1HDHH9кGHG uaE1F uP@t AFu=t AF@u*HHv(H(E1AHDD@E1F t t@tHLHI9LDGp9A@LAp(tZIH@HrH| DHHt@HHAP(H9tfP(H1H9uHH9u¸HL/1H5Q1HL֛1ɺ)f.AWAVLAUATUSHXLHT$HL$dH%(HD$HHGhHD$M9-Ao8Ln1ɺHGPID$(TAą9Ht$@L`Aą[9C1t$(EAG(Aхx9vH|$@gHD$@A)VAGH}*H\$Ht 1H|$@IEPIAG(AGHI9,KL1tpfHH@HHxHHH1H9tD1ɅuK(P P$H(HH9uB;kLrA0LL$IH5~1AHD$HdH+%(HXD[]A\A]A^A_L1ɺIDH521E1IAWLH|$ GHG)EDAG8LT$(DL$0D$,EGLT$(D$8ADL$0IGH@IEPH5ϧDL$0DD$(H8pDD$(DL$0HIGAG81LDL$1II9c*xLL虒+D$8LkAąII9:*xL1LHR`u2u*IHt!HTHtHR`@HH9uD9LH-r}LHI 1L}LHI 1D9ML9t$MG`f.GHIP3AŅBIILLr AŅIH9D$wXLDd$EKH1L^AŅIPHAŅ?LAŅL1ɺ 1H5HLS H-1HLE1ɺ 1HE1HD$xdH+%(n HĈD[]A\A]A^A_L1ɺl 1H5r7DH-ZL1ɺ^ HPfA\DAH-Lk{HH1SILz 1^_L0{L|p IH51y@A5ANL1҅tG\$LADL,@HILtHxuAD;sLrLza LiIH5 1E1BL! H-1HH\$PL9ufHL9H{u1ɺ HLlL L~1ɺ 1H5n3LyQ LIIn0"H LHA'H$MIo` L9t$IAHH5H@H P`IGPH8}IFHH-L ~1ɺ HdE1tL}1ɺ$ 1H5j/f.Lt$`Lt$hLLt$`[fH\$`Ld$ H;\$ u1f.HL9H{;u1ɺ HLD}DIދ\$IoI)D$`HHHL$pAoMIMHHfoT$`AUHD$pIEA9VL;DHB HHHLHLH-NwHLSI H1A[[/LLMLl$(ewI|$HXwHL԰SI H1ZYH-~L|1ɺ HwL|D$ubLvIIH9|$EHGHP HHHHH41LHH=UH-!{L|x1ɺq HL,| H-zL?x1ɺ HH\$PL9mH-z1ɺ 1LwH\LrHLSI H5`z1#A]E1A^~m ' AWAVAUATUSHLH$T$L$L$HD$dH%(HD$x1HI9 AF8IVfIIDD)D$PD$HH#BD$p)D$`t$s9HL$1H5^r,H% L%^1ɺ1L[L?HHL%X^VLLI1H $H5!_H=2_Ld[1ɺJ1H5]E1nHD$HdH+%(uTH}PHt$HX[]A\A]A^A_L%]L[1ɺ&L\L%]fDS9A)K @PLHH)L@FL)IH@HHHL HH4LLNLPLVLHHtH LHpLBL@HrHAL9u[DAIH)K@HHHRL)HLRI@HNHH4LLNLRLVLJHtHLHrLALBHqHH9u[UHSHHHH9HWHB HtHHt H@HZ(HdTHLSI1H5[H1[]ff.@UHSHHHH9HWHB HtHHtHHZ(HSHLTSI1H5S[H1[]ff.@AWAVAUATUSHD.EHG`IH HHHLLL%ZM9tkDAFL1ۅtTfDIH@Hƒ8t/LR1ɺLIL61BEA;^LrM6M9uH[]A\A]A^A_HHH9HCKLH$L$@ D$$D$ E1%f.D$ AD94$t`D1EHt$Attփ|$ tDd$ LQL1ɺiIH5Y1AEDmE1E1fDDHMAAD9t$uD9d$tnH$@D9stL|QHSIHB HtdHHt\HHSDJAT1ɺ{PH5XLg1AY^QLQL1ɺtIHB(fATUHSHHH9HGH9Ft|$ HtH^(HP HtHHtIL`(HPSATIL5L%X1LXHZ t [1]A\fL1ɺL=U[1]A\fDH@ Ht7HHt/HH PHLSIo@H^(fE1E111HD$ D$D$@ATUHSBt L% tLb(HHH9HWHB HtHHtHHZ(HTOATL%VSI1L4LXHZ t [1]A\fL1ɺ%LSe[1]A\ff.Ht$ Ht$Ht$Ht$Ht$Ht$Ht$Ht$Ht$Ht$Ht$Ht$pHt$`Ht$PHt$@Ht$0Ht$ Ht$Ht$Ht$Ht$Ht$Ht$Ht$HHt$HL$ H9kAE1D$6fDAUHATUHH dH%(HD$1|$@ILl$XLd$L$$tOH}PLLHHT$dH+%(H ]A\A]H-TLuQ1ɺEH1LXQ1ɺH1DH-SL-Q1ɺHHH-SfDATHUHH(dH%(HD$H|$@Ld$XHD$H$tSH}P 1LHHT$dH+%(H(]A\H- SLeP1ɺEH1LHP1ɺ^H1DH-RLP1ɺHHvH-RfDHHDL$DD$LT$ H9HLDD$ALT$lWff.HHDL$DD$LT$ H9HLDD$ALT$Wff.HHDL$DD$LT$ H9tHLDD$ALT$Vff.HHDL$DD$LT$ H9-HLDD$ALT${Vff.HHDL$DD$LT$ H9HLDD$ALT$+Vff.HHDL$DD$LT$ H9HLDD$ALT$Uff.HHDL$DD$LT$ H9XHLDD$ALT$Uff.HHDL$DD$LT$ H9HLDD$ALT$;Uff.HHDL$DD$LT$ H9HLDD$ALT$Tff.HHDL$DD$LT$ H9HLDD$ALT$Tff.HHDL$DD$LT$ H9fDAWAAVAUATIUHSH(dH%(HD$1Ht HLxHHH$IHD$AH9øHDMH'dLDHEPLHHxlp IHHuMA1H [vH\L HACLL,$E1uuDL4@HIJ|0]tgHt5Ht$DH֞HHHJ|0]AD9cLLDH蕞HHyL%C1ɺ1H5Ex1HT$dH+%(}H([]A\A]A^A_1H H[L xHR`u2u*IHt"HTHtHR`l@AHH9u|$ DD$I1L>Aąu)MH@ILxL$A^L9wA1L=B*fDIEPHH8<A9^LI؉LH@HHh襶tH:IVHHB HHHLIH11ULLXZA9^LwIEPH82DEt  u1D*EIAFLD$ Å|$ H/H0Dd$,HEHD$(Dd$Ll$0HD$ HHE1E1HD$8DE9vQMLH@ILhquL"ED$DA9A^LDB9wDd$,Ll$0D|$ t|1H$A A9nLvgL uIEPIL8H@HHx8LH] uL5>1HE1%舼A9nLwf|$ L$HtIFH T9HHHBLl$ +l$8IVIHB HiHH]LITD9GL8LIDHP8IVHHB HtPHHtHLIHLL1U{]A\E1LJ(&LJ(f.L7IVHHB HHHLIHLU11SH50?_A^LAXfDIUPIuHHHxHHHT$DE萊 {L07IVHHB H7HH+LS PLL$HH5>1LPY^D$,A^LDL6IVHHB HHHLH1ɺSLH5>PD$\PLL$@1ڹD$HD$dH LJ(=2H11UH-=LɔSHAU膹D$HH tAtIFL$9HHL$HjIF\$@9BÉSLJ(HB(L5IVHHB HtHHtLHB(|$ SPL #HLLDH5<L61诸^_1y @=ϹDL$(HL119ZHB(@IuUL4LuIL4LIH5+<1AAD$(QLff.AWL=;AVL5*:AUATUHSH(dH%(HD$1Ll$GdQLHAąHD$PH8T$ d D$ du^U7 A +u{!D tPL|81ɺ1H5 ;E1̶@HD$dH+%( H(D[]A\A]A^A_fD$ E1=AD2L1L8``H21ɺLILl10HGPHHL$ E11H8AċD$ ElH2LБLI1ԵHP2LIH591虵ff.@UHAWAVAUATSHHHuLdH%(HE1HI9E HIA$AD$LH@HHHHHH)H9tHH$H9u%H)HOHEIHEHEHEID$@uqLEubL:1LIH581胴DUHEdH+%(HeD[A\A]A^A_]f.AAEatLEL<@IIEPLHxb HEH1HLWI}PA\$LE1L=8LmE9fDLH}HEAHHEHCHH]E;l$LDH@I$HH|0LIL1 ]I$1ItH|脧lH}E/II$H|/HLÏAUI L1YDU^hLmL1 LV輲H}ޞI$HtC$/ LIL1qIEP11LH8#6HELu1I$L;uLefDL.I~I.H%LATILh1 I~HHHg`AXAYH9H`0onIVH}1ɉLB`躩M6L;ubLeET$LE1ELmMEfDDH;LH@ IHLHDLHHAV1'XILZH|MIAHHTHB`H%H HB`E;eLH}DH5[豍IHMLA21ɺ:1L蘰E1HLDLa1H54\E1@EL111H5g4,DULE,I~H,HLfSI0ELlL1ůDU=MLmL3,LLMI 1C耯HE1LID$HI#E`H IE`FtKAL01LE=)DUEL3EL01LJ1DU_H $H54H=4o:f.AWLAVAUATUHSHLM9"jGdM AIuHF A9AM8}AąQEAH ~E9VEeIHt 8xHI9H@@H AąHG*IUHHB HHHLIH1SLH51fA[[7tLH)LSIH5j11E1*HD[]A\A]A^A_L.1ɺ1H5*1E1f.Ll.1ɺ1H50迬DHEPHAH$DLHxj9 AYHAZI(IUHHB HtHHtLI LJ(ATL5d01ɺSLL1Hu`<_HAXAąTHEPHAH$DLHxj8 YH^H8(IUHHB HHHLIS=ȬLU1L1AQXZ f.'IUIHB HWHHKLIHEPHHDL$Hxj7 AZA[ATAUILH5.1E1觪Y^vHEPHHDL$Hxjv7 HHD$A^X&HDIHEPH$HxDLj(7 H=ɇHXZ1HL$Lt$(A;-AQLANu9 )D9 MyIG}LH}HHEHP HHHHIP1ɺR1SL[~LH]ZYD$0CIDL1ɺ L=1Lԕ1ۃLѕAHLI HHcхuD{Hp(1HHI^"HH5HuHHTHtHHܔL MLD$0HLDL}1ɺ1H5 ДrHT$tHt$pLe{H$l$tH@I9LL=LwLI4 1bLH$AHAѹ6 DKLPLw1L'XZLh(L=AL1ɺ LLH(L迻fL=LU1ɺ L讓cL=L.1ɺ% L臓euH1[]@H-ff.@USH\$ u.HT$8?AEH[]HHH9ՊhL9tmS$UH-IL:H1tXL<Z1ɺH1tH1L1ɺKutH1[]@H-ff.@AWHAVAUATUSHXH$Ht$Ll$0HD$dH%(HD$H1HLl$8Ll$0HL$H9H@HAE@uÅoEu+HH"KHH=]H1JHHtHtHfDuHzXHtGcuB3t1H1L1ɺH5i1Hf.H1HtGdtuHB0Hf.USHHHo`H0rt,HHH9~HHxGdHtH$ss@L /d uwHHS`tHL }TuJHHH0L c#@uL  DL c1L UH5cg1H[]@L Hcf.L hcHHtH$r L dc뀐HH}H1L YcZH-1ɺ1LSHgLS11Hf1LS1ɺHfHHH L bAUATUHSHHH?H[XHHS`AŅt HHpxHHNH1tHH9u HHxvbAą;HDžH8"H{PEc9NHCPHH8AąH{P^@HEPHH8AąHCPHH8AąLKH~1LaH5:eDHCPH8ltw >fuIfHCPHL jcHL} AąlHS`E1|SHLHRH5MH@LHH1dHD[]A\A]LtoH{P&?HA[D]A\A]f.苈=fDLT1ɺIH51dfL1ɺf1H5E1cHD[]A\A]fDO,HAF LzQ`IH5G1cf.L 1ɺp{DLKH?1LPH5@cHyhtHyxHHS`HHa0HAhHǃHHS`LKHj1LPH5vbH{P7@%fLMHy1LnH5>bATSHHuKHHHt#HHRAąCauYAHD[A\HE1L8PcIH5Co1aHD[A\fHhL9P1ɺqIH5 o1aHc`nL,1ɺl1H5naGf.ATASHHHHt8t>HRAątgHAHǃHD[A\D1E1LOH55n`HD[A\fDL\1ɺ1H5n`ff.fHG@tZHHHuH9u0H9ptHH9t"Hvu9Puf.1DHHLNIH5Zm1`1HDH9ff.AWAVAUATUSHHHG@5HAAHEAąt`H{HSHE1HHH5lSILN51T_Y^HD[]A\A]A^A_HC H@PHx HAAHhDhHEH8HAHL  L*[AHPHH5kHWHH[LD1^;DHE1 L`M.IH5k1U^Dx4HEE1P81LMH5`k ^XZDH;HfDLlM>H5 k]gR @UHSH8dH%(HD$(1Gd HGP@aAE|HHH9u eHH9t]HCHxtHCHxL.MIH5Yj1]@ >H8uK1HT$(dH+%(upH8[]f[LLIH5i1\1HHE1E1jHjj萎H t$1f@ATUSGd HHH9ŸHDtE1AD[]A\=tHUHtHR HJXHtHGPHu1H8AątGaSE1LKI1H5h[D[]A\ÐHUHB Ht9HHt1HIL1H5hO[+LJ(@AWAVAhxAUATUSHH8HWdH%(HD$(1HHJPH@hL)HD$ HtTHmfH*L[A^Y@,t Ahx=t@x}A9OA)HRXH=L@8H{HT$ AąPHT$ HBp8D@0 ȉ ȃD Ai@B9O;jBD99HBLH(L9tfHH9HEI9tIL%}VH{@HH1ATI1LOKAUH5fE1UYHT$@H H: HD$(dH+%(H8D[]A\A]A^A_fHELULDH U@HDHU@HDL=ULD$LD@H{HL$L%UHT$LDiHLD$ IH5 f1APHL$ LIQHT$ 1RAWATE1XHT$PH0HB@8cHƃfHH H*X~f.HQXLLIHD$ pH{HAT1ɺ=UIL[I1H5DeE1WHT$0XYDLLIHD$ pH{IFAV31ATI1H5dL{HE1WHT$0^_B@LNLIHD$ p;H{IAWLG1ATI(H5xd1E1$WHT$0AXAYfDL1ɺ1H5CdV{f.L%mOaff.@AWIAVAUATUSH8HGPL0HG`H$H%:H$E111ҾLLD$)41LD$(AdE1 4LD$E1ۉD$,IpPHHH9fDH{Gd HWXHGPHLLD$ D\$HT$3HT$LD$3LD$ H{L$D\$IpPA9DLA9DOH9<$t9HHALhH9tf.HHHHIHihH9uHHH99I9HEGHAcEI шL$L9jHQHD$ML=LELL$HAHEI~H-bMA$j 1HIXZt$S1LFAWLT$AR}TH |$CH8[]A\A]A^A_f.H<$H4$1HHL~hH9tHPHHRHjhH9uI9fHPXHD$,L$(-fDHHH9iHH$H3dHIH9HfPH HD$HyHED\$HI~LAEMA$jL HD$Y^D\$&=tTHLE11SAc~0=GTHLE11RE`=THLHF11R4H<$)LI|$MH VAVAUATUHSHFhHDoTL9r!1IHuA[]DA\A]A^DH{@AąuHEPHLHDL$Hxj HuhIHEPHDL$Hx$ H{IXZ"HHHLEAUI1AVH5^SWQH D[]A\A]A^ATIUHHNS&HthH5HHSt2H5MHSugEA$[]A\fDE[A$]A\1L2EH5]P11IٹL2EH5]iP1D1HvqStqHLW$LjDL׃ LM1H5J]IX1ZO[fDLD1ɺH5]O[fAVAAUEATUՉSHHDGTHHpt[EuFu HCHH`D$0ADHǃ[D]A\A]A^ÐHCHh`3@AL11ɺ"H5P\N[D]A\A]A^UHSHH5}HHQuEH[]f.H5KHqQuEH[]f.H5HAQuEH[]f.1IٹLZCH5}[)N1afAUVATUSHHw@H[]A\A]H$ HDjL H{$DI$L H{$DI$LI Y^AUATILyB1GH5[Z M_1AX@ HH{$DjL H{$DI$L OL$$LBI1H5YeLXZ1H[]A\A]fDAWEAVAAUIATUSHHhH$HL$@DD$(L$HD$H$HD$0H$HD$H$HD$8H$HD$H$HD$ dH%(HD$XA$D$(HD$HD$ LKH҃HD$HHD$HNE$EDEJ41HHD$8L=lXIHHHD$PH9JD(1IIHD$PLT$(HHDt$LL$@HLD$`AXZELT$(Lt$IHT$PHA6H =H1H{AHI$H;D$8HDLHj_ A4$$$H{HDL& =_KLI11L@H,$IA4$]HA^QHD$8A4$IH9[HD$DE*HD$ BHD$HH{$0DjLIf 1LILrAX1Z4IAHD$XdH+%(QHhD[]A\A]A^A_ED1IHD$8IHL$PHHD$(t4 ) E$9Gº9BEL=UA9HH{j$L=UDLR YL>^I1ɺL1 HE$ PXL=IH57U1GE1fHPHLPHj%A$HD$LMHHMLH$HH`H|$^D$L1ɺTH5wT1!GDL$LLH0HhHLLGH|$ ADL$LW1ɺL1FDL$v@A$%H5uHD$L1ɺDA4$HH{$DjL YL=^I1L1EH$jH{DL _1AXIL=L1ELt$ 1L B1LBLAXEAHDLHjD A4$$$DHLH{ H,$L;IL1DAZE1A[A$HH{jL=Q$DL _1AXILAL1_DE$_fDHL$8LLHUDEA4$1HD$8IH<HH1HD$PH=v>Ht$H!@HA $H=HƁvH΄tHD$PHH{$DjL A_L=P1IL@Xn1LjCHD$PE$R@H4H1HD$(t!w% ) H{L=%uSHHH9HHDAąA[]DA\L%e>HqHMPtL 91H5 NE1@ZYD[]A\L%JzL%H{fHZ}1E1L8H5M9@L1ɺz1H5cM@Zf.AWAVAULATUSH8dH%(HD$(HL9VHH9Hu\AHH}PH'oH}P>^HD$(dH+%(FH8D[]A\A]A^A_D5AHפG1HI9fUHHH9txHH9uHEPHH8AąHEPHH87HEPH8[5EtgQ ?u螲HEPH82 tEt>Q ?uu?%QuD5EtRHI9THDADL1ɺ1H5KK=E1yHEPHH8AąHfAąPuD5.D CHk[HM6HEHDHSILU6H5J1Z=AZA[D%PEHEPDH8EtmHHE1E1jHjj oH tE<$t>H1I9HDHYZL5IH8UL5IL%I1L~EwH8AJcH>H4]HV9HW8HN8H=H68H!HA11L.4;H5n`:H8H@AWIAVAUATIHUHSLH(HL$dH%(H$1I@ A@(HUHLHHEPH蕀 HLt$LLIL H$xHCt4H$dH+%(H([]A\A]A^A_fDH{HCHGH$HJ HrHtZ1HtSH9UHlfH*HfH*^YE,ЅDHKHƉS H)HtZ1HtSH9H;fH*HifH*^Y,ЅhDЉS$HHH9NHEPdHHH9Ht@8H~fH*^YI,ЅDЉS(;HhL1IH5171f.H(HL1AVI1H5~k7X1ZfHH_1HTH9FHVfH*fDHD$HKH81Lp>IHC@HD$HKH}4Lp>XHfHH H*XfHƒfHH H*XmfHfHH H*XfHʃfHH H*X1fHƒfHH H*XffDfDfDlfDHfH*X<@f.fAы'SIuk1H=H c HH=uH5LHfH3H9uHI9uAMAIH=HLEPApIA3XAPDEB3AAB3 DB3,EAEB3ADABAAED1B3$AÉ(D1303<@343833 @33I9AEt$DH=uHH13H9u[Lf4ÐHDIE1LLIHuHH uGHAR_L3V1H5ma3XZ1HARIgVL4AUATIH5MOUHSHdH%(HD$1H$D$ HT$H5OHx AA t@tux$D$AA$HD$dH+%(HD[]A\A]DHEL HtLLn317H59Y2HEL tHtL=1E1Lg3H52ZHPHhtqIVL3HSIVHI>I^tUHXIVL0HIFH[]A\A]A^A_1Lj1H5L/1#$ AUL-L1ɺ.ATLKL1UHSHDOL/DMP11LK/Lf/HHt!LHHLK1L119/11LK9LL% /1LH11LK;L.}LvfLH9]LwHLL1[>]A\1A].@HEHH@PHDL$Hxjd 1LILJX1Z62.ff.fAVAUATL%USOLH1L5L-JA1M1ɺ!L-LHEL9wHHt]tY1L-Jf.HH@HDHt%HpH(1AM1LV-XZ9]Lw[L]1A\L-A]*1A^'-UfH1SHJHHHdH%(HD$81H)D$H|$1)$)D$ HtAH@ Ht8u2AHtH@EHD$8dH+%(uLHHD[]fDHCL HtLL&.1DH5HY,E16ff.@AVf1AUATL%EIULH1SHHPdH%(HD$H1Ll$)D$ Ht$(LHD$)D$)D$0 Ht%LHHg AąHM0 L%ahf11LL)D$ )D$H\$()D$0f HHT$H5HI Ld$<Mtf11LH/)D$ )D$H\$()D$0 HHP HHsHWAHD$HdH+%(HPD[]A\A]A^LHH^ Aą6HEL ױHPHHCHtLHL,R`DHEL HPHHCHtLHLJ-Rz1H5FE11*XZ6f.LuLI~PHH@HHHH`H@PH, fDHEL HPHHCHtLHL+RVH5F1)^_DHEL HPHHCHtLHL,Rs fHDžHCIVHL eHtLHL+Ri3ff.ATI1H5FUHHWLL% E1 HHtHPHH5F1L%t1H5ELu% LAT$ t!HHL]H|A\^Lܩ1ɺiH51(H1]A\HEHKELH@PH1e!$Ly1ɺH5:D'@LT1ɺH5D'H1]A\L$1ɺH5Cy'C@L1ɺH5CQ'ff.AWMAVAUATUHSHH(dH%(HD$1H?Lt$`Ll$hHT$LH AąHt$HFIHIEH~HMtAGP1HHAHtY1HtRH9YH fH*HfH*^Y , =D‰HA HD$dH+%(2H(D[]A\A]A^A_f.L1ɺ1H5`B%DIHH $LL$ H $LL$HHLL$H$L$LL$AM$HȃfHH H*XfHfHH H*XffDfDH$Le(1H5yA%L$LL$Zu/DAWI1LF(AVAUL-:AATIUHպSHHhLvLH|$dH%(HD$X1$HT$(HHW LD$(Al$LA9hIx H5L$.L$D$HD$0L4$E1HD$DDL4@I$IJt0H$H@PH8EuiLNHL>(L11#LD$(fDH|$L HD$XdH+%(Hh[]A\A]A^A_fDHE1E11jjjHL$(|UH hDT$0EZHL@LD$HPDL$L1$#HD$8AXAYL$PDL$L1.!HD$8DL$LY_HP0D$@rJA99u|L>1LRP1 LD$8A_ZI@08AHM`Al$LD${I~P1H57[bLD$(HQL$VLP1d LD$HH L$Ht dED%dH$dH+%(XHD[]A\A]ÐHL$ LL$cdLD$H5bFHHdAąT$ H\$L$L-Ct$L$9retK.I1LL1T$ H L9utA cH $@C9wuC9rfDC c@D$t uD$uL 41ɺ;1LsH5:DL1ɺ(1H5 DAWfAVAUATULSH(H|$H$L$`L$hdH%(H$1)D$p)$)D$P)D$`HI@@@7uL@HEHD$H@HD$(% HD$HHB1Hl$ HE1Ld$011E11AHII-DEu]Lt LHH ŃH9HH@`t MIM LuIALu?EAE!EtL1wH5Llrf.AI1HT$LLt D$LH}趐LjKIH51H$dH+%(5H(1[]A\A]A^A_DHD$8E111HD$ HD$H@ H HHT$0HЋT$0IHEHD$H@HD$(% HD$HD$L$@DŽ$ML)H|$$uSLt$pfo$fol$p$$E@$$ED)$$)$E8H<E1D$$HD$ H$@AHA$THL#uK H<LL4 H$\$@fo$fo$fo$P4H$X0H\$ fo$H$HXh$ H$HH$dH+%(DELH|$LHH(1[]A\A]A^A_vfDHD$Lx(fHELRH5:LHH1TWH|$|DŽ$EL$Gf F=1Hl$8Hl$ Ld$0UHHD$ HA@L1\H5HD$( $EL$gDL1ɺH5!`L1ɺ1H5/ORM1Lu.H5LHHL1cH5$E<DŽ$$HD$8HD$Pfo|$P)$fo|$`)$~'USHdH%(HD$xt5HӅt6HtHT$xdH+%(HĈ[]HL$LL$LD$ H50.@t|$uL$ tsfzjHl$ PHpJLD$HL$H1HT$H5kAA|$|$|$jf.HGIHWHHp0HBPH8yff.HGIHWHHp0HBPH8~yff.HGHWE11Hp0HBPH8: ff.@HGHWE1Hp0HBPH8\: ff.HGHWE1Hp0HBPH8,: ff.HGHWE11Hp0HBPH89 ff.@AUIATUHSHHHt)HHH9ƸHD0AąH]L%H9u5DHH9t(HsLLuHA[D]A\A]@LHLAąu1LH5(g HD[]A\A]f1Lڍ1ɺH5(/ HD[]A\A]ÐAUL-VATIUHSHHH9u 3HH9t(HsLtuHA[D]A\A]@LLHAąu1LUJH5o HD[]A\A]ÐATHUHHIHtrH1HID$ID$ HTID$(uID$0Ht IL$ML$(L11H5e' HL]A\Lu1ɺ 1H59' fDATISHNHHAu*-Dt tID$It A tHL[A\ff.fAWAVIAUIATIUSHHHl1ɃIILLI)ىL$ Iǃ,.t1A?:tIH[]A\A]A^A_I_HL$ IILLI)Iǃ+tA?:tI_f1uI_H1IغILLHI)fH]Xf.UHAWAVH`AUATSHHfdH%(HE1ArH`L5\fHH`L9 IFHHH%H)HH9tHH$H9uH)HtHL Ld$IHKT4I9sf.I$IL9wHDžPE1LpEfLXHHHX IHPLMt*6ILHI9sLHHH9wLHXH9w9DA)AA u@IcHPHeUDLH HdA uE~ELI11H5A I HdHHt$[ HxHfHHH9wEt1LI|H A9HEdH+%(u]He[A\A]A^A_]H8dI6 HdHHs됐 HcHHSff.AWAVAUATUSHXt$H$dH%(HD$H1ctP0AHD$HdH+%(IHXD[]A\A]A^A_f.H$HIE1H-EL-Q$HHH=RHtI9r+HHEHHHHR=R11eHHHE1/HH)L9{HIL9hH5YR=cRL)L`HuHL9;H,RLAB3 D\$D|$H HD$HE#EHDHD$ H IH,HL$@HT$8HHHD$uM~A?tLL HMvMuHL$ H|$(HL H$II)L0AUD$;LHPD$BPD$IPIHIjr,QH WPLL$H1=DD$PH@LH|$8E I\$\@c 8 L |1L,PHL!UH58P5{ 8 1ɺtHPH}L OPL1E1[]]D3 8l 1ɺoHPL OL1AUEA^A_ 80 L 1LmPH{PH5yPsIL H1D$H=OHL H1E1i~H SLL$L H1tAYAZUD$L D|$HHLLEHHD$01#ZYG 8;Iٺ6IH ^H{HEHH ^APLQPH1H D$L5I%L=HA&L9M>ILLHtSLAWLL$SLAVLL$S$LAWLL$ 8;Iٺ1IH ^H{HEHH APLQP> ff.AUATIUHGHWLH@ 1H5LkHE@ t%U82HE@t U<EU@RUDUHt1H5RLDLAT$ tiHIHL]A\A]^5fD1H5L_U8uXHEHnL@HzIHEIAT$ LuL1ɺi1H5[]1A\A]1H53L/uL1ɺH5f.1H5LL1ɺH5x1H5LLC1ɺH5s81H5Lo`L1ɺH53XL~1ɺH5 1@1H5LL~1ɺH51H5LL[~1ɺH5PL4~1ɺH5d)@1H5#L_ L}1ɺH5#HL}1ɺH5!ff.AWAVAUILATUHSHLHdH%(HD$1HL|$PLt$X荑 H4$HFIHFIHFHVHtZ1HtSH91HfH*HfH*^Y,ȅDAMHt$SPHcHHaw̫HHHHAܷ HD$dH+%(HD[]A\A]A^A_fDALi|11H5f.HуfHH H*XHHƒfHH H*XfDAWI1LAVAUIպATIUH-SHHH(dH%(HD$1HT$LL谏 hHt$CL9F HHoE1a@D5OH@LtIFPH8ukL#vLIH1E1mHt$L0 HD$dH+%(H(D[]A\A]A^A_f.HE1E11j1Ljj$+H mCLAD9H4@LH1E1HDKLHHD$Ld@ P1Ht$ _AXAL z1H1`D$ E1DHE KvHLhIEPH8u)LtLxIyHE1E11j1Ljj)H tHt$HF0B<0Du IM`D$ AD9{LaD$ A'I}P1H52=t)Ht$Ht$ALx1ɺ81H5:/AWAVIAUATUSHH(HH4$dH%(H$1HbL%T L^ LH HH0H@HD$HH<$L$x IH!Md$M$$I.@ HHfInI@Dh uE>L$ED$MMIpAfAAwՃA:@LHfED$AH<$I(M)虣 H`DfH LhH4vI>H4Lx HpINL0HHINHIFL}EHL}HEBDx uD}IH$EtnHfL8HfE(1ɀ}:AH$H<$LtL$E}DI녃|$M9M.Ll$M9u\ 'MmM9IEuIE1Im L=MuI9HEH|1IEH|$I :L HH9tAGtH@H9uA<suLLFuHH7HDIEP w4Ht$Ht*HF86HH5HpIEfM1LH5Y@IEHI9f.HP !#/H@I9HuMmM9}HD$-L ^A-A-MQ;Qt#I΃ 9BA9DGI9HHHH9uL9HrHAD!I9tHHL /M9 mHtHN / xLJL\@H=HxH=HxH HHMH<$LE1莮 H$dH+%(\ H(L[]A\A]A^A_f9FՃEI9HD$E1A1۾;D@A9t91ۃ HI9HHQAAutAt E9pEE1EAfDHD9?AA1i yHz }LRLfH<$b HD$HHD$HH0HHHL$ H5 DDL@t$CfEt$H.@IMH$H$1A-L MIH9 Hr I9p LJMPHJ1LJ1LH5 `Ld1 H5 7H<$1 i-A-A-H|$Ht$0foL$0foT$@fo\$PHD$`M<$)$)$H$HDŽ$DŽ$)L$pM9b1Al$1Dl$LMMDt$I\fC CHct$HH)HHH)H9HOHiҀQIאI$LI9IID$CvCу w$DI|$ 1IAOtitSIIڃIDH낍CvS n eH5^HcH>IQLDA-l$0D$|'HD$p0D$x 1MLH5l GMl$Dt$LDl$A)A*A#A-A!H|$pH)HD$ HD$(H$H|$ H$t Hl$ H|$(Ha$<H\$(Ll$ H<$LH$$ 1ILH  H H7H<$HXH IHC3$A$DfAD f.? HHHcLD1 H5 nL_&H-1E1HTLl113H7tDŽ$D$|.LRMHHJ1wH|$pD$p5H)HD$ H;HD$((Eك-JH|$pH)HD$ HD$(!H=HD$ H*HHHHH?HH)Ћ$)H@H$H)Ƌ$xHcH9~  $)%HHB8l$xHiŀQIHHBP 'IHiIHiŀ: Il$p)$sl$tjIbHHH)MLHsLHI  u]L S1ɺH5 ^HD[]A\A]1ɺE1LRH5 .HD[]A\A]Ã+HD[]A\A]j f.UtLJSHFH!Ga u/F=ArHD[]At@tHGHDL$Hxjg] _AXIL5{1H5 -HE1D[]LQ1H5 HE1D[]HGHDL$Hxj\ HHCDL$Hx$\ LH5 I1H,$EYE1^HGHDL$Hxj\ LIXZAWAVAUATUSHH(DG`AA9HGHx)D9H{DHGH@H@PHt HЅHHEDHo聚HHEDHYLHHD$I9H\$DMeID$@A$HHHH9HrI$ADH9oID$@HzHHnH9eHrI$ADH藙tM$I$I9uDM6I9I~ uID$@HHHH9HrI~ADH HID$@HHHH9HrI~ADHۘc1ɺD$LNH5pDL$fDMmL;l$dAH\$HHHD$H9uDLuADHmIvHI~pL[MIHD$I9Hl$IvHI|$ ADHIvHI|$$ADHIvHI|$PADH}mIvHADHlI$蚗IvHADHUI$dtAD$LE1t=DI$H@HHڋHAE9l$LwM$$L;d$Hl$HmH;l$fDAH(D[]A\A]A^A_LLj1H5uE1뾉D$LK1ɺH51KDL$@H5>@H5٫s@H5ɫZ@H5@DH1HH[L1H5IE1fD$L8K1ɺ;f1ɺD$L KH5mDL$D$LJ1ɺD$LJ1ɺEL^H5E1V1ɺD$LJH5hDL$)1ɺD$LWJH5;DL$IvHHzADHԔ1ɺD$LJH5iDL$HzIvHADHhHzI$IvHADHKH|HK1ɺD$LIH5cDL$$1ɺD$LRIH56DL$1ɺD$L%IH5 DL$1ɺ D$LHH5YDL$D$LH1ɺ1ɺD$LHH5DL$Y1ɺD$LHH5kDL$,1ɺD$LZHH5>DL$AVAUATIUSG`HGAH@@`tu(E$[]A\A]A^@AI$M$L9t1H{\HL9uA9sI$M$1L9tDH{O\HL9uH;1AAVLzH5LX1ZFL1L,H5[1]A\A]A^f1L5H5P1fHG`trHGH@@`tuHÅDA9vHW1L*H5QX1ZL1LHH51HfDy1LQH5X1<SHHH?dH%(HD$1u@{1Ht$)9CT$1HT$dH+%(H[8HL 6PH.FLدPH H5P1H kK8HL ePHLPH51AQJH 1:f.UHSHH HH@ Hu+eD8ukHH9t HcHLH@Ht<~LML1H5'1H[]@H[]@LML{fLMLH5J1fDAWAVIAUI1ATIUSHdH%(H$1H|$@D$$Hl$@HID$PH8řHT$$HHD$@ID$PH8ID$PLHHx*XHD$HIMD|$$H HD$H$IAVLT$ H)ID$PL$HD$DLHx@j4DڃH N L$LIH5\1 $1LT$AGL$HHhLTPL1LT$ LT$AN xAGHcD$4HLH|PAXAYJADH&1* A~7tAH D|$$McJD@I$I9$EHcD$$HL$H1L|$0L5HL@ID$PLH8E HHu0 HHt$HHHHI}u1HT$(LHuHD$(HH4ID$PIuHDL$HxjAVAUATUHSHHHHWPdH%(H$81L$@LL:HFXƄ$HDŽ$P$tHF@HH$CHL$L$DŽ$uEp$$H$H$%H$HH58H$ 1H<$HLH$H$(HDŽ$0DŽ$@DŽ$HH$H$#7H$IHo=Lc@HMHMXH$HL3eK\LCPH$$HHsH}PLOIHcH[@HH$8dH+%(&HHL[]A\A]A^A_f.H@ H@XH>1H$LЅ'H$LLH(fD5 uFjCd11HPDKhDC` ZYK\DHEH1L 1H5PK\H<$H4 LH! H4$L  uHEH1HLH$XPH$XLOH$HOHHL9HD¤JHLII9HDE111ʫ<1ɺ-E1L/5H5O萳LL$1LHLL$8 LL$kH}PLιLLL$hLL$HLHL!AL41ɺH5OD1ɺE1Lm4H5NβSfLL41ɺ 1H5NE1蜲!L41ɺ1H5Nof.H.LIH5FN1E1.fL31ɺ1H5Nf.Hx.L$IH5M1F@H@. L/IS1ɺ*E1L 3H5|MnfLH5LM>贻@ATUHdH%(H$1H8HHHH9sDH8/tH9rH9a1H1ʷAăt^86D6ubH$dH+%(HĨH]A\YfHH腵HD$%=@c/@۹8}HQIIHlH HDHAPLQPH5W1ůH :@s8謶}H5QIIHH ӺHDHAPLQPfDE.HES}IIHPHHDHH $ZAPH5VL-QP1H mH$dH+%(u,1HĨLH5V]A\鼮7ATIUHS轳LtGuCF1I,LH5%VY[]A\ t8t4}IIHOHHDHH M.APH5ULQP1H []A\ATI/UL%ՋLSLHH0dH%(H$(1聭Ut9H$(dH+%(H0[]A\H$HhuHڴuHD$H9$uH$H9$uHx褶8hԳ1LIP5Hx PL.1諬Y^3@[8蔳8I1PHOLPL.1kXZ߶ff.@AWAVL5aAUATL%&UHSHL=t$IM9uyeD1L1MLZTA ²AwIIİL輰HHIL9HMoHtHLuIIG|$HBH_EW1ML%LDT$ C|$ e8&(M1PHLPLQ-1XZ)fD諴8MO1LPVH6PL-1躪Y^H1[]A\A]A^A_H[]A\A]A^A_@AVAUATUSHDdH%(H$1ExjaI1H-؝1L>Hc;DL EHc&DEL51L-sL%J,HcA~HHP1HtHHIHuH$dH+%(HĐ[]A\A]A^f5LbHcu`1LaH81H5+L PHPL@+1Y^D5zL苲8įM1PL*1LAU表XZDu uH1ҿH5良ukHfD84HL PHL0PHxH5*P1H ff.AW11AVAUATUSH8dH%(H$(1Lt$L׮L=\HE1D$ IoL$LH)H${L1賮H $L<3H|s{L$H$aHHHPITHcsLD=2 DAHMcHH)I׉D uYHAu#M1PHuH5%PLJ&1^_W u ;蜪ED$D$,ҤD$DL$(LM1H5c; 11ɺL$H5W-1H$8dH+%(HH[]A\A]A^A_fHt$;贪HD$H9$HD$H9$21D $L%DT$H5%苢DT$D $DA>pM1PH+L$PH5j1CXZ@A>0A<$MIHCH{HDHH IxAPH5L QP1H 1DEDŨA<$MIHBCH{HDHH APH5LQP1u;H ثUHSHHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H3H$IH}HD$IHD$ H$D$0HD$/E1x"HHH9wHH9tH)HEAHHD$dH+%(u HD[]Ԫ@HUSH-.tdHo軥HH)fDHAu.t_t +uI:Hu=DH[]DGt <.uuH[]ø뺸UHSHHHϢtKH HH跢t3HLIMu!H[]fDIٹL1H52H1[]UH5H7t3H5HtH]H]fATIUHHHt"LH IHt7HL]A\@HHT${HT$tRHefHLIH5<1HL]A\fDHHT$ uHHE`HH!H9tH.H2:H/H8(H4HH%rCH&HH'HS@uHT$HHTHHHf.AWAVAUIATIULSHH(D}LH Lt$`LT$hLD$pDHHE0% HHE]PH@P9IAsA0EPHH9pH9eHL$HzHDD$H)HjDLD) YLH^I1ɺH5K1L$DLҾLb HHH1L1$IH9E1 u $fDL^ HHH51ɺ1L}H5L1ɺ1@1HuaHuLHFPLNHLփLChH(EL[HL]A\A]A^A_w1f1AfDLEHNLA@a HEHL$IHHE#LưLHHH51H4$ H4$f.L1ɺy1H5HיfLLD$LT$H$G H$LT$HLD$HLD$LT$H$HD$ÇHL$uLLD$LT$H$H efDL1ɺiH51H(1[]A\A]A^A_1LH5zL11|H5PߘDxE1 nDj0 $WLHL$諝HPIHHT$H8tF HL$HH+HT$L膦HL$HAp$tH59LhHL$H1A$Y41HQXA`DydHAhVfDLQ1oH5UI>A}HWtLHL$mE HL$HHǂHLHL$HT$C HT$HL$MH5L1ɺKyH54HApH51L yH5{H-h1HL+H11LbJH轖HLLHHmH}L@H5زIHEH@PH /11Ƀ@HEH@PH M1H5~LwH5aDUSHHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1Hl$ H$$D$0HD$Hl$'@ƒH$H2Ht.HUHHu$/vHT$H2HBHD$HuHD$dH+%(u HH[]mff.fATI1UHHHt>H_HHtYHxL-A1Eu EH]A\fE1L1ɺ8H5}[H1]A\ÐH1]A\fDUSHt[HoƙHHBu6.t1_t,Cըt%/t =t!t:t&t #u]HuH[]1@ATSHH=mtAHD[A\f.H=E1Hu'H0HH_IHt7H?L5uH=E1H|L%%1ALL#L1L"KْL)1"H5µ謒AU1ATIH=USH1H茙HLlj赕H9u(AHD[]A\A]DL-88%HL mPHp|LPHmkL~P1H 莓AątL1L^1ɺ~E1跑HD[]A\A]f[E18葘HL ٴPHL}wPHjH5jP1QH DH[]A\A]1L1ɺH5-HD[]A\A]f>AULuATD ǗL%Eo`ULHPPuPRP1誐5DH uƑLt ]A\A]DHL H_MV91B 1L1L JtVl1H6H~[]LLnA\1ɺ4A]ƏfD1ҾH\ u=L-u#Hh"H LL 1L1xN8NL 1LPH|+P1L!XZf.˅fDH PLʦ]LL i0A\L1A]G鴎]LL8A\&1A]鏎ff.@UHx1ҾlHH H1ҾHlH1ҾHH Hk]Sff.ATUS蹗11H觑ÃtD%D9V[]A\f}t贔L1PH?L +/PH5k1胍_AX[]A\11Dܓu8HAٹATH5kL=Y^[]A\fD}(HE1P1LH5vkXZ[]A\ATIUSuHH5~LYtEM1LwH5k螌u[#]A\H0HHHH9t$@HxUH0HHHH9uM1LҤH5jОHdfS%11Zu6AٹLǤH58j[Dk8褒HA1P1LH5i{XZWf.fATLIUH-ikSHHD dH%(HD$^P?PĝPP1H t tHD$dH+%(H[]A\H)H$L "HtMu8HL-HP<1{A[[@11LBHKA$upHLu1ɺEHL DjEtet uH=I܎_GH1L fLӡ詉=EufH=腎L%H$HI9a葏HLH9vnHHMSL1ɺO12^_&81ɺJHPHڻL aPLF 1AXAYXHT1SMLHZY5DHCtO t HfDHwAWAVAUATUSHH $HH $H8H<$HHHT$dH%(H$( 1D$HtH HD$ E1E1Hl$ A L-!@AAFH IHtIcL1LH)H yL%I11L_GL脇?ŃKHt$11҉茐A9D$AApHD$AHt fDH$( dH+%(H8 D[]A\A]A^A_@H<$-t tgDEtkH D$ HHl$ [E18葍HALPL71\i_AXI[f蛪fHD$L HH1LRLi1 Y^@<1E1LzH5Sم@LL1E1b譅[E18葌HL 'PHOJLPLq1AQ[H :H1LBLRk-XZ衏H<$1ҾrqQ躶 eH;H芇赎8HL LIHj&H?^A9HARHDAPLpSVP1褄}H 蘈AUATUSHHdH%(HD$81HD$HD$HD$ HD$(D$0D$ u#HD$8dH+%(HH[]A\A]@H="{HHHHD襍HH1݊Aău=DMAL-pL1L萃XE1ҾZDt}L-O1LIPWHPLz1&Y^oL-FL1@LH|$w/|L1L /Hl$ L2賂HIHvPH_&L#PH )H>H5HD$(PH|$81H H|$1HT$ H5DL$ ETHH|$H|$DMAAoDL-*蠃}WI1PHLPL 1跁XZALL1x荁UH5HuMH5Hu:HL#1Lt$0L %0_AXHL L1t$0LإAYAZL1LҜALL1蕀NL-1LQLiDhlϊf.DHHBHI`@( H%scH3sDH `HJHJ t"L"1ɺ 1H5taHDH HJHJ tH M!HJHJ tff.HH׃Au5HHHHDH HHDHG HWHHeHHKH5>HDH1HDj HfDHH׃Au5HHHHDH m H1HDHG HWHHնHHH5HDHHD@j HfDHH%Au;HHiHrHDH H/HDHG HWfDHH=HH#H5HDH HDi Hff.HH_Hq@HH _H9u<@HH9t0H;puHõH5AuB=i HHH5AtH5i i HfH5Sh Hf.HA`H׃Au8HHH'HDH HHDHG HWHHHH۴H5δHDHHD`h HfDHA`H׃Au8HHHHDH H.HDHG HWHHeHHKH5>HDH1HDg HfDHA`H׃Au8HHHHEH pHEHEHG HWHHճHHH5HEHHE@g HfDHHAHHAH91fDHPHHHH9uEu;H:H#HEH5H7[HEf HfDHHHEH5ղHвHEmf HHH56EtH5@HA`H%Au6HH|HHDH H{HDHG HWÐHHUHH;H5.HDH!HDe HfDHHHA`AH rĀtz%u9HHױHHDH5IH{HDUe HHHHHDH5HHDe HfH5H`tH5ODHA`HHAu4H+H4HDH HHDHG HWHHHH5߰HDHҰHDqd HHA`H%@Au6HHHHDH H^HDHG HWÐHHuHH[H5NHDHAHDc HfDHA`H%Au6HH HHDH ~HHDHG HWÐHHHH˯H5HDHHDPc HfDAH׃yHt(HiHBHHB @HHQPRu:HAHJHDH5(HHDb HDHHHEH5HHEb HH=HBHޮHB ff.AH׃yHt(HyHBHHB @HHQPRu;HRH[HDH5FHHDa HfDH'HHEH5HHEa HHMHBHHB ff.AH׋QuGu#HHGHHG HHGHHG @HQu5H\HEHEH5HHE` HÅHH HDH5HHD` Hff.AH׋QuGu#HHGHɬHG HHGHHG @HQ(u5H|HeHEH5HjHE_ HÅH7H@HDH5HHD_ Hff.AH׋QuGu#H̫HGHHG H%HGHƫHG @HQ,u5HHHEH5HHE _ HÅHWH`HDH5?H6HD^ Hff.AUATUHSHHL)LxH}L`L Ht,LLHHCHC H[]A\A]fD1LYH5{TH1[]A\A]ff.AUIHATUHSHHawI}L`L1 Ht,LHHNHCHC H[]A\A]fD1LbYH5xSH1[]A\A]ff.AUATUHSHHHHt HHtH9uOL-PSLvH}L`Lx Ht3LLHHCHC H[]A\A]DLjf1LYH5SH1[]A\A]ff.AUATUSHHyHuHAPLMuYHvAHCHC HC@( t"L1ɺ 1H55RHD[]A\A]f.HLuH}LhLe Ht0LLHA|~HCHC HD[]A\A]fDY1E1LH5RkAUIATUSHHHAH@ toHBfHPHtWHtI}L`L HLHHA}HCHC HD[]A\A]@uHAHCHC HC@( t1Ls1ɺ H5ǎ*QHD[]A\A]@@AHHtHH9t$fY1E1LJH5eP>AUATUSHHHAXHtVLhHLsH}L`L H~LLHA|HCHC HD[]A\A]@HAHBHB HB@( t1LX1ɺ H5PHD[]A\A]ÐY1E1LZH5uOqAUATUHSHHL MtHLrL`H}L HtCLLH{HCHC H[]A\A]DAL-f1LYH5Ȍ+OH1[]A\A]ff.AUATUSHHHAHt H@HuUHAHCHC HC@( t"L1ɺ 1H5INHD[]A\A]fDLh(HLqH}L`Ly Ht4LLHAzHCHC HD[]A\A]f.Y1E1LH5NgAUATUSHHHAHt H@HuUH AHCHC HC@( t"L1ɺ 1H5IMHD[]A\A]fDLh(HLpH}L`Ly Ht4LLHAyHCHC HD[]A\A]f.Y1E1LH5MgAUATUHSHHHAH@ tgHBfLAL-o uWH}L HLLHxHCHC H[]A\A]@@uAL- @A L-{tA L-{x1E1UoL`e@@AHHH9tHt$f1LbYH5xKH1[]A\A]fDA L-{fDAUATIUSHHHHt}uJAH-! I<$Lq Ht[]A\A&tMtLfLHAPH@hHMII HHwYLHE@ HL81H5D;#\}HAPDH4AwJAAA H-YAE1H ; HAHEOd$HnfDL1H5:[1L. 1ɺ H5w[1@MLLmfDATHSHHHHtu]Hq HtaHCAHC HC@( t"L01ɺ 1H5z<HD[A\f.HHHq sHu1ɺ E1LK H5vZHD[A\ÐSHHqHHHtHƨHtDHCHC HC@( t"L{1ɺ 1H5y0<[fL 1ɺ0H5_vZ1[ff.fAUATUHSHHLMtxL^HL`L HtyLLHAgHCHC HC@( t"L1ɺ 1H5 yl;HD[]A\A]fDAHL-L@ Hu1 E1L}H5wu$YHD[]A\A]fDHHH@8  } ff.fHHHP8T @HHIGA$? @ATE1IHUHH11H-Ht(HHLH]E1H cA\> f1L 1ɺVH5t/XH1]A\DATE1IHUHHչ1HHt%HHLH]E1H |cA\V> fD1LZ 1ɺcH5tWH1]A\DATE1IHUHH1ɺH*Ht%HHLH]E1H NA\= fD1L 1ɺpH5s/WH1]A\DATIԺUHHHSHAL1H@PHDAAHtHGL[HH]E1A\A= 1LJ 1ɺ}H5rV[1]A\ATIԺUHHHSHALùH@PHDAAHt"HGL[HH]E1A\< fD1L 1ɺH5ZrV[1]A\AUATISHZH;LhL Ht8LLHcHsH;H9AątDA[DA\A]D1E1L' 1ɺH5q|UD[A\A]1L 1ɺH5qOUD[A\A]fDAWAVAUIATIUHSHH8LD$dH%(HD$(HAH@H$< @HXHHHX IHH@Lt$HHl$H-HD$Ht!HM1HH[HuHD$E1LLLHG: HT$(dH+%(mH8[]A\A]A^A_f.HBf5@,HHtHH9f.HD$HT$E1LLHT$HGHT$G: efH IHGH@E1H&Fn @>OHHHHw1ILZbLk1ɺ1H52RHD$(dH+%(HD$LLLE1HGH8[]A\A]A^A_"9 f<1҉ILH=dYA1ILH=8fYHH@HHDETHHH9LHCz-DIUPu)CMHE`fIMPQ8CFHE`foAH OfL1!H5]<:1Lƻ 1ɺH5nV:1@ H蚟yHiCrHE`HxCDHE`HEcHťuHE`rHHqHmHY PHst H$6)HHHrH~5HH9uH<҃ⷃv@1fDHHLtkIUPBɸ¸뻸IUPH:CEHE`HE`H rJH)s+CwHE`C--5Q0}H:qCRHE`dHt$HtH|$t CmHE`>Ht$ Ht|H|$ H5tlBugCsHE` IEP@A}CSIEP@8A} CCIEPuHHH9MrLHH@HHHLVHRHH)fHH9HPBgt9A}tCMCI^ACmuI1/LH< MH?thHHH9t/HPHtLzMtHRXHt AGbtH9t8HH9uLMHLm1H5T36ItL(HHPH{HHH9EH<pLIkHI~L;yID9wLJHuHAwHLl1H55XZ^I$sVAtHOHH6HH9&H@0%HSdA@mDM_vAMI%t=I&T-AI"r9lAHHtI$skt4oHRH]BiH蓠u-H=i8 SsViHHt$ HT$l|HT$HD$ 1LjH5F 0uH1AwHrHAV3HD$@H B<0A:LJHuHAwHLiMOHL}iQuHPE1LiuHH5lAwHrHD3H IfDAWAVIAUIATMUHSHHHHH@LxHL7LL`L HHL1H 4L JH MHLH1hY L5fL7LL`LX HLLHq@HLH H[]A\A]A^A_HpulL{HLA$ t^L7LL`L HHusL1H5N1H1[]A\A]A^A_fDHSHH}HL[]A\A]A^A_2 fLNe DL1H2L H AUHATIUHSHHHH H}@AH9ufHH9txH;zuL HL1H5G01LR 1ɺH5L0H1[]A\A]f.Ls HtaHH҃ⵃxPHH҃mPHCHC HC@( tI1L8d1ɺ H5OH[]A\A]1@fPduDH[]A\A]E-uOшAfUHHSLH(u?HgHwgHHDH5HHD H[]DHOgH8gHHDH5$gHgHD H[]fDu'HfHEHgHE H[]DH=HEHfHE dff.fATHIUHSu HlH1HfCCHE`%HwHE`HೃzCHE`HൃxCHH9O1DHPHHHH9uགྷpCEP*(&$-ScEatVCID$I\$I\$ @( u[]A\@1La1ɺ H5L6[]A\@H-Htb-຃sDL 1H5tg,1Lv 1ɺH5I,[1]A\@-1@HHTݸָϸUHSLHHHt4,t+HddH5`u4H H[]H)dH5tH5 dH5dUHSLHz tFHAPHHt ,u-HcuuHH57N H[]fu'HcHEHcHE H[]DHHEHvcHE H[]fDHH56c H[]ff.fHHH9t(fLHAAt LMuYHH9uH^HBHB HB@( t@H1L^1ɺ H5J HLHfSHHHH9t#HfHPBt HHuHH9uHfH 跲HtBHCHC HC@( t"L^1ɺ 1H5kI [1LZ 1ɺ0H5F)1[ff.HA`H-rH%s2HHH9t&Ht!HHHHt-D@uHHBHB HB@( t8H1LK]1ɺ H5H Hf.SHA`HHH-rH%ssHHH9tgHtbHHpHtRH BHtMHCHC HC@( t"L\1ɺ 1H5GY [f@uHLܩ 1ɺ0H5D1(1[ff.fHA`H%rH-s*HHH9tHtHHtHmHBHB HB@( t7H1L[1ɺ H5.G Hf.SHA`HHH%rH-ssHHH9t`Ht[HHtOH ֯HtQHCHC HC@( t"L8[1ɺ 1H5F[fDH}Ll 1ɺ0H5C&1[ff.fHA`H$rqH0rj HHBHB HB@( H1LzZ1ɺ H5E1HHHH9N"HD[A\AUIATIUHHSLH莵HHtHILL[H]A\A]HID$ID$ ID$@( t LU H5KA1H[]A\A]ff.ATHHSHHHtJHCAHC HC@( t"LU1ɺ 1H5@8HD[A\D1ɺE1L H5d=!HD[A\ff.ATHSHHHQPHqHT HtMHCAHC HC@( t"LT1ɺ 1H50@HD[A\1ɺE1L H5<n HD[A\AUIATIUHHSLHHHtAdt1HHt4HILL[H]A\A]fuHHXH}ID$ID$ ID$@( t LS H5C?1H[]A\A]@UHHSHHHHtAdtk6HHp HHt\HCHC HC@( uH[]fDLQS1ɺ 1H5>@uH@XL 1ɺ0H5/;H1[]H]h@AWHAVAUAATUHSDHdH%(H$1҅t]HPhHtTD:LrI9tHHLD% HH`Et[uVDADLHrAąAH$dH+%(CHĘD[]A\A]A^A_DHAąuLm 1ɺ1H5:fDHHH`AHH$szHHH9m4LrXMLME6HR`H$LԞ 1ɺ1H5z9'fuLrXDH$^L| 1ɺ 1H5"9E1B'fAWIAVAUAATUSHHxDD$ dH%(HD$h1DLzpHjpL93Dl$ Lt$ A6fEu90HPHDD$ AąM?I9IGuHHL@q# HHHAąIG@AHHHL$LpH9t{HD$ HHD$fDM~pMtMH|$L1Ҿ@" HHHwDD$ DLHIFxLpH9D$uAHD$hdH+%(sHxD[]A\A]A^A_@HHD$ LHD$I9ufDHmL9HELPABdtIIH91L9xXt L9uH|$L1Ҿ@LT$! LT$HHCHLT$oLT$ODD$ 1DLH]1ɺ}E1L› H5q6#fDEIMI9D|$ Lt$ AHmL9HEtEt1HHL@! HHHHE0HPHDD$ u1ɺE1L H55ULܚ 1ɺb1H55/f.L 1ɺ]H5T51E1L| 1ɺ_1H5"5f.LL 1ɺj1H54`f.1ɺlE1L H54n/f1ɺnE1Lݙ H54>Lř 1ɺy1H5k41ɺ{E1L H5?4Lx 1ɺ1H54LR 1ɺ."ff.AVAUMATIUHHSHH dH%(HD$1H4$S HH@HHD$HHtulH1EH1AA^AƅtWIGE1LHHT$}AHD$dH+%(H D[]A\A]A^fDHPDHt$H<$ L> 11+H52LXO E1H5.OcL 11"H52HD$9: ff.@AVAUMATIUHHSHH dH%(HD$1H4$ HH@HHD$HHtulH1EHAAAƅtTIGE1LHHT$AHD$dH+%(H D[]A\A]A^HPDHt$H<$ L 11EH5d1LM E1H5MLo 11<H51HD$=/ff.@AVAUMATIUHHSHH dH%(HD$1H4$S HH@HHD$HHtulH1EH1AA^AƅtWIGE1LHHT$}AHD$dH+%(H D[]A\A]A^fDHPDHt$H<$ L> 11H5/LXL E1H5.LcL 11H5/HD$9:ff.@AVAUMATIUHHSHH dH%(HD$1H4$ HH@HHD$HHtulH1EHAAAƅtTIGE1LHHT$AHD$dH+%(H D[]A\A]A^HPDHt$H<$ L 11H5d.LJ E1H5JLo 11H5.HD$=/ff.@AUATIHHUSH1HHtJHHI<$LhLO HtzLHHAfHCHC HD[]A\A]HAHCHC HC@( t1L(E1ɺ H5|0HD[]A\A]ÐY1E1L*EH5E0uAUATIHHUSHӺHHtWHHI<$LhL\ HLHHAoHCHC HD[]A\A]fHAHCHC HC@( t1L(D1ɺ H5|/HD[]A\A]ÐY1E1L*DH5E/lAWAVAUATIUHSHHAA$IxjEHMs ZY8HI]HLxL. IHLLHDH HHHfH*LLH[]A\A]A^A_fD1LZ 1ɺ, H5+H1[]A\A]A^A_fDLVB/ 1H5*tH1[]A\A]A^A_L4 DH؃fHH H*X1f.HLDIpdH%(HD$HL9t HtAdt8HAPHዀIH$HT$dH+%(u-HfDPLDX(Av H@D+PMM) ff.HdH%(HD$HAH@`@u; u4HHBHjEHB HT$dH+%(u)H@yHuHAXHH@HH$R{ff.HdH%(HD$1HHH$ HT$dH+%(uH"fHdH%(HD$HAI H@PHHH$HT$dH+%(uHff.@HdH%(HD$HAI$H@PHHH$YHT$dH+%(uHoff.@HIdH%(HD$1HHPHHtBdtlHPHJ t/HBfu*Hu%HH1H9ufDHtHTH $LHHT$dH+%(uHÐuITff.HIHq`dH%(HD$HHtgH$s0HHt[HH9tOHHtCH@hfDDEulH@H@hH$Ht$HL2fDH$ru_H HBH}BHB HT$dH+%(u=HH$s!HHH9tHMDHAhkfHDdH%(HD$1EtHHH$ HT$dH+%(uH6fDHDdH%(HD$HtIHH$HT$dH+%(uHfDHdH%(HD$1HHH$lHT$dH+%(uHfAWMAVIAUIATUSH(Hi H|$dH%(HD$1HtGH]HH9t:IHCH@PHt HI9LGHH9uIu fE1H|$LHL$MLLd$HT$dH+%(uH([]A\A]A^A_ff.AWMAVIAUIATUSH(H|$dH%(HD$HA H}HXHhH9tpIHCH@XHt HI9LGHH9uItAH|$LHL$MLLd$HT$dH+%(uH([]A\A]A^A_DE1ff.AWMAVIAUIATUSH(H|$dH%(HD$HAHXHhH9tyIf.HCH@XHt HI9LGHH9uItAH|$LHL$MLLd$HT$dH+%(uH([]A\A]A^A_DE1ff.AWMAVIAUIATUHSH(HIH|$HYdH%(HD$1HAH9t|IDHCH@PHtHHMI9LGHHAH9uItAH|$LHL$MLLd$DHT$dH+%(uH([]A\A]A^A_DE1FfDAWIAVAUATIUHSHAA$AIxjEMH耒 ZY8tyHIn HLxL? IHLLHUH HHfLLH*H[]A\A]A^A_1Lz 1ɺ H5"!H1[]A\A]A^A_fDLv8 1H5 H1[]A\A]A^A_L  ff.fyxtHxDHܢHBHN<HB ff.AIхtH0IfLc H֋b fH֋Q Q H֋QLA IҋQLIrv0HfH@@gtttH@Hǃ8tHA+PA@ t 1ADLLп H֋uH̤HFHU;HF 雿 ff.HAHIPu+u H}HFH;HF @DYLEtHAKE1H IHLfDHH9tG8uHxLHI9}Iyu AvHAH9uDEt E9<L H֋Q$鱾 HAH@uHHBH5:HB u DLIH1IAIIH9tfDHH9uIA(MA(I9t1fDHI9u ff.LAH1I@II9tfDH HI9u׽ H֋du At鰽 H 5HFHF9HF @HHH1H9t%@L@HMAIH9uJ f.HA HHtPx( H-HBH8HB @AVIAUIATE1UHSHH9t H{藖HAH9u[D]LA\LA]A^颼 fHLH1I9t@HI9up HHH1H9u 2fHH9t(L@ItA@duHAH9u ff.HH#A`HtHHH9jPM 89r~f1L) H5<1hAMALL=ff.AUIATIHUHHdH%(HD$1H$ZtuEbuXLL0 (fDHHtH$HtԋP LL HT$dH+%(u1H]A\A]@HH1H9HDHH$AUIATIUHSHHY`dH%(HD$1H$H r:HID$H)ID$ HT$dH+%(ulH[]A\A]fHHstHEPH H8sHHkttH$LL fDHAPHHH8 uH]``ff.AUIATIUHHSLHdH%(HD$HA`H0rjH%rH-s<HILLHH$OHT$dH+%(u\H[]A\A]@HmID$H'ID$ HHH9HBfnwff.AUIATUHSHHHHt0uoHHCP1HH8_IHtoH HHtZHHtu8HHLLH[]A\A]H@HPXfDH@H@XfD1LB& H5 H1[]A\A]AUIATI1USHHHHt8ueHCP1LH8tHHtlL/ HHtWH1Ht0u3H HLH[]A\A]DH@HP`fDH@HH`fD1LZ% H5 H1[]A\A]ff.@AUH'ATUSHHLaPMtnHy@HHt EuQLqHLhLB HtuLLH_HCHC HC@( u.H[]A\A]DHtMHCHC HC@( tL!1ɺ 1H5j 1L H5 H1[]A\A]AUH'ATUSHHLaXMtnHy@HHt DuQLqHLhLB HtuLLH_HCHC HC@( u.H[]A\A]DHtLHCHC HC@( tL 1ɺ 1H5j 1L(H5H1[]A\A]AVIAUIATUHHLSLH dH%(HD$1HL$HT$/tCHGE1LHHT$AHD$dH+%(uTH D[]A\A]A^fDAIFPHzL"LAvH1H5,XZUDAVIAUIATUHHLSLH dH%(HD$1HL$HT$_tCHGE1LHHT$AHD$dH+%(uTH D[]A\A]A^fDAIFPHL "LAvH1H5\XZDAVAUATMUHSH`5dH%(HD$X1D$ D$HHQOD$ uQA$H!H5 H4HD$XdH+%(H`[]A\A]A^fDLsPMML|ID$ ,LT  :H`H#C`&Ll$H{ @L(ntrHsHLL$LLH LD$ B tpD$ A$H H5q fA$uHn H5NLi 1ɺ2 H5#A$uMH HEH+ HE vf.A$GHH5BfDH=HEHHE )DD$ A$<*f.HHAQuSu/HHHiHGHW H9ttHf.HHGH6HG HËQuqHHHEH5rHHE~H@HG@( tL1ɺ 1H5![HHHDH5wHnHD HHAHHPHAuTu0HH:HGHW H9HHeHGHHG HËHHHEH5H3HEFH@HHHH9HAHP&fDHG@( ILc1ɺ 1H5"H6HHDH5 HHDHf.HHQHHR`H%s yHH0s xHAu"HHHGHW H9t'ÐHHGHHG @HG@( tH1Li1ɺ H5 HfDHAPHELp8@ fH@PLH"@ ff.@HHH#A`Au9HHHHDH )HHDHG HW@HHHHsH5fHDHYHDHff.HA`H׃Au8HHH'HEH HeHEHG HWHHHHH5HEHHE`HfDAHHHt*t$HH uBHOHW @HaH ރH5KtHH@H5+ff.@HAHH@H)rzH*r#HHGH HG HXAukHHHDH5H-HD@HfDHH@HHH9HAH@XfHWH`HEH5=H8HEHff.HAHH@H)rzH*r#HHGH HG HYAukHHHDH5H-HD@HfDHH@HHH9HAH@XfHWH`HEH5=H8HEHff.HAHH@H)rzH*r#HHGH HG HZAukHHHDH5H-HD@HfDHH@HHH9HAH@XfHWH`HEH5=H8HEHff.HAHH@H)rzH*r#HHGH HG H[AukHHHDH5H-HD@HfDHH@HHH9HAH@XfHWH`HEH5=H8HEHff.HHHHDf.HGH@HGHGHG(HGHG HHFuG3u'HWHB HtHHt HB(HLHtHGH@(fDF$G$FPGPf.H(dH%(HD$dtbztTzHT$dH+%(u:H(HL$ LL$'zLD$H5  zHdH%(HD$HAH@H)r[H*s4(HH H$nHT$dH+%(u\HfH}HBHHB HH@HHH9;HAH@w-ff.fHdH%(HD$HAH@H)r[H*s40HH H$HT$dH+%(u\HfH|HBHVHB HH@HHH9HAH@wmff.fHdH%(HD$HAH@H)r[H*s44HH H$HT$dH+%(u\HfH |HBHHB HH@HHH9HAH@wff.fHAH@H)r=H*r&H{HBHHB f.H$@HH@HHH9IHAH@DHAH@H)r=H*r&H{HBHHB f.H`@HH@HHH9HAH@DAVIAUATUSHHHidH%(HD$1HE`HHH0QHHAPAL%<DI>Lu HDAAHCHC HT$dH+%(H[]A\A]A^¹AL%tH=tHAL%\XHE`H AH)A L%N1AI>L%DyL蘅 H#1L YH5j1#I$HxHHKT,JT(HH)I)D1ɉ΃M4L79r@AL%I~fDtyAH6HAPAL%'H8B DA $[ALfLKAL%'xH%AHuUHQPAL%:B8A L%B0AL%^f ^fDHwHCHC HC@( t"L 1ɺ 1H5jͷAL%e +fDA $ALL?@HH}H<$AL% yHHuHAPHP0馏 fDHvHBHV HB @yHHuHAPHP f fDHvHBH HB @yHHuHAPHP(& fDHMvHBH HB @yHHuHAPHP8 fDH vHBH HB @yHHuHAPHP@馎 fDHuHBHV HB @yHHuHAPHPHf fDHuHBH HB @yHHuHAPHPP& fDHMuHBH HB @yHHuHAPHP fDH uHBH HB @yHHuHAPHP馍 fDHtHBHV HB @yHHuHAPHPf fDHtHBH HB @yHHuHAPH' HMtHBH HB @HAHH@H)r:H*s, HsHFH HF @HH@HHH9HAH@DHAHH@H)r:H*s<x H}sHFH HF @HH@HHH9gHAH@DHAHH@H)r:H*s@ HrHFH HF @HH@HHH9HAH@DHAHH@H)r:H*sDx H}rHFH HF @HH@HHH9{HAH@DHAHH@H)r:H*sH HqHFHHF @HH@HHH9HAH@DHAHH@H)r:H*sLx H}qHFHHF @HH@HHH9HAH@DHAHH@H)r:H*sP HpHFHHF @HH@HHH9HAH@DHAHH@H)r:H*sTx H}pHFHHF @HH@HHH9HAH@DHAHH@H)r:H*s8 HoHFHHF @HH@HHH9-HAH@DAUATIUSHHHAH@H)9H*rRHoAHCHC HC@( t"L1ɺ 1H5>HD[]A\A]D\Aw}EH-^HlAHDI<$LV{ HDAANtMMHCAHC HD[]A\A]A H-AtL1ɺ[1H5hAH-jkXf.HH@HHH9HAH@fY1E1LH5XHUHxHHJT-JT(HH)H)D1ɉ΃LD5L79rAH-fDMLLLfLUH-1ɺDHLK1HLt]1ɺ1fHH5Hff.@AW1AVAUATUSH(_L;^LuvN8II9O8uhtsLL@1I=DIHǃ?u9HMDAwPHOI9Hu"Ap;wuHL9t!A<tf1H([]A\A]A^A_III1HL$IHD$HT$H9fHH9D$uH;l$ HD$1HH9u19uHL$H9L$tTHD$L`HD$H9YI@MmL9CIuLuHD$HHD$H9D$uAF$AG$AFPAGPtZH[I1HHH9t6<uILDH|HDOEHLHIxLH9uH([]A\A]A^A_H;l$1fDHH5Hff.@AWAVAUATUHSHH5-HHhdH%(HD$X1HT$toLd$ L-11fLL)D$0)D$ )D$@H\$8ybfH)D$0)D$ H\$8)D$@1LLFbHt7H@ Ht.8GML11-H5HEL NO HPHHCHtLHLt R3@L-1LLaHLHX D$ IHL=Cf11LL)D$0)D$ )D$@H\$8fafH11LL)D$0)D$ H\$8)D$@6aHt7H@ Ht.8ML11-H5 HEL >N HPHHCHtLHL RF@AL 1-H5rHD$XdH+%( HhD[]A\A]A^A_HEL M HPHHCHtLHL RCH51E1IZYDHEL dM HPHHCHtLHLr R@DLhA}1 LLH1H\$8_HuRD$ DHEL L HPHHCHtLHL R<+f.HEL L HPHHCHtLHL R9f.LxHEA?H$H$LL`PLpHLpMLLoH LhMD$LmXLLupETyILA[uIM`H}D$ HO`uJIHExIHUxIAHIHIHEHM0IM`I@u}Hg`H$HSHHHH ZLAYI1ɺ.L1葱,@H1L%S蓆_ff.UH-6SHHHGwTH@PHDL$Hxj!> 1HILX1Z*L tCL t7L I t+LN1H5衰L ,1LV1H}HCE1HHH9tHAH9u1H1-L7L11H/LH0H0L LEL11ݯHH1[LX31]麯f.UHSHHHdH%(HD$81LtHW8H5dHVf11HHK)D$)$H\$)D$ %IHt@L@ Mt7EP1HsuLEPHD$8dH+%(HHH1L[]a HEL $6 HPHHCHtLHLRT1H5輮XZHD$8dH+%(u=HH1[]ÐHEL 5 HPHHCHtLHLrRNAWIH5ZAVAUATUSHHHLHPH1HH5KLH@HPH1AąHH5L1ѪAą&sTHL1H/AąDAAHAtAHE HHDH5L1\AąDAALHI91L-cA~uLAW AąLL1թAą|AG(fo }WfAnG(f89fA~G(AF/IFH5LHPH1膩Aą5AG(PAW(xH5fdL1WAą$M6I98A)L- 1ɺ1H5 HD[]A\A]A^A_DAL- 11H5ИfLYH51E1蹫L<- 1ɺ1H5{菫kf.GAVH5L1RAąL, 1ɺ1H5"6IF@dLHH1E1LH5ޗfL|, 1ɺ1H5Ϫf.Lif.1҃H5L1wAąDL, 1ɺ1H5G[7L+ 1ɺ1H5!51E1L2H5 @L @lH5{JީAG(YL\+ 1ɺ1H5诩f.H5L1Aą>L+ 1ɺ1H5Oc?L* 1ɺ1H5)=L* 1ɺ1H5L* 1ɺ1H5ݕff.ATIHUHH51HOLHHEڣA|$Lv!At$81HxHHHU tHLHH]A\fDL) 1ɺiH5H1H1]A\L) 1ɺaH5H1]A\L|) 1ɺeH5ѧff.@AWAVAUATUHSHH5cHHdH%(HD$x1Ld$8HD$0LD$(D$$EOL}Ll$8IPL8RHLpMLH5HOAŅ LmLd$8I}PLQHHpHH"BAŅLH@AŅqHH5 HMAŅ(HUTH5 H-MAŅrLd$@L- 11fLL)D$P)D$@H\$X)D$`/@HvHt$0HPHf.L< 1ɺ1H5{菗$f.L  1ɺ1H5K_աDAWHAVMAUATUHSHLH(HT$L|$`Ll$hdH%(HD$1Z HL$At8HIAHD$dH+%(4H(D[]A\A]A^A_MIHHH9IFrT1H@hHDHHHIH9H1HtRL9H`fH*MnfI*^Yi{,u=D‰MeDAL 11pH5ȂܕHH}H$LjD" H}HD$HD$ $L$H0Dm" I~HXZLT$1H5#I1yARLU#HL$ L!^_HAIEDHЃfHH H*XfLLfHH H*Xzff.@AWAVAUIATIUSH(D -3dH%(HD$1EMt =2t7!A$2HT$dH+%(H([]A\A]A^A_LT H*Lh H-ML5 DM}A?MmMA}tL o1ɺ1LL肓HL$LL$ /2LD$H53v2HGL5HfD;D$r u0C;D$w&C 1HH9CfHLŕ1LSL 1ǒ_AXfH- m1H L-j L5uщ fHH9<CtuAU1ɺLS1L )LE@X^0 .H/ fHLu C HH9u?t@sHօtZf.1ff.fAWAVAUATUSHH-HsdH%(HD$81L$XIHHt$4ILL7LMGDt$4AusTaFV1LLIHH1LHpHD$HHCHPXHHPHuH9n1WcHD$D[T1DD$HHD$ATA oHEٹDh L•H5y1>rAYAZL 1ɺFf.L 1ɺH5|1E1 HD$8dH+%(Q HHD[]A\A]A^A_fDHAI}A$jME A[[IL+$H5q|1E1耏o2sTH$1HH(\(IHHHHHT$DHEٹ>hLKfDH$ LD\$ VD\$ HIA}I<$&HwH0LLT$(D\$ :D\$ LT$(/AI0LHI9E1H\$ LMHl$(LEfDHkHvILY1LH5vpHCI0HH)HCHHH9uH\$ Hl$(EMHD$I<$8L|$LT$(D\$ Lr;LT$(D\$ HHI8Mb1LRH53vmo.HQXH L *IH5z1-d)HcLaH5y1E1@HHx` 0LI!LD\$ HD$(N:LT$(D\$ HHI0MM1LH5uIn @L 1ɺJ1H5tnfHwI8LLT$ D\$38D\$LT$ u%L 1ɺgH5tmI0HL$ǀI8ǀ1HADŽ$A$HD$IXI`D$EhApIHIPIHAAuCTPE1 LASHǀtDxDHCH@`H3At6)L>H5wPu)1ɺZ1蕊DE EPLHI99L5LwAGt!0L)zCfIGHHH9@LjXH@HMHkLPL F1LIIEZYL90IGHHH91LRM?I9$H9tML1LLh^HLHQVRAŅrA!DEOs1LLAWAw1LRPLv 1LAźẅ}'LH5uPa'1ɺT1} LsPHHǀtbf.Až LA}LoLL1AHT$h LLH$HL8DH&HHHH9ǸHD2HCHH@hH9Ghs7fFH|$Ht$H(D$@HLHfHHj LLHH)I>}LghLL0AD$4L@u=ML$L1H5mSfADŽ$AHD$dH+%(H(D[]A\A]A^A_@H1IH=I1LH5leLp 1ɺFH5p1ÃE1qHH-Xl1EhHLteYL ^1ɺH1Te{LHHL17DT$H5p+DT$I@+L3LHHH5o1E1@Lt 1ɺH5ykdH0LLHHfD$L( 11KH5go{DT$'L 1ɺH5k@dgH/IHI 1L>H5jcL 1ɺ\#fD@LOHPLsfDLL 1ɺH5QjcfDL$ 1ɺ1H5,jfceHWLHLHHHʋf.USHH\$ HH8/ HHxHHHHǀH1H)HB HD$(HBHB HB HHB(HHHHBHHHH[]@H-$iL1H HbH11L J*bH1[]t ff.t@HH1HH5sXtyHD aA~H1jLH5\ X1='Z뭐HUSHH?tZH58-tO+0tUH5gHΉAEt+1tLH5aH證AEt 2t;H[]CuH[]f{t{t뽸fATIIHSHHEAt$ T$(Eɋ\$0DɃDEɅtDAɄDEDʋL$8t$@Dd$PDEDʃDDDʃ H5DEDʃ@ED'DE1HAu6AHLH5HDHZL%SHDH5IDASQLt$XP H IHtuHL[A\fH8+ HHtClvm2_fCWH@H2HH JuI\$HL[A\1LH5#_HL[A\HGH@dAVAUATUSW HLpHHLHLhL* IHLLH׊_L誅HHH5H诃HtH}_|HHt\EHCLHxPP'HtCH@Ht:HHH9iHRHRtt ufD1[]A\A]A^D1DSf HGCtYHLK LQH !B!H1HHHHHHHHH)HH)A0AL9u˸[@"AATHH5'tsHHR f.HH9H<IuE1EuDA\1L"eH54zDA\fD1 HH1H M0fDHyH@uCfDADA\@AWAVIAUATUHSH?#tcL-AE1 EeIDIcLEHHaIH -LpL9uH[]A\A]A^A_HHH1L=HuADAUIfATUHLHdH%(H$1M;qH$Ht$Ll$PH$L$DJ$HLDHLT$HDD pHL$HD$0H$LD$ HD$@$Ht$(D$H$ Ll$8D$L)$)$)$)$)D$P)D$`)D$p)$Ht@^~Mt@LLAt=HtH1ɺHaH$dH+%(uZH]A\A]ÐL 1ɺ1H5qxL 1ɺ-H5Ix^迂ff.@Ht7HE1H<-tA.McABHuA tJuV1Ht1LH5w1HfHD1LH5lw1HDATUH(H8% IHtH(HHt HL]A\Ð1ɺE1L H51v@LW1H5 vfHG`HtHtH$sBE1H"rH!rHtL 1ɺH5< qrL 1ɺr1H5 Gr|$%H-,|ML1H5nSL1ɺ1H5 qILH5Sff.@AWAVAUATIULSIHHHT$H$H$Ht$HHL$L$HT$ DD$,HD$8dH%(H$1MD$LHD$XHD$PHDHT$LT$HD\$,Iſ EHt$`jHE1jMLjjHD$PH HDL$`EMtD$tAHD$0D$(HD$LxMMHL$ D$(MI~M~Mv Ht!HHH9LHCH\$MtHtHt$H|$zH|$tIE H@@HtЅtIE H@PHtHT$PHt$LIL$MRI|$HT$`RI$LD$ _AX(t$(D$L0HL$ Ht$PH|$Xu =t_ tYtM1HtFH9ffH*H*^YOT,ȅDDHD$ @HHHH9HHHHHH9HuLIH-9 1HdnE1@D oEu<zoqo(HT$LT$IHT$LT$ 8D )fDL$(HD$ $ I|$H- LHI1mAH|$0DL$|sDL$D$,uGH$dH+%(HĨD[]A\A]A^A_HD$ 0rMDDL$TnDL$AntHD$81ɺHL 1lE1bHhOLIEH-w 1ɺE1L4 HDL$lDL$D1ɺiD$H-/ L HZlDL$L 1ɺ;1H5 /lE1L 12H5 kDL$H- Lw 1ɺBHkE1AH- 1ɺ1LD HkE1ufAWAVAUATIUHHSHHdH%(HD$8HHBHBHD$HBHD$HHD$ HBHD$((LHHzL HHjE1E11j1jjH HHfHx`oH=tHE`HoHLAŅLL== LLI1OjHEP@AHP L4HII9`H)1L lHsD$H\$IA$L+LLqHHG:rH4HKHx 1HL$wHL$HH A $H1ɺMPL1LHhiXZ|$t_D$UfL 1ɺH5 1E1,iHD$8dH+%(HHD[]A\A]A^A_fDAHnL| 1ɺ1H5 hDH1RH5yLLJA^_M1Lȼ1ɺLE1qhD$HHDH^L<H5xAJ0rxAŅL 1ɺ1H5 gff.@AWIAVMAUIATIUSHHHdH%(HD$811HjLE1P1AQ$ PD$@H HMH"$AMA<$EuMtAEAHA $LsIFAN IvHD$H@PHt$DHD$1IFA~$)HD$ILX`I'vAHcMIAAuHEHuHHgLxHP H;uHpLhHH9ts ELHuMtMC A)MKIF@a@HD$LHx(pHD$H@ H@@Ht LЅHCHxUM1ɺ PHD$Lp(L%j 1LeXZ8HUPLHr0HT$ pHT$A$L% L 1ɺ1LA6eHkHD$8dH+%(HHD[]A\A]A^A_I9H9fDHu1E1E1zfDA4${HUPAEHt[BtUz0Hz0H}HH}HL1H5tHFL 1ɺk1H5 E1,dI@AFL+FAF(HD$HH5JLfnH5LOnHD$H5xH8HD$HtL%T L 1ɺLscfDEf.HD$H@ ?H*H$PH%UCAHr(LH@HH  wvZf.AdA`IH@L 1ɺb1H5/ E1\b)E1H;HSL% (CAH;HSLp CAH;HSLCAHCHxPH\$H1LVLK(PH;HSLp$ CA@H;HSL]CAL% L 1ɺL+aL% L 1ɺLaL{IvH;L| IvH;MLL&7CAL3 L IHfHHLHHL@LH5 @1bM1H5Lx-BLL L 1ɺ+L% 1L`L% L 1ɺL_LcACL% LQ 1ɺL_LL;f)D$ L| IHLfLt$ HHHMH5(LH@1aM1H5ٚLALL L 1ɺ/L% L 1ɺ!L^Lg 1ɺ%H5 ^LC 1ɺ1H5G@^L%O L 1ɺ'Ln^h1|$ -t 11LOjID$ALcCL 1ɺ1H5ę@E1DHHAA1dH%(HD$81Hj1jjAPE1H Ht=Hc$uHT$8dH+%(uCHHfT$11L 1ɺ$H5/ _]1gfDAWAVEAUATUHSHĀL$H|$ L$L$DD$L$LL|$dH%(HT$p1EIHEH5 1HT$HӺU\ILL$LHjAVDL$(H A$-HL|$ bHyH5LpHtsLfuZ1ҹEHLgHuD$dHLLLjjD$$PDL$(LD$ HL$0.H A$uH3HHuH|$u`AHD$hdH+%(HxD[]A\A]A^A_@D$L8 1ɺH5] 1[DL$@HH}LLjjD$$PDL$(LD$ HL$0uH iD$L 1ɺD1ɺD$L H5 [DL$)~eff.AWIIAVEAUEATALUSHHHVHHH$HD$H$HD$H$HD$dH%(H$1HFPL$H L$HSH{LLHѻIHeHD$@1ҹELHH$jeH3ltPHkHD$ HL _H|$ HL$8LHHL$(Pa HL$(#H|$8HDEEt$ LHHt$ t$ PH Aąt]H{HY H$dH+%(=HĘD[]A\A]A^A_DjkƄ$+vDL 1ɺU1H5 Y}fL 1ɺA1H5 E1X^Ll 1ɺD1H5 E1X"H<$HL$(]HL$(H4$H|$ H_ tH|$8@1IL@1ɺKH5$ ANXHD$f@@ bAUIATIHHU薹Ht18HuIHL L]A\A]ÐLHILl 1ɺe1H5 E1Wf.AUIHHATUHSHIHti8u,HI]Me0HA Ct4HL[]A\A]@HLLHH LcHuHE1[L]A\A]DL 1ɺe1H5 Vff.fAVAUATIUHSurMM\ 9w.LHHX0[]A\A]A^@HML21PH5A 1SAVlVH LHhIMt []A\A]A^fL 1ɺS1H5>8L 1ɺ 1H5 U[1]A\A]A^fL| 1ɺ_H5>7L\ 1ɺAUATULSHA@LLl$0LT$8ItALҾLAX8HX0DELHLH[L]1A\A]3FIpLHFPLNHLփL/uL 1ɺH5܍T6f.I@LH5LHH1TH1[]A\A]L< 1ɺ_H5A=61L 1ɺH5ToTH1[]A\A]fAWAVAUIATIUHSH8dH%(HD$(1L|$pL\$xD$$Hz:HAHt3Et.HD$$L1HP$LPASAWHSPIHHKHL 1HHHhPqZY[D1L 1ɺ|H5 Q1[USHxdH%(HD$huHu0ǃHT$hdH+%(Hx[]fD1Ҿuɋ$2t;Hl$PHt%1HL$HT$HLD$ H5VRt51L1ɺH5 $PǃO|$t v‹;|$wnZff.AWIAVIAUEATE1USDHHHT$AAAGd EtUA ItAGdtPIFuADDED DEH[]DA\A]A^A_@H|$tPAfAuAIIH99gH^TfDL0tIG`H%r@uIHAD EDEff.AWAVAUATUSHH $HH|$0LE@IHt$(L$HSHL$8LH dH%(H$1uLpSHHHD$PL=H1HD$ H\HHzdHT$Lru݀zmuDbA-uDKLDL$RHD$@qWHT$1Hz HD$ZLD$DL$AjE111jjPHt$@H IHD\$PE1L)SH[HH9DAHBYu.H$dH+%(HD[]A\A]A^A_fV8S L 1PHL PH5p 1LXZHW M; HD$Hƿ1LFiLHt$L 11 JL+D 1E1LH5 L@H@PL$lLLT$HT$hLH0L$T$HD$ot$L$ LآIH QT$HRG AVHD$(1KHT$`LLH NHT$@IMPLT$HLHLDIIFH3H3H IVIFH3VH3FH A>H|$(LLT$LT$H1ҹALLT$@L$LLD$)VLD$LT$@HuƄ$IUPLLT$@HHT$HT$LT$@HIHHt AFd5LLT$LHD$HH5( HT$I1LR] AJY^LT$H|$8LT$HL$8Ht$(E1LH|$0DLT$L 1ɺd H5 IH|$Ok@H LU 1ɺA HD$Hƿ1I9LT$H1LL$ V LH5: jIH|$(POAXAYALpXHt$(H|$01LK-LT$L 1ɺb SRH8O$MHuIHG"QH5 HDAPL4S E1P1HH AWAVAUATIUHSHHHRHH?Ht$dH%(H$1ID$PHL 1ɺ HIƋE(=H}HL螩IHD=#ZE"LYMLD$HL|$PLH|$LLH=O HD$PHHPfHM)D$hLH5[ Љ)D$X )D$x%D$X ЉL$p D$tP1Q1AUJGH DT$PHHDD$PEAH$dH+%(HĘD[]A\A]A^A_HEHGHH}E1E1j1HLjL|$hAWjH hD$L6 1ɺ H5[ 1FDT$[L 1ɺ H5) 1WFE1+E1E11HLHRL$lT$hE1H|$DHwHL$PU(HHULHT$hHLAUI1SHT$(Hu HR EHEH LHGHGs);D$PEAD$a 9Ml$H_LQNHH5%hLHHt$1MLHwD$L 1ɺ \AT$|A$EDT$Ht$ H1QE1E11R1jH aD\$ DT$ENDT$HA$L>EL$| H5 P1KDAYAZDT$DML;11 H5 DAft$l9Lt$\$hL$T$lt$L\I1VH5 SL$ QT$ R CH E1ufHHHH5; D$tLh PDL$x1NC^E1_ @D$L 1H޺ 1CDT$MHuAH@Hto"oj'o@HoB oJ0HH8HtooZ_ff.ATIISHHBH@PHBHP LR8MtTH_1@u8HL_LgSA@$)LHLPVH7AH H[A\APL+PAP(fHHtLI fDLH(1L޽ H5 A1ff.AWAVAUATUSHHHjt$ HdH%(H$1HD$0H9YLHEP1L$0sL0L1D$,HL&AH$0H_8VHL EfvIWPIwHLu IHuL= 11MC LL@D[EA11LGHL$p@ljD$HHL$CDT$HL$I1I?H<HHuDBtS J8CGA<$HPHrPHPML4,V L1@H MLL1Y ?AH$dH+%(HD[]A\A]A^A_@HEPHUHH>1L.IHH "HsDLHD$fDHT$LLTLLT$,IHHT$1Hq@Ht$1ML )H i"LHeL1'H5>fDHP5 L׺IH5k 1>E1D8@KHT$,LL={D$,HT$01LLD$,HL0εA…c|$0xDcEu H{ tC$Ll$@f1Ht$PLLDT$D$H$0HD$`[ HD$PH0HD$X)$)$)$)$)$)$)$)$ ؈ DT$HHgL$DT$LAHt.1HL$8HT$4LLD$ff.@ATIHUHSHI<$HHܔL 1ɺ HtoIHCPLKHHLCc@tVHt"11LHkt[]A\DLt 1ɺ 1H5 2[1]A\Hshf.AWIAVAUATEUHSHHLHt$LD$dH%(H$1HEL9I L5bHD$(fH|$`DLI)D$`)D$pHD$IGPHDŽ$oo)L$@)T$PH;LHt$@ Lk 1ɺj HXHD$ HD$LH;HPHIGPHTx1L\$ L) Hm MDE E1LLHL\$0HD$8HLLfD$ 胺HAAD$(PIGPt$(HP`E H PHT$PHt$XH|$0H 1ɺu HL HzK(LL% `Hx LAVI1Lٯ0XZHT$(HHjAH$dH+%(HĘD[]A\A]A^A_IGPMOHHHt$(HL.AƅHt$H;1脑HHtt1EuI 1HTAƅOLe 1ɺ 1H5 //L9I0L5!:HD$(LL 1ɺ f.H5/ 1E1Z/DLܰ 1ɺ 1H5 //f.L 1ɺA1H5E1L 11{ L.UT98G=Gf.AUIIѾATHf,UH-SHHHdH%(H$1JUHH69Aą88u/AH$dH+%(HĨD[]A\A]Ð5=4IIHHkHDHE1HbeAPH5DSLP1-H tDSL-tD$L %=1ɿ1LLh-H01 78C4=\LHIHHՉHDHL (APLSP1,H 1E1L"H51,k@L1L,BIL1L1h,6ff.AWIAVIHAUIHATUSHL;HHhDD$ IdH%(H$X1RL%1MHH-*LHREML-1LH LrRL5 1HپHLIR`Ht$0LHt$.6u>D$H%= M1L=L1L+Ht$H5AąD$H%-`;膱t$ L=It1ɿ1L )LfL*Hs.tZ48_H11AUL )LL)e*XHZf HL*S11AD ,fML4H51E1*H$XdH+%(HhD[]A\A]A^A_f.MLDf.L LҪ1H5)zMLKL$ L=L Y(1ɺ1LL)ML̩2H8/='H^IH0LHDHE1APL 'LSP1(H 11 wDH-HD$H2H$L=HD$(fDH|$6Hx.L@uAxt܀x.uAx.uAxt1HLH=LD$ NLD$ Ht$(H=2u$%=`p1ɿ1rL LOL'H=X+8;18(k.1ɺtLPHL mPL 1>'A[XfDH|$V3~1ɿ1L )LL&L*08-1LPHL PL 1&_AX[08-L 51LѨ PH`yPL1g&AYAZ@fDM1LLk18&+-=D%LHIHvHHDHL %APLSP1%H H$L+uLHt$H*u;HD$XH9$t\L $1ɺ1LLx%L=1ɺ1L y$L*LE%qA//.L=8,I1ɺ`PH"_LQ Pff.AWAVAUIATIUHSHdH%(H$1҃tNMƃAH$dH+%(|HĸD[]A\A]A^A_fD$LLHL=ǿHH-b1MHHJ=9Ht$HF)D$(%=@yHiILĿ11PH5.#H'AHHMHIHOJ=t!Ht$H(xD$(%=@tmL=114L ULL!#@H$ 1H߉D$ 1i|$ 011 LLLHD$vuQL=)fDMt$LLHLLLHD$%taAfDL=ǽL"1JL9"Lţ 1ɺL1"E1r@L 1ɺ$H5d!{@L=OL1,L!LM 1ɺ놐L< 1ɺ!H5!@C+Hj8u(=LHIHL iHDH9APLN SP1*!|$,H -/11$ N+f.AWAVIAUIH=ATIUSHHdH%(HD$x1G* I:$HD HHLMY1  - *HL HƼIt$jAuLHPHH=UP1t$8t$8t$8ML$I $j$H@AąSsA@Mt2H1L1t$H=t$t$$H Aą?{0t3HHs011t$H=it$t$#H Aą6H|$ t$t$t$5W25I25;2Dd$PH\$hH0EOHL-?Rf11Ht$@L)D$P)D$@HD$X)D$`H{H@ Hn8ML- 11L-LHH^1LP11L QLXZH L& 11 H5yLl$0H{fDH@11t$H=t$t$y"H Aą,M1LH5&QD$HH5ATIL1E1Ll$@Y^HDL"HD$Ll$Ht HxL"H"HD$xdH+%(HĈD[]A\A]A^A_LY1ɺ1H5Z7E fDH1H=1t$t$t$H!H AąM1LTH5DM1L#H5ĸ@L-W@M1LH5a@M1LH5T1|@H@8OyxKoxeAE1lo&ff.@AWAVIAUIATIUSHX $dH%(HD$HHB` t ,H-F$1LLLADžH LLL3H >LLLADžWAF EEIIH9uHmH9HEHxLLHHEHP(ADžuLM 1ɺ3 1H5p H LLL[AEd=L舮LLLHADžL؛ 1ɺ$ 1H5 +*fDIE`H%@H0;H4`IIH9uHHH94HCHPBft1LL)t9HCLLHP tL衭LLLHuL 1ɺ} GfII9IIH91H1LLHP-ADžIH9y1H1LLADžrAD$EEN EuJEF(EuAL蹬I>LLHXHHtLLADž IE`fDH4sIIH9~fAt8IIH9t%HU1LL1ADž HmH9uAF tAEc4f.A~,E~(EutIIH9u_HH9tPHCHxGftAF(譫I>LHHCHPGHLHAF(H9ufDIIHD$H9iHHt#1LL8ADžHHt1LLADžHHt1LLADžQHhHt0HC@t&E^ LLEE $ADžHHt0HC@ t&EV LLEE $xADžHHt%Av LE $LGADžDKLE1Euf;HCH@tCuLLH۹HH$E^$f)D$)D$ D$D$)D$0EtIIH9>*HH9IHL$LADž1L 1ɺW 1H50 `_L 1ɺ 1H5 76L 1ɺ< 1H5 L 1ɺi 1H5 Lr 1ɺ 1H5 LL 1ɺ 1H5o L& 1ɺ 1H5I yxL 1ɺ 1H5# SRLڑ 1ɺ 1H5 -,L 1ɺ 1H5ג LLADžLx 1ɺ] 1H5 LR 1ɺ 1H5u L, 1ɺ 1H5O ~L 1ɺ 1H5) YXL 1ɺr 1H5 32fAWAVAUIATUSHDD$dH%(H$HFH@PH8H|$ HD$D9D$(IHH@L4ILIOAHzäIHCJt0H5I}1oHHI1HBL0HL$JII}1Jt0{oHHI1HBL0HL$C1ɺ ALH H5t z@HrHIG@ I}1nHH I1HBL0HL$I9\$L$(tHIH#G`bAfDHBHtH@HtH@@Ht HH9HD$ Mgx"HI#D$`ID$PH5+D$,IEL8LLD$H|$H5.D$DT$Et LD$2HED$8HD$0IG@cAG$I$D$lL\$HIIGI}LHPHH@PH>QHHHI}E1E1j1LjHD$XPHt$8 H Ht$\D$,DL$@HD$EH|$0L$\E1E1T$XHwHIHc1HH@HLHHL$VD$(@AWL+PAG(‰D$8fHE1E11jLjjH|$P衺H HHDD$T$<+T$8HT$E kHDLފ 1ɺJH5 "L 1ɺ H 1ɺ AL H5 H=HtHzHt$p$%=`ILHR1HBHH@H9H9JHHL$1H1ɺs ALʉ H5 +fD11LH+H-Ȋ L 1ɺ4 H;fH5HaHwXLxL8e L7IHgL 1ɺAH5 EL 1ɺ <DH- 1ɺ1 1L HpL 1ɺ H-ȉ 1H*H- Ls 1ɺ HLS 1ɺ B LIH5] 1E1YI LYIL 1ɺ 1ɺ AL· H5 /HH- D$dH L ^PDL$h1^_*Lz 1ɺ Lg 1ɺ 1ɺ ALE H5q wL- 1ɺ N fAWAVIAUIATUHSHH$LD$dH%(H$BxD$XG(H?D$DHHH$I9F(L%HCHD$IHH<$|AWATI1LH5 HD$ZYH@`H2H-H|$H}H$HL$HPHH@PH#KIH HT$H4$H}eIHi A<$IEu>HxxtGAH$dH+%(HĨD[]A\A]A^A_DLL襱HuDKANHEF HT$H4$H<$AVE1DLHGPDT$H@`% H HT$AD\$ɌH|$D\$DT$A E11HLLLARSAStHD$@H HHL$ AHդHEAHCH$EH@`H2sE(H4H4$LLM9uvM$$M9t^ID$HPBftE1ILLHt$ID$ILLAHHPuL( 1ɺH$H@`H-VH$D$lH|$.H$LHHD$8L9Ht$HHD$HHDHEHT$0HD$(DI|$LMMDI_HC H@H LLI|$HD$Q~HLt$0 H5b t$@P1LL$8HC H H@XHtIWLHJP1H9Ѕ@ M$MLgH]LHHbHH88xLHD$HîHt$HHHD$ѽHD$HaL{}L= IH5 1EED H}1LLH* E1LLLH IIH9ttLd$IHID$HxrH}LHID$HP芨Ht0ID$HxGLLHIID$HP8 M$$L9uLd$L|LS IH5 1I$HtE1LLH*" I$HtE1LLHb I$HQEVEI$huA|$LE1f.ID$H@tbu[I$HtNHTHtDI$HHDH@`HttE1LLHN fDAE;|$LQDH@I$HH؃8bHxHHW`Ht BM(tID$H@ 2E1@HLLHL 1ɺ 1H5 L 1ɺ[DH$H}1L6HH$H@`H-*H $HH9HHH9|HE1LLHHPADž H$HH9HE1LLHADžL~ 1ɺ1H5 L=M H$LM1L'IH; IGH@7 H4$H}H53 ! I%yIIyHLyATI%H5) 1\AYAZH$H}1HPHH@PHBIHvH$@d #H<$?hH<$HD$H$Ht @dgH|$|H $HA`H%|HHH9HWH$H謏LHLIHADžH$Ht$ HHADžL| 1ɺ1H5} -H $HLL9HH$H4$HHH9HHHfDL<| 1ɺLH5a} 1E1V蛎II$H|fDu(I|$v LIH5| 1$ID$IT$H@P1BtAD$L+BAD$(AT$$H|$ )HH,AD$8AD$Lt$M$$9CƉD$L;d$8H|$H$H@`H%Hs&H$Ht$ HHADž'HC`HH0 u6H$H55LxHLu_L/HsD$X1ۃpHL$ U,tFH$@a tM 1LtH5 Ln 1ɺ 1H5o  Ln 1ɺTH|$HH}1L%HH$HP`^LKn 1ɺ1H5no hIWp1ɺAL n H59o n8H<$h*LqILm 1ɺ1H5n &D$pI\$HH|$ H2HD$ Dx@hEu ǀǃIShH<$IGhHLqAWI>L$m 1ɺ1H5Gn wALl 1ɺ1H5!n QLl 1ɺ1H5m +H<$=HH$HH9L<$L HXIW`yLfl 1ɺ 1H5n H$H}1LHIHlLHLHADžPLl 1ɺ1H5%m ULk 1ɺ1H5l /uLk 1ɺ1H5l  OH$Ht$ HH耱ADž[HS`{HdfLp IH5l 1L9k 1ɺH$Ht$ HADžrL k 1ɺ1H5-l ]'Lj 1ɺ1H5l 7}Lj 1ɺH5k IGH@Lj 1ɺ H5 H<$heLD IH5 1L=j 11 H5`k H$HH9?fLi 1ɺ 1H5k OLdL IH5f 1Li 11 H5j HL}dLY IH5 1LRi 11 H5uj L,i 1ɺ1H5Oj H|$ LxH11Lh AH5 -Lh 11 H5i jLh 1ɺH5i HH<$zcLm IH5i 1LOh 1ɺL8HC`D$E1H$MM$$L9$$MID$HLhxMtDXLPEMt'MuMtA>tLLLT$D5MuLht"H IF`HH%\A}uIMHL sMHQPHIHHHHhPY^D$MLc`L9$$T$hLNL\1ɺILdS 1ɺ 1H5T H{nH{eH;L)S 1ɺ1H5LT E1y@LML,[ IH5T 1AE1jIG`H%r @TL/eIDǀF$D@LlR 1ɺ1H5S +LFR 1ɺ1H5iS L R 1ɺ1H5CS sHCǀHCǀXML1ZgH5R #IIL9HI}`~LoQ 1ɺ1H5R .LJqE<DLZ1tH5LR |H}HL$@HT$8LLD$H<LT$H}LHL$XHT$PLD$`LT$LT$MѹLY"H5Q HGHGHGHGHHff.UH dH%(HD$ tHD$dH+%(H ]ÐHHb H5a HAHHHD3e fo$HD$D $H)wEx tXH-h11DLWHtHD$dH+%(uWH HLX1ɺE1]BfLqW1AH5?hAUATUH~lLIMIHVHIE H taEUHJmRAQL /i.H5gELIXLD1A[LXLH5ZH]A\A]d@@tNH$JH1RH5;g<LVXXLZH5hLLqX1DH5f]1A\A]@H1RLW2H5f_LAXLHH5ը]A\A]銩f.LV1H5f\{LV1$H5Of,KLV1)H5fLaW1AH5eH1RH5e7LVYL^LH5AWAVAUATUSHdH%(H$1HHwL%Re1LHIL WLHӺU H=eLuEmyD$<H|$@H5fHD$4AXHAY`H1Lt$HH=e1t$Ht$HH LVAǺ5EHtCH1H1t$HH=et$Ht$HH LtVAǺH|$Pt$@t$@t$@555$L$H0IEf11)$HH$HD$pHHD$)D$p)$aH~H@ Hq8H5W 1ɺ-1Ht$L vL ZHt$H11ɿHhL APLJ1'XZIEHt$f11H)$)D$pH$)$`HH@ H8H5 1ɺ-1Ht$L Ld Ht$@HD11t$HH=ct$Ht$HH ADžLTDL11GAD$D$aDAE1 HLUILAI11LD$pY^D$D$MaLHD$@Ll$8Ht HxD-WEtjD-Et^HD$xdH+%(HfDAy. 1E1LQH5(WHD$xdH+%(^HĈD[]A\A]A^A_uD-EtD-0EtHD$xdH+%(H7HĈHL[]A\A]A^A_j@D-YEhD-EXHHHD$H9E1L|$Lt$ D|$DDHH;\$t-HCLLHx@jt߁|$uA@Et{L5E11LGL1Ҿ'L赎AAELOL1E1述jf.L5p1ɺ1AL3GL膰1Ҿ'L7A@=4$E1H AŅHpHLhH蠴H ^H|$ jQH 7OLc1QH 4OL N1AWL= QH )OAUL-NQH *OLAWQH NSH$HPt$ LHL$E1H AŅaD$(L1LLCrfEHL Nf11Ht$@L)D$P)D$@HD$X)D$`IHt;H@ Ht28L N*L 1ɺ-1H5ř L1LLDͮD@B讵Hp2LHW @HN Ht HCuL 0 1ɺ(1LbHl$0E1HHI@D$AAA.}T=*J=+=,L1LL6Bܭg$OL1LLC菭=$uYLLHSLAP1AQR_AXL1LA/=(HLPL1LRLY^|L@MLLD$I|$HPHH$ZHH$Ht$HH$迺HpCiHpH $HHh`7LHܔHHl$0H{Y1ҾLDL$DL$AAAAAAALt?=$ޅEofL1LJ蠫KL?AAL;>=vHpHLLApHL1*XZAA=6L>*L1LL@Ԫ_L1LL?訪3L1LL6@|L1LLz@PAAL==OR L1LLv@/EL= YfAWL=oAVL5NAUATIUHSHHHt$H9LkL?txLvtlLkIEPHHtX蛩tO1LLLntcHsHFPH4$HHt#ftH4$1LLmt}DHH9lAHD[]A\A]A^A_@$HCHL?pHHD$L1H5s袨XZD$f.$HCHLHpHHD$LAVAAUIATUHSH@HdH%(HD$81$AHtgHpH肦LH HAG HD$8dH+%(H@D[]A\A]A^DAč@w AAMHGDHcH>DH=i>1b~0L GA@HLH;LݪH|$jL ESHELc1SHEH D1AVSATL%EL=H\$XH0Lt$HL$ LD$Hk DL$ AąAeA.1E1LF>H5轥DHl$ Ht H{%SH蝪HLLL<E1BH5"QkLD\fDHpHH5LZ;pHL1Y^ML<11H5̤L<1H5m蜤L<1H5=lEAAAA.EYD$u8@BHp蠢LHż tEHAD FL1ɺ1L<H5֣AHpHL9H5ppHL1蓣XZ{LL;1H52aLL;1H51t觭AWfAVAUATAUSHLH$dH%(H$1D$<)D$p)$)$)$)$)$)$)$MHLHǢD%E_D%EHE1bt_HC L B@LDLAH ALt$pLD@LHDH[$1LMuL- HL/;11AUL-LLAZA[HL$@L'AąLMH5LHD$&H5LH"OHMDC(LD$HLDHLD$ HDHT$HL$xH @H|$PjAVL ?QH @t$ QH @LD$HAPLc1QH @AWL=@QHL$`LQH ?QH ?ATQHT$xH F?R1$L$D$xHpt$HL$8LLLD$< AąUD$8(D$<tLL1L9Hl$`Mt I~}MHH$dH+%(|HD[]A\A]A^A_fLL81H5f蕟Ld$@HL@MLDC(HIMLLLDHLD$($LL$HDMHL$LDHt$ 蚣H @>H|$PjAVLE1QH >t$ QH >LD$PAPLc1QHt$XH >VH5>VH5>AWL=>QLL$pAQL `=VHL$xLQH \=$L$D$x$Hp~ HT$@JLL51H5HD$lfL\ 1ɺ1L賜fD1L61ɺLA腜H$Hh]DHL]6L1Lj6 HL6)fD@L51ɺ1LA譛HpHL4LpHL1kAXAYmݥf.H @HP @HI1LkI"H5 1Hff.AUATUHoxSHH_xH9t:L- L%x>LK(M1ɺiL1蓚HH9uH[]A\A]ff.HH5Hff.@HH5 輤Hff.@H?H6H H 鉤fUHH0ߞH]֞fDAUf1ATIHUHSHHHdH%(HD$81I)D$LH|$1)$)D$ d3Hu/A$AHD$8dH+%(umHHD[]A\A]fDLHH?AŅt$tA$AIٹ"1LjGH5 rfHr1mff.AVf1AUL-9ATLUHSH1H@dH%(HD$81I)D$Ht$L)$)D$ Z2Ht^f11LL)D$)$Hl$)D$ /2Ht3H@ Ht*8t|ML 11-H5 zL @9"L_FH5 1E1HD$8dH+%( H@D[]A\A]A^DLpA>tHCLHxPBHLhML58LHL>Aąt4 $A@L1HnAątgHCAHH` WM"1LEH54 +@MWLEL| 1ɺ_1H5 ϖEDATUSHG@HHHH57HH@HPH1tAąt5HH57HP1RAąt{AD[]A\D1L 1ɺnH5B 'D[]A\1E1jLDH5 D[]A\fLl 1ɺo1H5ڂ 迕ef.AVIAUATIUSILHl$0Hx)LHHHpHHSIHt$8HAHBPLJHDLD<>AąteHHFHHH9 HCHH@PF1Hȋ`LHIaAątBA[]DA\A]A^1LJ 1ɺH5 蟔[D]A\A]A^1L 1ɺH5 o[D]A\A]A^1E1L 1ɺH5W <[D]A\A]A^AVL5AUL-M ATL%" UHSHGdH@PHHH`DL$H{jHƃ 1LIL5X1Z蓓HH{DL$j`l YL4^I11L:L<L怽XL 4IEHL41P1YLL4ME11L {4<L,$ВZ_AX HDL$H{$j1LIL/4X1ZgHH{(DL$j4H 9YL3^I11LD,11L3L[LH HL 3HDH1ɺ<L>3P1衑H{0DL$$4H r_1AXILa31L溴?HH{4DL$j4H AZ1A[IL31L溷ݐD<11L3L蹐D@11L2L蕐DD11L2LqDH11L2LM1DL1L2L)DP11L2LDT11L2LD811L2L轏\uK[]A\A]A^f.HL @11LAVL1<1vA]A^DL tCL t7L $t+ALJ11[H53+ L -[L]1A\L1A]1A^@AWf1AVAUATL%g9ULHSH1HHdH%(HD$81I)D$Ht$L)$)D$ x(Ht^f11LL)D$)$Hl$)D$ M(Ht3H@ Ht*8tzML 11-H5y %pL 8"L}<H5'{ 1E1HD$8dH+%(HHD[]A\A]A^A_ÐL`A<$tHCLHxP8H|LxMoL51H`HL64AąL5'HdHL4fAL$$HHXIF0H5[ AF8AFAF UAąHYH5? H4Aą9HZH54 HAąLL58HLc3AąHL5% $ H(HL83AąL5/H,HL3AąH[H5 HAąL5 H0HL2AąL5 H8HL2AąL5 H4HL2AąlL% H<HLc2nL% H@HLB2ML% HDHL!2,L% HHHL2 L% HLHL1L% HPHL1L%x HTHL11 LHL%] 1Hl$L$HSǃ\1L1HI贂AąwHCLAHH`@/Gsf.M"1L8H5dw I=@ML- L 1ɺ1H5w f.L| 1ɺ1H5v ωf.LL 1ɺ1H5v 蟉L& 1ɺ1H5v ymLHy HHtH\UHD$8dH+%(uHHL[]A\A]A^A_袓L 1ɺ&1H5v ff.ATUHH5r SHHHH@HPH1貅`H+H1HAąEHCdH+HH@PH1ځAąwHU AąXQYZtH5+H1 Aą$H5+H1 Aą2(Hu+H14 H PLy H5d 1vAYAZ_H7 HL` ML=L-c Mw Il$}u=Md$MtkA<$tL ]1ɺ1LL`vfDLHyu BLHyu ,f.8*,҉ t H1ɺPHH5b PL 1L%uY^),<&H1ɺHL PLTx 1H5|b fuD$ A[A\.fH)L %1ɺPH;L gPH50b 1u_AX-),@HL 5L$L$ H5a Q1RP1tH h|$f (,$@1E1L H5" yt|$7|$&~ff.AUL-s~ATIUHSHHH9u 3HH9t(HsL~uHA[D]A\A]@LLHWAąu1L#H5` sHD[]A\A]ÐHGIHWHHp0HBPH8ff.HGHWA Hp0HBPH8 fHGHWA 1Hp0HBPH8ܟ ff.ATH1ҹUSHdH%(H$1IL~Hth_L{HtHl1H82t4SHLvuHcH'HH)D0D1H$dH+%(u H[]A\|f.AUATUSHHH:HIHtnIt$HHAŅtH3HLH[1]A\A]0DLt 1ɺL1H5qHD[]A\A]f1 HHz1ɺIE1L H5dvq@HA[D]A\A]ff.AWAVAUATUSHHL@t$HT$dH%(H$1MfA$I$HD$A'H-G)H HDfAfIfAHHDŽ$HD$hL lHD$`H$$x EhAhEfEX Et$AH AXD$ f $L%LHzH5Hiz;fA t$LHCztH5HD$(*zL$(ED t$ L H5C1AHoH$dH+%(HD[]A\A]A^A_@EhfHDŽ$H$AhHD$hHD$`$E= fTvLh|H5AnGHDŽ$fL%gHD$hLHD$`HD$H$H=$HD$pL$HHD$(1HT$\H5 LD$0pLAǃD$\T$p HS@f $f$HT$ HnfxHPHߺ3HD$ H Ht$ Hq8 HS@Hf L8Ix@HT$hLH LD$hHS@L$HfHHLHH @G3;q L H5AlH$HD$hHtH9t H;8tHz HD$hHlH98HxfA @fH5 HvLfL%HL$(LvL$(fLHLcvLH$HvLHL.vfA($f.Lwf.H5HHT$8uHT$8H5&HuHT$8L8LD$hfI1L:H5AjfDfA EtI@HhfAhH=RI@H HHD8@HD$nfH5"HHT$HHT$@LD$8t`DŽ$ HD$`Ht HH$HH E1H$1E1H\$8L- LAIfDAEEIHE`u0$tAtHLLH4-Ht MHLDA(u$H\$8L}Hl$hH$H|$HD$pHD$xHEH$H|$H5:!vHD$pH D$8LL$L% 11LLh$D$H}HL$Lt$(H\$ALl$0HHHD$/f1MH HH9\$HEHf11L)$)$H$)$HHuL L $L1E1h@H5c HHT$HHT$@LD$8zrLD$8HL$@HT$Htf'fDŽ$ ,fXf(xf111fH|$ 1HPHHHHPHt:uHPH>HQH8H@f.H|$ H8HuL9qyLD$8HL$@HT$HH5HHT$HHL$@LD$8=qLD$8HL$@HT$HLHHT$HHL$@LD$8 qLD$8HL$@HT$HH5HHT$HHL$@LD$8pLD$8HL$@HT$HH5 HHT$HHL$@LD$8pLD$8HL$@HT$H8DŽ$H(Xxf$ft$ ft$ft$@ft$ft$ft$ft$$ !HT$`Ht HH$Hl$hHD$ Lb1H5 dLq1H5 dgLL$LE1LK dDD$8H\$t|Ll$pMtrLyiLotXuTnL 1ɺ1LdL 1ɺUH51Ac@ uE3@LK@MtfAxMPL1H5AcJff_DL$IL1L1>{)LN1ɺQ1L濄p>1LLDL$C>DL$EAv_D$$t'L1ɺQ1L濄DL$>DL$ELT`L1=E1 I0Mrs{h{A-AwMA&H¡#LL MLLE11Q={/1111ҋD$$AAAE_y@@L1ɺB1LLLL pLaZLDL .LL]L!L#1ɺ1L濄;Li1ɺ)1L濄;L1ɺ.1L濄;eL1ɺ31L濄;CL1ɺ81L濄];!L1ɺ=1L濄;;EAWAVAUIHATAUHSHH蚷HHL5F1IPLL' 1:HsPY_F,HHC`H>H`HL McH4yDExAHSHHK HATILAZA[AHD[]A\A]A^A_f.}uur}nul}ufL1ɺ L1:AfH1ɺ PL5EL 1LL9HsPAXAYHHC`HD$D$ H$H%H&H'MH=+HLxL71L 139fDLKHLm1ɺ L19A@H`HuDEeH[H$PG uq@HxLHsHLI |D}u}nML$ D$HH`HH9PHH@H<HHt4}uu.}nu(}u"Cc@tHHt@HSHHsPHK HL AHHHH9H1ɺ LLL1\7MAAL1ɺ fDLHsHL+ L16_E1AXLu1ɺ 1L6HCPHL LsHfDtLAZL1ɺ _L1ɺ 1LIH6AxAA BA}0<I]H5H@IL1L 15L$DT$AtIWHE\$ AFDT$AHIIwPM ATIO LY^DT$AA EAEADL$ ȃ BAHAIwPIM ATIO LMAXZEALHsH1P 1LL4XE1ZGH1ɺ LILJ1h4L1ɺ 1LC4bfDAfDL1ɺ 1L 4*fDMOHL}1ɺ fL1ɺ 1L3L L13E1JL 1ɺ LLXe3ILF1ɺ' 4IL1L# ,3AL1ɺ 1L3I]D$L1L> 2DL$6A{ff.HG`E1H$H&ryH'rrH(rk udHx_H4rXH-rQH.rJH/rCHtH$s6E1u*H7r#uuH"rH!DDËtf.AWAVAUATUSHH $H1ҹdH%(H$1H$HHHATLPLL$(1H5.HD$ fHX1ZHT$HdH+%(HX[]A\A]A^A_f.L%mD$?LL8A#tfD1D1VfDHH5H|$V+AEtH|$H53+HfDTu GatfD1GfDGgAWAVAAUATUHSH(H|$H\$HdH%(H$1Ht$HxJ1|#fK[]A\A]A^fD L+f7wVf HL2ff.fAUfATIUSHH8dH%(HD$(1:-)$)D$I,H׉+HtHLHLuN fo $foT$HHHDHP HD$(dH+%(H8[]A\A]u4 fo$fod$HHHX` fo,$fot$HHHPhp rILGH5!fKC<,ff.AWAVAUATUSH(dH%(HD$1D$>IIAH1@fDA9OAyOAy_LLLzA9u$HE8OuxOux:uALcD$IN|MA9-uAy-tb1LH5~LT$ MLT$A9OIL$t1LLLPf.LHL$HT$E1Lxt$CtT$A9HD$dH+%(ueH([]A\A]A^A_ÐHH…t JDHHLcPH51RAQAfAMH F*fDAWIHAVIAUATUSHHdH%(H$1HHV)HHH$HǻI&fHxI|HH A&(HuLDLL`H$dH+%(HH[]A\A]A^A_#1IٹLjH5yAFfAFH$dH+%(u.H[]A\A]A^A_ATAF(fDAWAVAUATUSHHdH%(HD$81HD$IIHcHD$E1fDHT$fLL)D$)D$ AfoL$foT$ AfAAHHID 0fAII9tPMtjO4LNnAH5WL'u`HcIHA8I9uHD$8dH+%(uiHH[]A\A]A^A_I$8OuxPx:ktfDM1L*H5fAM.Q'AWHE1H YVAVHAUATL%*USHD$HH)fA<$IcHD$1E1HL5UHMHH=}*L AIHA"fA9uIcHPfA$Hi3t AƄ$fAt AƄ$EfEt AƄ$fAt AƄ$AAtbHIPIL+HH(BƄL9uE1LD*LHL9tuf;uft-L:H4IMHf.D9tH(L9uIIuAHD$ IA;[]A\A]A^A_CƄ!IIYAWIAVE1AUE1ATAUSHH|$ )9HD$DH8 AthAAtDA2tnAAHDHI#tA0trA1Et|AGADAGuqAA2uDAGH[]A\A]A^A_fDIWH5 1P@AWH5< 1/H5u 1wH5u 1KHH51[]A\A]A^A_AWAVAAUL-ATUSHH8GDgt$HHAT$ ADfD$&EtH{Ht H1H5W fEf ,HD$L=L5 ID-H\$Hk E1HD$(YfH51H[LHIT1H}HD$AH( D9ADeAIcH[HAT#uH51@fD 1fH\$Hk E1L=L5 _f.H51H[LHIT1H}HD$AH( D9~3Hc]H[IHAT#uH51DH\$D$AL=^fD`HHl tnT$EH5J1T$H5$1KvH5 HIT1E1H} D9AH(LcuDT$KvMHAT#EJF D9D=+)H5y1 9f+?D$|$f HHtEH5%1HHtH51H51t$D$&IIIJHD$f ~L AL%d@Mc}L$KLHEL#Et;HfH8H4HP(HfH(H9[;(u D9AI( D$fH E1fDAH(D9H}tH1HdfH51mtH51MT$4E D98H51f <D$ uH{Ht H8 []A\A]A^A_fDHDHDD$DD$H*HD$fxvB8H51DL$nDL$EAH5x1HKH5> HIT1(I}H51  D9 T$D$[H|$HD5H|$HDDL$EB D$.@HD$(@DD$D$@H51ULH#!fDH\$^1H5E1fH u@H51H1HAH(D9~H}tH51H; H51ATUHSH=HHPL%ع1ɿRL1ILN tH}PY^tH}Pt[]A\fDHЌHILP#1L'X1Z[]A\HH\fAUATIUHH0dH%(HD$(HF`H%r Hƒ Pu\HE11LIH5ɸ1zHD$(dH+%(H0D]A\A]fHHE1E1jHLjjBAH z$ouAHty脋L;1ɺIL-1L KL1H{AąuH;LLI1  Lӷ1ɺIAUIHATUHsteAu D]A\A]@H谊L1ɺIH5K1 HLD]A\A]HAeLIH51 D]A\A]DAT@u4uADA\1E1ADA\f.1IAąuLގ 1ɺ1H5~1 f.DGc@HHG(H?L9H5-DH@HkFHкP1 Hff.AWAVAUATUSH8dH%(H$(HG( IIE1E1D$(D$D$4f.KIG(I D9~IcH\IG@HtHcHRHf|(tHk' Ht9uD$f.I}P>N*CK H.=HcH>@FIG@AH f+ +A}xeAmxL衇H1PA1L!H55 L$8D$XZ ~"u.LLA軰D$kfgvL=I11L3H5z2D$DL L 1ɺH5@+fDA-HE@AHHPfxIID\H9D9 At0t+DHHtf/ALHT$虥LLkIH5a1HM@HE1f/Iy/IH99 A:MID$xAI9IG@t$IH@LHI9ǸLDM$HT$xHLL\$L\$ D$x  E1LIH5@1E1uIL|$Bf@HH1H9HEHD$fIEXAH0HtHXIEPH8Ho@H) f 1H-0IEXL}ULq1SI~H5z1+L$8D$AYAZIEPIAHIH9øHDHB@H> ft S@f  CDt 9C@8L$(D$b11ALLA L}L 1ɺIH51OL$(IEPH@H@h`PA]xL|HAPH5H1L Y^HC@H1ft U<fHD$PH4IEPHx茭HD$0HjLSHHCHD$,HD$I9jDd$8MLt$@Hl$XL|$H^H1HHD$ L8Hv A|:MLr.HLH1 D$,M$$L;d$fA$0tM$MbLHt$0HhHHcD$,HHHD$ IEPHx蚬IHGHD$ L% 1ɺDd$8Lt$@H5H1L|$Hb&DIEPA1HH@@Htf8tIIH9¸HDIE`  @X9 X9IEPA1HH@@HtfXt<IIH9¸HDIE` @TY9 YIEP1ҾAH8IM`ƒt HH[HuHHFe HIU`LyH1SIL~ H5%1L$8_AX+1ҾLAKIW@HtftA9Et AEt 1ۃVLxH1ɺSIL+H5j1 A[L[xL>1ɺI1Ҿ*LA|IE`HH39 HH3H3HEƒL$(D$IE`wfDIE`IW@AHH$f** H LIE`wL1ɺOIH513IEP1ҾAH8览HHn4 I E`IE`L~wH1ɺSIL8 H$1 I9HHT$tLDD$tHHV D$ttEp A9$1уt(A AH$Ixt1$A AH$It1$A AH$It1$A AH$It1$A AH$I t0$A A$A@t0$A@ A$Ay0$Aဃ A$A$փt%A A$At0$A A$AH$B$A A$AHH$HIIALy 1ɺd1H5LH-It=HI11L&t$(Lb D;d$I}PgIG(Dd$(D$ D$=IwHL\$Ht$5HE1E1jH1HjH$PHt$(H L\$ $zISsLoIH51I#s=I11LaH5E1b1LLw 1ɺ$1H5wE1'LkE1=H5JLrHL(I|H`H5P1AYAZEL4CDL,w 1ɺ 1ɺE1L w H5kH LIE`qL1ɺSIH5y1*}HHHI$I#E`Lv 1ɺLvv 1ɺLcv 1ɺH5|HH@HHH9 DHH@HHH9i ff8 HH莺HLu 1ɺzH5^HtH$HHE@Hf/IE1ILJxILJHAA)AH#1ɺE1Lu H5uVIHT$H9 HE@D$x!IEPH@H@@at EvN E J1҉É ]9mH QL1ɺ H51A_AXA;]xiL@oL,IH5؛1Mn1E1LH5]L1ɺ1H571L61ɺH5cHE@H f/ t$l}1ɺNE1Los H5WLWs 1ɺH51E1&     1ۃ LmHLSIu1ɺkE1Lr H5j"LmHLyISLxr 1ɺL\mHL&yISA]x9v1HLLHqADf=LH_H511HC@CDtGH$E1E11HLLjjj"H t$t$LtlL;IH5 1RtGH$E1E11HLLjjj!H t$t$LkLHIH518LkLOIH5S1LkLIH51Ht$tLޑDD$tEt$lS>H 1QAL'1H5dXZA;]x74LjH L ͏LDHLPKDd$8Lt$@Hl$XL|$HHT$0HD$PHl$HHT$ HHD$@H+HHDH9\$@uHl$Lt$0L|$8Ll$Dd$,IHl$ HD$Hu1HXPH;H2HLHL9uM?I9IWH9B@uAD$LE1uAtNhtE1@u>HPXHJ`t.HHHH$HfLhXA$I\$@Htf/L\HI\HLH=RH1ȶf/0H8ID$@HOXL`IL=a|1L1LT 1ɺLsF=!:A6fDH(ODLOIZLH$H$H|$HBHD$L2HBHD$HHT$HH5.pHEPH8!E H0P1ɺLLS H%H*HE`CI$ LES 1ɺ1LHH NH2HID$@HDHP HtHHt LILH(ULSL12ZYIT$H5rBHHDEt 71LID$H\$@!L9CH{WHL9u-f.HMcLIJ=HEPH8EuiA!DHLH=H1H5sLt+H5l LtH5\Lqu>DjAL﹦hAO1H5H_AXIm@HDfDc ECfDL蘫LsCdLC`LIm@H:f8#L7fDH5.LH5rLjfL1H5蠼f/sDKhEHk HCfHC@HsLuhf)7Hp)HC@H8HS@HLAąL= 1ɺ1H50(fDL)H51E1蹻@f&A}DLDCX@LIDL< 1ɺ1H5|7tfHC8SC ftXH i HKKfVLy1H5輺1 f&uzL&< 1ɺ1H5yH!HChH[HFff.fAWAVAUATUSHHdH%(H$1HHHHIII1HIHzLI} gIHL趾I}HXHgHH$HxLHHILHLHH) H)։HID$/H>ID$HH8I}LxLgHLHH!LI$I}LxLfH|LLHID$ID$H$dH+%(qHĘL[]A\A]A^A_7/$ ATfTfD81E1LH5v1i@I$L 1JH5AI}LE1t%HILj1S=H5E1豷LfLa1BH5|ID$BfID$2f$ۉATTfDFIօu]t9EHiH (iHHDȸL5HD5DL'H h@x5f.AVHiAUIATUHH(HNHdH%(H$1L$L5L|xILt$H}PLLkHtLHT$ L1萸AătXLaH5;1E1H$dH+%(H(D]A\A]A^L$ H L1vLx1LHLHuLE1亟H5WaͿff.fAVLAUE1ATUSHI9tKHE@ELt-HH@HZLd Ct*tmHI9uHmL9u[D]A\A]A^H;HG`tĀt @tH<A묐KATDOfDHH@H%HAsA[]DA\A]A^ff.HHH9ATE1USHHt HG`uwQLtaHHRHX8H,tDHH9t9H8uHxHG`tĀt@uqAHDOH9uD[]A\AĀz,1҅IAfff.fAUIATUSHH!aIHI$IIID$H9uP@fH@ @HSI<$HPIT$L HPIT$HID$HH9tQHCt닀tI}(`Hu1E1L)H5hHL[]A\A]L1H5{6H M $H5[7 H=l7 ŴDHW`HHt]H9H:tH1Hu*ÐHzHW`tƀt@tH1HtָGatxBH9uSff.AWAVIAUIATEUSHH(H9F`$D$ H1AD9tsHK`H݀HLL9H9t^EIF@1Htf/LHLq"AąvAH(D[]A\A]A^A_fDHqHN`tŀt@uHYEtHLL9HfDLL$LE9HSPDSpE1L $L\$D7L\$LL$3HI9J1HI9u1DL$ MDHLL$AL$-E1L衎AąL21 1ɺ1H5腯H(LDA[HX]LA\A]A^A_L0 1ɺz1H5t/jf.HHH9$BtD$ 1f$1ɺE1L_0 H5L1H5] 藮L#0 1ɺ1H5E1sff.AWAVAAUIHATUHSH-HH}P)HIEt%HAEat H>AE9*HHIHuIIL9LMt]AFatVH9tJLE1LHxAƅu,L/ 1ɺ1H5[:fHEau21H Aƅ5AHD[]A\A]A^A_DALH1LuAƅuLz. 1ɺ 1H5ͬHP)H5IL@1虬HHL[1]A\A]A^A_Yf1҅H EHE1E1BAƅL- 1ɺ1H5k&L- 1ɺ1H5DE1L|- 1ɺ1H5ϫf.AWAVAUATUHSHdH%(H$1Ll$L}Edu:AH$dH+%(QHĨD[]A\A]A^A_LuHH5iaALJHtL)L|$1LHHLJHt HH}PLUHHxHL|PHR'LIH51蛪"fDHE1'LYIH51^fDJfDH&LDIH5X1致AWAVIAUIHATUSHH!DK EH{?tH5X GgH0In`HHHHHH{H5AąIE@Hf8))L1H5O DDCEDH{?7Hs LD Aą!LU* 1ɺ1H5訨CChALhAIFPLMtH5LL $Cu KhClF9t DQ-DShAwE&E9t1MNHL&11H5!D$اIn`D$t DKdEKC AACu s1҅OLD$5D$L 4 tEL t9L s[t.AL18H5bV 4D$E1H5a11ɺLDT$ H4$IE@H4$DT$ Hf8,AFaD9s E9E9D9LADHLL)DAąK\L  #=I11L2H5AG)DAL' 11H5aHD[]A\A]A^A_f.HHAbL I H&H5LLDHH6 E1P1豥^_DHIn`H L`6AL $CE21E1LH5f!@V1E1H-/LHH1LGD9AE9LE1!LIH51fE =I11LH5mA'fAFaAIIH9t1HH9uLH4$p H4$LI+1輣H4$PfDEA)DShA@H5A1L5H4$jH4$L$ 1ɺ1E1I(@IIS`H9;L!1H4$D97ChHAvHEH5L1Ht$謢AZA[H4$9L$$ 1ɺ1H5wVfIID$H9TIFPHHs`D$DLHxjDڃ /_1AXILY1H5.D$%H5LKH4$躡H4$KAWAVIAUIATUHSHHdH%(H$HGPHH$1H9HD!I}L%L֫ADžu_H$H@@HtBf8)t8)t.Lo19H5?DAEAEhH0I#F`Iu HHCIM HPHq@uH9tu AUD$L"LLL#ADžH$H@@Ho fMD\$EEpE Iu AmdIu uAE`HAM(AU,WLPAEtPEM|H ADž LP=I11LNH5蒟A>f.L~ ADžL 1ɺA1H5LH$dH+%(4HĨD[]A\A]A^A_H9A1L 1H5(AMPHC@IH9,HPBs@LAUhAMlDt)ЍzEA1A9D$ERAEt qIED$8AE uAEt3I}H5NM DT$跨DT$L^oQAEE}EHCEEHPHHE:t{Lt =I}?H5. HT$ DT$H|$($DT$HT$ H|$(LDT$HT$ H|$(H5K DT$AHT$ fDd IAMdH$u uA]`Ee,ML9AELH LDT$Hi>HDA9HHT$HHBHD$ JDT$ AELDT$ IHH9HGDT$HH H H H HT$(DT$HT$(HLL$ HL$E1H=~DT$sDT$Hp(mL 1ɺM 1H5 `L+HLo IH5c 1&I~PgLP+H|$0HsADžI~PL|]ADžI~PHrtI~Pd1LO 1ɺ 1H5 E1蟉NH|$0HADžL 1ɺ 1H5 aLLݮv IH5l 1/L 1ɺ 1H5D  L 1ɺ 1H5 LfL IH5 1豈`L4L6 IAWL=AVAUIATIUHSHfDI$I$HD$H9øHDID$PHHt%at1Hf LLL!LuA>HCHE H57 LluuuHC@ ]it+HE H@ H@XHt1HLЅLuLLu_LLtPH5 =Lt=H55 Lޑt*H5LˑtUuE DIE@Hf8Hu HMtHUpLLM|LExY9LuLLbt>H5i<LOt+H5W5 L H5aLވIE@Htf8)t M'HE H@u RHLzH[]A\A]A^A_I$H9D$@HpHu Epo@Ll 1ɺH5H[]A\A]A^A_DL4 1ɺH5ɴ艄H[]A\A]A^A_H53 LIE@Hf8)MH5P3 L軎H5y L褎HE L LH(1H5ԃH[]A\A]A^A_1LH5蜃L 1ɺH5sHLL[,IE@Ht(f8)ufufufHuH5L覍tHE @LL ILkL:ILJ%L۳IIE@Htf8)UfGHE H@6Ā-H50 LH5ĽLLcI,AWAVAUATUSHHdH%(H$1HH92IH~PHIDL蘴H8LI-H1ɺfAVI1L5LLpXHZAt AD$cH$) L|$It$HH$LCkL1ɺLILߪ1H}PZitH}P[AL[ 1ɺ1L貀E1f.IE@H5f$'1L̩1ɺLhIE@Hcf/UǃLH(D$ L 1ɺL1DL$ H$dH+%(UHĨD[]A\A]A^A_ÐD$ Lh 11dH5DL$ @LLLD$ L" 1ɺbIE@Htf$fL1ɺzLIL 18H1ɺ{LIL,1|LGEDHLIuLH={H1U|LHI1S, 1L[zXZHLAŅH*LLI 1wzf={L- L1LDzL 1ɺ 1H5\z*fLch6sfHXdH%(HD$H1HtYHtTo&ooWoO 'onoG0HG@oov w o~00HV@HW@HF@VN F0HD$HdH+%(uHXAWAVAUATUSHH $HH $H(L$ HIԾ1HLl$`LdH%(H$!1PL1H$1HHD$8PHHD$`L9BHHT$@Ht8uXR 1E1LzH5֨xH$!dH+%(H(!D[]A\A]A^A_DHADžH{P1LHhHD$N/VH{PHD$H9ht.`H{PRHCPHhHD$HD$@HhH$HL$HPPLHH1H|$LHguvHL$HVuHt$H$H|$HFPLNHL15 HT$8LH D$8H Ht$HPHcHL`HL$PHcHL`PH Hc҉D$8HHL`HL$HL`8Ht$@HHT$<LHFD$$9HI9HtH$Ht8'fDH|$@tHH /H|$tHH D$$HKHH|$1HH{PHT$Ht$+HH{PHD$H9hL$ L1L-,H1Ht$@I9HD01HHt$@HH F`HT$HHF`H1Ht$I9HDHT$Ht$@1HH|$@HGPHhH{Pf]tH{POcH|$@c1ɺ LIL?1tHCPHHH9A1HH9uAHI9H1ɺ LIL,1@tHW L7IH5P1E1tpL 1ɺd 1H5$sIf.L\ 1ɺ` H5s@HD$} L:LHHmfLɟ1j H5\sL1p H5q,s1ɺu E1L H5>rhfHD$@ LLHHL- 1LrH|$6qHH[ H|$)LLI 1vrDl$1ɺ t$LL$L1LOoY^^QzHI9SLHD$HI9HPI9t$ PL-LHCPsHL1hoH D$$Af.fAWAVAUATUSHH $HH $HL$(Ll$@HHLIԾ1dH%(H$ 1D$0HHFHD$@Cft9HHH9TH LV@fH$ADžyHICe EIIHL$H9HHD$8HD$@Ht8uVLo1 H5O nH$ dH+%(H!D[]A\A]A^A_fDH{P1LHhHD$$H{PHD$H9ht. VH{PIHHCPHhHD$HD$8HhH$HL$HPPLHH1H|$ LHjHL$HjHt$H$H|$HFPLNHL1HT$0LH裩D$0H5:HPHcHt@Ht$ PHcHt@PH5Hc҉D$0HHt@Ht$Ht@Ht$Ht$8H~HT$4LHD$,'H|$8jHHЄ H|$jHH賄 D$,INHH|$ 1Hf裒H{PHT$Ht$ c!HH{PHD$H9hL$(L1L-"I1H9|$Ht$8HD1HHt$8HH F`HT$HHF`I1H9|$Ht$HDHT$Ht$81HOH|$8HGPHhH{PSH{P^EH|$81ɺ LIL1ljIH9D$HA1ɺ LIL1(jHH9ʄL@L H5#1E1i@L\ 1ɺ! 1H5if.1ɺ E1L H5~iofHD$L E1: H5LHH1@i1L1' H5YiLy1- H5)h1ɺ2 E1LU H5hHD$8@ LJLHHL-ʘ1LhH|$fHH YH|$LrLIW 16h'H|$8P LNIxDl$4HHF AUL-%ILL1gZYLRL` IH51gL" 1LE1t xgi1ɺq LL XgHH#F`L 1LE1| "gL-QHLJhHHp`(H#H{P[L{ 1LE1 fLX 1ɺ 1LfLL$ L |e H5ȖftL 1LE1 `fQpfDAW>IAVAUATUHSHH(LnPdH%(H$1Lt$ LHHBHHD$dHD$0H$FpD$T$IH$H$DŽ$HDŽ$DŽ$ DŽ$(H$H$ǹI9HE@H fHpHD$Ht$HT$IH&gAąHD$MHD$pMtLMeHH1LH9HDvAąH5iHH$H#LSLL`IHA1ۅLLHAąIG`IL%I F`IH9HD$HDAą+1LCAą6LL-GLI=EeLHI1AT 1L1cXZA.f.AL9 11 H5ѓcH$dH+%(H(D[]A\A]A^A_HD$1*M LLH5p1E1&c@LXI9tLH(Aą-LL貉IHLYaHH~{ AąH[5itgu cu c ۆfDL L?I#L 1ɺ 1H5|7bfL 1ɺ 1H5Tb~f.L 1 H5!aKLXL IH51a@1ɺ E1L H5vaL11 H5LaL1 H5aaL 1ɺ 1H54E1`[H11ɿL\  H`I1H9|$HD5LLH/L^HH$y L\tLH7 H1L 0`L^HHx AąHLLLI! 1_NLf 1ɺ) 1H޿_,1ɺ, H޿L5 _ LP:8L</ H޿e_iff.AWfAVIH AUL-;L ATIUHSDH(H$`L$(H$.DL$L$HD$ dH%(H$HFP)$DŽ$HDŽ$HD$1EHLLDHIL$@HH$HHf/HL$1ҾLHL$$P$$T/H$Xt HE`H%r H-HD LIH5.1]E1H$dH+%(vH(D[]A\A]A^A_1Ҿ>L*IL$@$PH4DŽ$T17f.LLuHD$HtHD$1H$LH@ PXuNML LB +DD$L 11A H5@\DT$ HEPHHt0]t'1Hb; HL!uE1HHD$XD$/D$/D$uD$0ID$@HfLL$M5 HD$H$LH\AL$H|$LLL$8LL$8H LhM~ L9M9 L". IU`@ H1HHMMt H$LHT$8oAHT$8t MA$IEPHHt%L[t1H9 LL-HD$HHD$8H~H|$8[D$\HD$HHD$PHD$`HD$8@H$H$LHD$@H$L$PMH$HD$pPHt$L$(_1AX L UMS AEp$HD$DEpHpXFAVLAUHL$L$Y ^L` 1ɅrD$M EupE9H1ɺ $LOPHHHD$P1pY_LAXL6IHLD$pLD$pMH$HH1H|$hD$LL$hHt$@11L XID$@Hnf/`Mv LFWLHkq D$0 D$CAup$HT$ H|$ D$EEc HHtHHH9tHD$ HHt$ MH@H F`IIn`-I9HD$L$LL$$IG$$иIEPLHHD$UH|$Ho IGL L$ LH LL$0@H% LDIGHHH1}LL$0NI}HLLL$0LatHT$0H|$1LLLqAHD$LMtLV{ E1|$ 1H@5Hp H RH LHD=dW1PLL$x1Ht$PUXZD$(t|$/tLLÅLH|$`1L$U$LL Y] LPLD$HHT$pHt$ A]A_LD$8HT$`LLHt$ YH|$Ht[L$`PD$dL \ LLPLD$`HT$XHt$ ZYLD$PHT$HLLHt$ H$Ht Hxn AHPSLHum 4HD$A\ LкIDH5̄1TDT$LD$0DHDŽ$E1D$\HD$HHD$PHD$HHD$8HtaHQTDŽ$HD$`HD$8WD$l L$Lij&fDHD$`DŽ$L' LIHD$HD$\H HD$8HtHdXHt$LpH~L/HD$@HtHt$8LHEaLEHLLD$8$XLpHD$LHxHD$`HHt Ht$8LaD$/oM oU0)$$HD$@)$HD$8HELt$Ht$xAVH$PH$PAUH$PD$HL$HH@1ɺ L H5E1E1:RHD$HHt9dRt0E&Mt"M MtA.H$H HxVE1H$LLH$L$L$(xL' 1ɺ 7Dt$0H_HSH EHDMHHHDHL61R PH PL$1Ht$`QT$PH Ht$@L(11 PLp| L_IH$1HHD$L狐aLD$ L/ IHt$hH=۸1T'L HHƄ$dL$ H$p$$ L$$LD$0$$DŽ$($HD$ HDŽ$0H$H$H$H$HEPDŽ$HH8$(DŽ$THDŽ$ LD$0HH$ H}PLtHD$0HR HD$0$HT$ H|$pp.DL$EFLuPH5"I>IH I>H ӭ1H3IH HH E`L HHH9 @LLl$0LxLǀHǀHv L:IH}1 LH޿L=MH޿L 11L LE1HLb1ɿR PHPL$1Ht$`HLD$PH ELHL9t9M1M6L9uL1Ƀ HI9uGHt$@Lȳ11 KH OV 1LL1HD$ HHt$ MH@H F`IIn`%I9rHD$IGID$@H0f"*1LHL$PD$$$D$^^L _1ɺ FL$AOTIFh1LHHHH|4ILJlLDL$E1E11DL$ LH5zAQI1AVqJXZ0IIm`*LLqL2 tZID$@Iu`*HD/$jA11P1LD AZA[Ll$0'L< Ht$@E1E1IIUHHt$IM L5LE1E12Ht$@L1I* 1}I>LG E1H|$1XH|$$FH HD$LHPXyHt$@L 1ɺ HE1HD$ |$HDž Idž Hǀ IDž |$(DHD$8|$XI \HD$`E1HD$8HD$H$LLHHXId 1LL#LHIHEHt$@1ɺm E1L E1HL9MHH54jL$$Iy(LL$pLD$xWRLL$ptH$H$LD$xM9IMHH5fIy(LL$pRLL$pMI(Ht$@1ɺ L1SG[LװH5Q .GL 1ɺ Ht$@1ME1 GHD$H% Ht$@L| 11 MFLZ 1ɺ LJ 1ɺ Ht$@ME1F\H|$H&H$HxL 1ɺ 7PLl$0L 1ɺH5P )FHD$LpLAR1t$PHt$PEH$A[[1HHt$@ 1L^EHt$E1LLM LZ||$XE1%IGLTH5P LHH1UE"E11+L 1ɺg Ht$@E1E1#EL 1ɺj HD$L LV1t$hHt$PD_AXH|$Ht1lH$1HL? 1ɺH55O DaHD$L[ LAR1t$hHt$P]DA[[1H% Ht$@1ɺ ML )DHD$ 1L>LU1t$PHt$PCA]A_Ht$@Lo 11 CHt$@LP 11Y E1E1CeL+ 1ɺa TLHt$@LݭI 1aCH|$`H|$HwH$HAWIFPHHD$8HH|$8AJCHD$`HD$8Hx! LLLMVHt$@LI 1BHt$@L% 11 BL 1ɺH5L [BHt$@L 11' H]A\ff.AWAVAUATUSHH8W\Ht$(HvPHHD$ HC@HfD$ft$H{HfHD$HL{HHkHE1I9u.LLAaLHHD$H8M?I9fAtMxM<HL$IcLHHD$CH{LpLHHuHD$Le 1ɺHHG`HE1HHHD$ HL 1ɺH5mt=RDHD$(T$E1H{HL$HpP9HHHT$ H|$(1LH AEH8[]A\A]A^A_@L 1ɺ1H5,mHD$dH+%(uff.@ATIHUHSH^PIHHtEdtQLJ1L%dd1L4L1L 1ɺl3[]A\uH@X6L @cuHHt/H3t#Iٹ<Ljf.H(t1Hwn_ID$@Hf$HL%cԯ1ɺPLIL 1$3HtEdtDL 1ɺ11H5 2L 1ɺS1L2uH.tHB=3LI11LU2[]A\f/H HHخH=H1' H}HLY;ID$@Hf8#D#AG=w AGDtpL-`L41Lc01L 1ɺLF0@AL-'fDAupH}PDHI|$E$DA$jL-`A$$M$ѼYL,^I11"L/HUPLHHT${HT$HLPMLLT$LT$LLT$ɬLT$HLëL\LI71/L-<_IٹLuL.xLd 1ɺH5^.IL-^1ɺ1L$ L.11Iٺ<LLLT$S.11L0>L6.ID$@LT$Hf/HLT$,LHF LT$HHH9HH@@@u/LLT$HLT$tEa DIL71LR1LT${-LT$H}PLT$H`LT$]ARpLDHLT$dLT$Y1L jIٺdL=^.L/11,L-$]Lu 1ɺ L,ff1ɺ4LL= ,=H1M%LLps,XZ 1HLT$H=˔FLT$;HHHH9+;L-Ht$ H8D$ 4LHL覹AEMHT$dH+%("H []A\A]A^@L?Pv ?L9HLLE1IE1HP!^_'H\$LHGHLpMyAFd L辛L If.H5DO1ooHL%$OHqHLLSI1ZHY?L0LI1fL 1ɺH5NarHD$Lӟ 1ɺH5mN1&@H-L衚HLyUI1H5*NAXAYHXL|IH5M1@L$ 1ɺLDIٹLe~WHH$HH,1f.LșLIL 1ɺH59Mh@HxLIIٹL̏*'f.AWAVAUATUSHLnPdH%(H$1HG@H'fHHD$ H HHT$ IIH\$ LHHlLpM_L9LLmPH]`;PHH"HH,LL=K9HLUIR L1AXAY1L 1ɺ1L`H$dH+%(H[]A\A]A^A_LpPIF`@uOAut}ItsL{g LI1DH-F @LH^ LzIL=J1L fAuwH%H-HHMHL H|$0LDH 1@u LHEPHHt1<t(1H HLL=JXDIFPHHtg1H: LLkKL L"IfL 1ɺ#H5IQHD$ 1L 1ɺ H5[I@H萕+LGI1H5IwLPX L/ IIٹ&Lxf.HȺHo LILLH0 IIHD$Ht1HTHD$tI HD$Ht Idž HHH9øHDID$@Hf8#t%D#D9[TtHH9D[Tf/IHt$(H HT$(LLLH.HD$(HL$LH Lf$HCD\$DLH@ @D\$HD\$It$LHD$lsTLIlHT$1LI1R AWL=FLkLΚZYD\$RID$@D[THLŒHI躒LH=H11ADHX1H;2D$HtHD$HD$(Dt$L->MHD$HD$,HD$oLx:t$)M(L=ULF11 =;LLQ11) Dd$H3D$(D$,EtHL$H, HP8L L1L1h HH31jLL$HDD$8V"AZA[IHDL$,E`HsH H3LxM&H{HtL LrEfHT$PLH)D$P)D$`ytHT$XHD$`II)H9I$Ht^>#tYH(DiEt2  ui= kAD$,tI|$@AD$,?I$H }L1ɺ#L  LO8t$HL$H3H H1ɺ&LLQ @Dt$D$0= 8LLB11y IIH9n&HhLHD$pL+AEhD$0tHt$1HGxL薇=O LI1ɺUL+1 AfDI$H>#tzHDT$M DT$tT  u ~DT$ QAD$, I|$@DT$AD$,SI$DT$fDHDT${DT$LDT$d6D$DT$uWElf;.fDDt$LL1 E1H3HL$(HDT$HE TDT$u1ɺ[LL p DT$_fD1ɺWLL݊ E DT$ L1L DL$E}H3HL$(H H^1ɺ[LLh >L1LRDt$E1LLD$Dt$qDT$I$LILA,=IAٺAHL=01ɋD$L |LP1AZA[DL$ELID$@Hf$/fD$)؉$$ACHDL$dDL$T=L=m/L|1LDL$HD$EL=7/M1HT$0Ha>D$0 LHI9IU;B ID$@Hf/H{IUHHB HwHHkLSL=.1ɺDPDL$@1LL*y5XZH1=ID$@Rf/u(1H=yzVLyIL=-1LL 1ɺDy=L=-ILCy1ɺ1L1*1ɉD$L=S-1L~ >L11L~ L$DL$"hHHy-LOvIHHH9$V=L=,HHLx1ɋD$0LP11ID$@AXAYHy1H=x11ɺLLc AIq^1ɺLILe1H5XI$^1LeIH5)1I$HHH9LDc 1ɺ1H5AL51ɺ1L5cLmD$sLHHX1ɺLLb +8tIPԻLoB1H5 L1Lc1LL/cD$LHH91ɺLLa fHL$(LL$0HLD$,H5 S D$(v|$,~=9L5{L;a11LDL$DL$L@\LI5\LH=`H1聶HT$ dH%(H$x1H|$0HHIvHHDŽ$DŽ$H$IF@Ƅ$DŽ$L$hHDŽ$pDŽ$Ht$HfLHHD$H;\$<E1LHD$H-}EI7H|$mAIcAHl@HH;\$ftHhH}@tI1HLL HI?1HH/ H.II9uDHI9 HJH9A@uH|$JDE*AHIE@IHmf/_LT$A1ALaH5+ 1LEHt$IHD$HHEHt$EI~HL$@DLA膖HHPHD$ H$H<HHHH13LaRHL/Ht{HxttL$1LH;HHHHD$ LHHH1L[aHLLxHHD$1HI~AH$H$pMHAA$$DjHt$ Eof=IH- H$1LaH1*H$hH5 LH$pH$hXZZH$0HHt$0LHHt$(HHAI}LA$jMELT$HeYH_HH=_1_LT$8YEd 'H)HEPLD$tHDŽ$H$';HL$|HT$xLHt$tL$L$褫HD$H$LMtLE1hL$IMH1H!6L^1LLL?Im`4HL+L=!1LpU Hú_HHD$ID$@Htft HHD$H$L$xLHD$PH$L$$HD$(D$|D$ D$tD$ HCPH@HD$@HCXHD$8HI9IH@HD$XD$$DT$ ED$ DL$ ALEt$ L( IEPDE< IMhC4H9 D$ H|$EHD$H H HD$`1HHt$HHHPHH@HH H9HGL9IB1HIJH)HHDHD$Ht$8H+L$LHL$01HHD$0Ht$HH9 H|$( H|$(H|$@HPHHT$hHD$HH HT$hHt$(HHD$PHZ Hf1H] H$1)$)$H$)$kkHHW H|$@1yHD$(H H\$8Hl$@H|$(OHD$(HXH=HHmH#HE 8uHxH5a uH9k Hf.HH@HtH9uH@HAwf1H[ HL茕L@R 1ɺ H5H$xdH+%( HĈ[]A\A]A^A_L=LQ 1ɺ3L>1LQ 1ɺL!f.IٹL01H5.OM MLLxIEPLHx}HHtLLHM}HLLpIEPLHxf}HD$HtLLH~AoM AoU0I)$)$f.LKH=WH1I3LJL/I LO 1ɺH5!GL\O 1ɺ6L=LH$H_Hx{QLO 1ɺH5iLN 1ɺH5y9L/1H5 LN 1ɺeL=1LH$H&fDLL=9ILTLIJ1H$H2LM 1ɺNL=fDHSXHLD$ 6D$ )fDHt$8L:D$ f.H\$8LHl$@~HHIsHt$01ɺIHD$LUPP1AUL$LH H2HH1ɺID$LLUPt$XD$]ff.fHcAHG@Hu*LvIJ4HJ DQ(fEMcO[ILfx(F(fDP(HOHHHH9tZIcL RIHAJr(ft/Lfp(H2H0rpr p HrHpHrR HpP H H9ufF(u@JDHLNPLM1) H5t^1HHfDP(HQPQ P HQHPHQHPQ P @HHG L aL(tH5tHLE11HATIUHSHZHvPW\H;LLHHH7AăC\u 1ɺEH5ϼ]A\A]@ATHAUHHRtHD]A\DHA9LQIH51^HD]A\ATHIUS-ÅHHLHH,jRu>HIT$`Hu*Hx%H-HHw (Hr []A\fDHH+LHD28HUILI1H5vX1Z[]A\DLQAEuHIT$`Hx12@L7LIH5H117f.I$I9$DHHW`E1HHL PÂHff.HHQw\E1HW`L P~HfHHW`E1HHL ~ PCHff.HdH%(HD$HG@HtftOHH$HHHIHL  E1PԁZYHT$dH+%(uHD1ff.@HHq2E11PE1胁Hff.HH3E11PE1SHff.AVI1AUATUSHdH%(H$1HH$HLD$DŽ$H$H$GHILIL`LIHIV`MHL LP,5%ZAYH$H9t>KD$X1LHsAȃAAHA9DLH9uLLFH$dH+%(~HD[]A\A]A^@qDLD9 1ɺH5A蓷됐Lq$1H5Afkff.AU1ATUHHdH%(H$1HHH$HD$DŽ$H$H$zHIHILhL|thHHU`MHL HP~AXZLHܻH$dH+%(uxHD]A\A]fL7 1ɺH5A;fL#1H5QAu|ff.AU1ATUHHdH%(H$1HHH$HD$DŽ$H$H$HIHILhLt`HHU`E1MHHP`}AXZLH耺H$dH+%(uiHD]A\A]DL6 1ɺdH5)A릐L!1[H5A趴/ff.@AUf1ATUHH dH%(HD$1)$HD$HtkIHHHU`ID$u\HE1HMPK|LHAXZkHD$dH+%(u?H D]A\A]fDL 1]H5AγGAUf1ATUHH dH%(HD$1)$HD$HtkIHHHU`ID$u\HE1HMPk{LHAXZ苸HD$dH+%(u?H D]A\A]fDL1tH59AgAU1ATUH]HtXHIHU`u\MHE1ɀH|EPzLHAXZѷD]A\A]1AL?H5FD]A\A]ff.fHHAEt HfD1L3 1ɺ}H5,Hff.fHHHF`t2H$s3tbHËuHݻDH$rHuL3 1ɺ}H5V1L2 1ɺH5l'xff.fAW1AVAUATUHSH(dH%(HD$1H\$H$H\$H\$]HIIHu\LhHU`E1HMHPxY^A$tdL|$I9tZL-qbHE@1Ht1f"@ƋquMOLHLy.M?A9DLI9uLHcHD$dH+%(u?H(D[]A\A]A^A_ÐL1H5AƯ?ff.@AUHATUHSHÅHHDHL$HEt HE`uGHE1+L<IH5|15HD[]A\A]uu?uuHv1AŅuw:Hs/AH[E1<MH#HLD*+HATI1L;H5mXZ1fDAWAVAUATUSHH $HXH|$H\$0HHT$Ht$dH%(H$H1HH\$8D$$ H\$0$YL|$01I9D$E1Ll$(Ld$,/f.=A1|$,M?I9t;IGLLD$,D$(Hx@tыD$(=uD$fDT$EEtf $ tDHD$H@`H%H&_H1HD$H@`H%r H&- $E$%uP=L;RDL$1H51聬AXAY<$<$HD$AH$HdH+%(HXD[]A\A]A^A_fDH|$A(Lv IH531f.1E1L9H5蹫b@Ht$HL$Ll$@HTLHFPLNHHhL1C D%E611Ht$$L;L%v $LL\:Eҁ$AɉR%=8P11۪^_H|$S'1ɺ#LIL_:1裪1L:1ɺ$L濄膪HD$H@@Htf/4$1H=:IHMemTotalI9uA:u1HT$H5[LҩifL踲HT$H KHIFHH H H9HHH{HIt$hjID$HL%L31L濄IXZAUU1L7触KTY^HHHHH9dHC@Htf/M1H=7N} HDH8HtH@HH?H]A\L 1ɺH5D1ff.fATAUHH.H5 HMt>H5m H:t+H5 H'tH5-HE1AHD]A\UH.H5 HAEtH5# H͙]ATAUHH.H5' H蝙t+H5CH芙tH5=HE1tAHD]A\UH.H5 HIAEtLUvtKlu}vtpptSH5OCHAEtH55CH]fD}gu}u]f.}vu}u]D}u]ff.ATAUHH.H52H}H5 HfH52HOH5 H8twH5EH%tdH5> HtQH51 Ht>H52Ht+H52HٗtH52HE1×AHD]A\fATAUHH.H5AH荗t+H5>IHztH5AHE1dAHD]A\ATAUHH.H5AH-tdH5HHtQH5gAHt>H5aAHt+H5^AHtH5YAHE1˖AHD]A\f.HHH2H8雖ff.AU>fATUHH@dH%(H$81H|$@Ll$HD$0Ld$@M)D$)D$ HLHHD$PU1LH@1HL$$Ll$IHHHAE1ID$H$11PHATjH$褘AH$H HtHx8HDŽ$LH@H$8dH+%(H@D]A\A]fLL 1ɺ8H5?A蛊fL 1ɺ=H5?AkvfDLA1EH5g?A6A謔ff.AU>fATUHH@dH%(H$81H|$@LD$HD$0LD$)D$)D$ HHL$@HHD$PƄ$H $j1H(IHHHAE1ID$HE11PHATjH$זAH$H HtHx6HDŽ$LHsH$8dH+%(uoH@D]A\A]L 1ɺH5>AۈfL1H5=A覈~ff.AU>fATUHH@dH%(H$81H|$@LD$HD$0LD$)D$)D$ HHL$@HHD$PƄ$H $1H蘊IHHHAE1ID$HD11PHATjH$GAH$H HtHx*5HDŽ$LHH$8dH+%(uoH@D]A\A]L 1ɺH5w<AKfL!1H5G<A~茑ff.ATUSHH0dH%(HD$(HG@HVf!HHSP5^hH:sxLChDKpHC`1Ƀ{tAE1E1HɃHUASVH5< Q1AQLhAPLARATP1RsHRi?H`HD$(dH+%(H0[]A\fHHE1E1j1HjjH HSP $sxCtLChDKpH:1ɃHC`l$E1D\$ DT$HɃ|$AIL AfDH0HSPH:׏AWAVAUATUHSHHHG@Hf!1HHHC@H`f)RL% 1ɺ1L:LфHLL=9L59L9HI11L9L{HCH@ Hxpt;HEPHHHx1ɺLIL919HCH@ H@HtHHI9t[S C$MLLU9ЃEbPME11RHSY^HB Ht HH+LJ(*fL,1ɺ1L裃H[]A\A]A^A_H[fDHG@Htfɀ2fDATSHHH6dH%(HD$1H|$et1D$ACC HD$dH+%(u7HD[A\fDALY 11H56謂%DATSHHH6dH%(HD$1H|$3t1D$ACC HD$dH+%(u7HD[A\fDAL 11H5C6蕌DHH6PHHfSHH{t { t [f.1L07H55蜁1[Hff.@SHHtS v[D1LH5C51[Hff.@SHH{t { t [f.1L06H54蜀1[SHHt { t [f.1L5H5c4<1[SHHt]{ LtaH9Cwu[ L5t>1҉A uvSu [L1H531[ALI1H5}3V1[fLQff.fSHH`tS v [f.1Lj?H53~1[H@SHHt { t [1LY4SH52t~1[SHHt { t [1L&4aH5K2$~1[USHHH.U@uUH1tHtH+H[]ff.SH>HF E1t C AD[@HF H>yHff.USHHH.H5 H!tUH5 +HuC H[]Ht1{ H[]C H[]DHH>PHfUH-0R 1SL .! HL2HhdH%(HD$X1}|^uK11L W L2HO|HD$XdH+%(Hh[]H1ҹPH542HOHtjIL921HT 1{]iPHTIL 21HV 1{/fD$O@HW@1HtHcHvHf|(fAW%AVIAUATIUM$HSHHHoM|$HdH%(H$81H|$HBHL$HA$oJLHD$LAL$oR fod$fol$ fot$0AT$ oZ0fo|$@A\$0HB@ID$@"jr z0HD$PL$HB@BtL$AD$t$BtBxAD$x$BxHBXID$XHD$hHBXB|AD$|$B|A$$HI$H$HHI$H$(HL$mH<$HmLHm1LLH+01LHLAŅtRHT$1LLAŅAH$8dH+%(HHD[]A\A]A^A_L 1ɺT1H5-yDAL 11QH5-xfL| 1ɺW1H5^-x[EDAVIAUIATUHHCt?HE`HLIE`5AątsHA]DA\A]A^fDHALHHbLUI1H5,xXZDH]A\A]A^D1L 1ɺlH5v,wHD]A\A]A^AUATUHSHHBcHIHL-,#=xLI11Lk~iwHC@u7HspL1ɺ\4AąAHD[]A\A]DHHxhtHxa3HH`0HSLHH@hHe`HDžAąuL] 1ɺ1LvtHA*LC1ɺyIH5+1vvHD[]A\A]HH{pHHLlUI1L$vXZff.fHtoATUHSLgHHMt L|uH]H[]A\f.HM)1SLH5*uX1Z[]A\fHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1LL$ H$$D$0L$HD$LL$/ЃLHcHO@HtH@Hf|(tHH(*VLH1L2 H5(tXZHT$dH+%(u&HLIHcz1~@SIHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1IA I<@sHW@HtL@IfB|(uffDHH=H=t=(~gt=u@Isf.IsH$$H$H\$H\$ D$0H\$ʃHڋt9Q/vHHuH1ARL&*H5&MHL )rXZHT$dH+%(u H[1|HcH&*LvIBD(t2HOHHHH9uDDH H9tJtf~(tFHO@HtLfy(t͋A1HIIv1IA@Ht/LAEt H1L: 1ɺ-H5ԡqHDAUATIUHSHH^PdH%(H$1Ll$HD$LHHE@Hf)Hp)f.HL$PH.HHD$XD$haLM@D$lMfA/1ҾH2D$pA$H|$PD$tA/D$xHT$PHt$HXrpHKXHT$`LH<1LHwKoID$PHHt%Ypt1HN LH4t$lHLHH-HDbH1SILT H1o_AXDL$lELu 1ɺ 1HoL$xu!LH=H1NFH!;LM@D$pM1H|$PD$tD$xHݨ HD$P%DLa1ɺ 1HcnfD1ZL 1ɺH5q1n.L 1ɺH5AnL| 1ɺH5mLL 1ɺH5m1xf1L 1ɺHcm`f1HL0m-wAVfAUATIUHHXdH%(HD$H1HG@)$I)D$)D$ )D$0Hf(tL2dHE@Hf8HL`HE@Htft1ҾjHD$ 1ҾiHHID$`H H ID$PHHCNl61HJ LH0H-Lo 1ɺHk^fDMt$PIHtoktf1H1J LHb0uNH-›L 1ɺHlk@1L 1ɺHKkU\ID$`$H LL莘6L==lI11LH5j?f1L&L: 1ɺH5ϚjHT$HdH+%(HX]A\A]A^f.LLWIH-x1H.jfLLIfL 1ɺH5!iM1LLF=jI11LH5șifDHE`H}E1LHHN%H!H-L 1ɺH3ifDLLIH-4LZ1Hhl@H-LU 1ɺHhAfH-ԘL% 1ɺH~hr@ATUSHdH%(H$HH@V,H HHH V4H5HEȃttHƃuH5 HLCXH=} HHEL LMIQLVLP1RH{pL<$LAA@tY1ҾHHt/=hMI(L,11H5R,gHCH$dH+%(H[]A\@III*f.1ҾHaHRtLAA@Q1MLFH5f1_fD1LH5Tf1.pAWAVAUATIUHSHHdH%(HD$8HAL0LhHhH$/lIL$@ H$f!!fAF4A$xAf+t+FAHEMFIVHpfSL1H5jLeL=f1ɺ!1L L(eL 11L eH<$uHhHt1LQ>AHH eA$0M~hMwLHHHXHHA$GHHSHHK HL PL k LY^HD$8dH+%(HHD[]A\A]A^A_fI@uAdžA$x*HUXL'0IL$@A$xAHFA1tHA9KHE1PL=qLo1L?cIL$@A[A_HEMFIVHpHLLr}ML$@MthfAx(t%E^,1ҾLD؃AF,hfA(tAN,fAtL3EEM~XMLHd H L@MEEI}M~`MLHLD$ H'HpLD$HFd YL9 3L=  1LOLaH}H5T IHHA fDIHJ 2H)sAHI9uLHL LL+IuH IuHQ AU }HIAMqHWHcH>IAF4@A$xAdžFA@MN`L}MLHLL$O LL$HQLXMDACe IG@H f L:L IL=1L_Lx 1ɺ1L_f.EE EH}LcHG@Hf&1L9  AFp1AAFpL3 @HAAFH ujH} hAAH5W_AXAu IHHNHEMFIVHpIFPIF`k L=LLZ^f.L 1ɺ1L3^#fDAD DAF0[AE^,HHH9fHAH9uLY$L]D1Ҿ@DD$)DD$"I9[IHJEFpDMNhL. H5h \DE] EI7"AH(\(HD$A‰HHHHAMHEL sH L,ELDL=1LY\L 1ɺ1L<\,AIH(\(HD$HHHHHI@ t|AdžAtUIEL=Lhp(AFpPHH HV1LSARP1s[AH0A5I^XH(EEE~xqLsEH|$-H|$DA;HEHHDL$HxjAIHEHDL$Hx$L<$=[L=yI1L~L1:ZAAZA[AVt9r1EMEAVpE1DӅiD)Ѝ9U=[L=HLO1PL1YEFA)^_EAEtEE IHBH)A^+A^t H)v tqELB(H HEt IVXH5IF`MNPH I~HHHDMLDH1APL0RVH5 WP1XH0LMtmLXtaA|$0CH5L cu=IH@5 EFE  HL ANDLH~HI~PA2H@HIFP%DAH(\(HD$DHIHHHHA9HEDT$DHD\$L= DHLHx$jv=XLEH$1LȂ 14W[A_D\$AMDT$D"HD$AAEED I^XH7 HHHH@HD$HH\$AvxH0AH(\(ACpHIHcHHHAMHD)BwAFIHd IHAutuo@u IFxEMHuXH}PjٿZYL= L 1ɺLUHIFqf IA^HBu I~`oI~XAI@L=1LYLRI> L. 1ɺ1LRuHEIMAHHxVIHgL=pL 1ɺL4RMI>n IHBfDL=L} 1ɺLQLAvptBt<A9v)Avpf. DLL=1LdQAV1afL  L"1 H5\ QA HHHH1H1IHHHH9HGI9IFHD$9LEAEMA$MxEDT$HMLjH L=xbHt$ HHEDL$Hx$1ɺQLI1H$LFOXAMZ\$DT$DL=L 1jLOL5 1ɺ1LO|M 1LH5*[ YO,@HEHL=bDL$Hxj$L}LIX1ZoNAf.L11ɺ 1H5Z Nf.AN IHAIF`IVHL nLIH5Hq(LE11R LNIAZA[HBA>LF1ɺ 1H5Y NH}HDLL$L=HjA[LP[IL1ML 1ɺ1LvMfAɺB1L=|LDy LGMfI99IHJA@dIH@L=L1LLfL\ 1ɺ1LLfDI@L=L1LbpL9 1B9Hr(L=XDHL1LuLAYAZwf.DL= Lu 1ɺALKfL1ɺ 1H5pW K^f.LL=1LiK @L H5 W >KL 1ɺL=J1LK DL=*L 1ɺLJfL=1ɺ1L\ LJgLy7f.L=L1LiJj@HMLL=\1L,J^_UDLHIAFIFXHJlH}A~L=LW 1ɺLIRLA1 H5UU IALL=1LQI@L[fIIL9dHH@HIF`DIFXvLwfI@?(f.LL 1ɺ}DH0LGIL=1LvHL=L 1ɺLNH>fyfDHt$HM؉jHL$A IHEH DL$Hx$IHEHDL$Hx$Y^AWAUIL=1LtLJ]G_AXDL=j1ɺP1L L,G;LL'IsLHHHtH@HD$HIL vALLD$#ELHH_LD$;LiLIhf.LLLD$pLD$LdLrI LL=&L 1ɺ3LEL=Lj 1ɺ LEL=LC 1ɺLEL=L11FLpELLLD$oLD$LL=e1ɺXLILK1EIHJIٹ2LÚ HMLbL_ 1ɺ1LDL9^LI OL=ff.@AVAUIATIUHSHAHtqH[PLH+Ht6LhMt-LLH菞AătWA[D]A\A]A^DIٹa1LH5CA[]DA\A]A^L51iLLCLBHH6\tJ1ɺLHPuLLLIm1AC+@LLaLIk1 Cff.AVAUIATIUHSHAHtqH[PLHHt6LhMt-LLHlAătWA[D]A\A]A^DIٹ1LH5iBA[]DA\A]A^L5j1LL)BL@HHZtJ1ɺLHuL脾L)LI1A+@LPLLI1Aff.AUATIUSHHH/G$E<+<-u2HC FHUHDPuH1[]A\A]D1@J LHI MI9,$tAUuH=vdCH9vVHH9HRHFHCK HSH[]A\A]fDHAf.CHfDSHHHdH%(HD$1HtH$1:u 1{ HT$dH+%(uH[JfDSHH5 HH;dH%(HD$1Ju1HCHT$dH+%(H[f.HH%tAH$8u8{ t2DKAvU1L:H5t?11L 1ɺH5vO?1dIUfSHHHdH%(HD$1Hyt%H$8u{ tH9CD1HT$dH+%(uH[CIHHdH%(HD$1H t H$8HT$dH+%(uHHfSHHHdH%(HD$1HtH$1:u { tHT$dH+%(u7H[f1LZH5=1cHUSHHH.H5dH%(HD$1H@teH5q Hn@u*C HT$dH+%(uDH[]HHtH$1:u1{ C GDSHHHdH%(HD$1HytH$8u{ t1{1HT$dH+%(uH[KGff.ATSHHdH%(HD$HGpu8D`Avu-HHt&H$8u{ tE1{A fvt+E1HD$dH+%(HD[A\fxguL#H5L>t$H5o L>u!C AfC A뉐HHEAąrH$E18bE1{ AR%FDATH5 AUHHFtH5w HEuHD]A\fDH5 HEtH52 HEtH5 HE1EA$Ro5C~*D+w"H}HcH>u ?v11}Df.~"tEu(t#u1D@fHgEHf.?p9v/f.f.gtDf.f.AWHE1AVL5)AUAATAUSH8dH%(H$(1H|$ HIcHD$HH,fDkE9|*DHD)DLcKH8CyD{E9}A9HcA)H5AmIyEuE9}IL!11H5[3D$D$A:wDH zL-PAHD$8HL4Lt$ A^AHAv11ILL2HZYHH (HH)f|DG|$(E1E1D|$N<#HI?1=uyAGupt D\$EtbAGH5ZeEOLV HHkFHLP1Q1L2H=)AYAZL_Hp)N4#IIz`MHD$ HHHHHH HL$0H (f|QH5fHH1L$H 1VHH Au#HHuH)HD$0DftHU@9tH(H9u1MH54Lt$L5AL1MEIAAtKEOtaEt=IefHEUHHH(H@H(H9s9uAHAI0@EtAuH5Lt$HHD$02H51.3D$L=Lt$f=dHTtlH5W 1T$2T$H5 12KvH5 HIT12H;H5 12 d9JH(LcsDD$KvMHAT#EWH5 142H5q 1!2W@1DD$H5o DL$1HD$E1DL$DD$ Ht9tKAH(A9ufD1H57 1A&M;1fDDD$DT$EAH5 1^1DT$DD$L1DD$H5? DT$41LcT$HL$DD$KH HJHH D2fH|$HD@H510DD$DT$b;b9.H|$00D$,D$uOt$(toHD$ @HD$8H H5 HH<*8tcH=7/D$D$HH[]A\A]A^A_Ë|$tD$L1ɺ#1L=-D$H=g/IL3L1-{H561/+DAVAUATUSHIՃtNH:1AAI|11EDH9HD[]A\A]A^@H:H5WH|$6H|$uHH= H@ @H;H "H9uH=Q.AHD[]A\A]A^H-11L H+H1L +H1L + )L%dif.HH MHHHH)pL18+9)XZAAWAVAUATUSHH $HH $HxH|$HHHt$/HT$ dH%(H$h"1HR/1H+HC@HC HHH5(HHHfHHH|$PHH|$0L )H HBHFLPH$`HD$(HPDHx t8LP LE1fx&AHFDVDX#ƒEAEH FHL9tJAHH@HLDP#EtDfx&tG:HH$`H|$PH|$0HHD$(HfL-))FH5 H0HHD$HD$ HL$(E1HT$0H0HD$8w2Ņ(?HD$H=0 E1A:@XL`&Dt~D{E9|6DD)DHHI|DLD)D\3yDsE9}H1AULH5(XE1ZXfAƒ:wHH5(ADHHHftHH5)HHHV(HH JHI(HHfAt4HWfAt%HhfAetHH)HHHL$8H|$HHL$8GE(fE(HfAtHhfAtH'fAtHfAtHӤfAtw#fAetfARHۦ\HfAI.HA+HD$LH5eH@@14%E1H$h"dH+%(Hx"D[]A\A]A^A_Ht$H!A)HHt$ HcHH릉D$HHLI 0H5L1$Y^DT$ayH  H HL UDT$HLhQPRH5a18$H DT$yA#H H HL DT$HL4QRP뒹L H5DT$#DT${@L1H5DT$#DT$DHHZH H IHH3H 8H I+H @ $H5N H=_ %-HG@HSfhHtLJ($t x.ftx+t#ǃǃ҉f tH q [fDAWAVAUATUHSH6LM@MfAX-t DžA/fAth(HxH_HFfAhtDžHDžHE @ t t(H 1҈:H 1҈HU JH HH ‰H0H/H HH#H H HE@HHt7fHfHtftH1Ҿ=HHtH5H *1f1ҾH H]@IHHf+twLc`ftvH5E L* L1ɺ 1LH5H]@Hut1fuH5 L!*tH57 L*fH5$L) L~Htf8fh  f%ҾH 1҈KA1EMH 1҈uHHH5| H*)tH5* H)HE@HHffHt)L MA<$FH ӿ HLLLfHHt :H]HLmHI9L=) 3LLHHtLHL9f0tLMtL,&H}HuLLeuL2@ H5v1MAHD[]A\A]A^A_D@L%ʴ H@L|L!H}LhLHLLLH*LHHE@LHuHU@HfHfDHDž۩H©HE@HHHHHH@HE@Htvft Džft3HH$1ɺeHHZHE@Ht%f(tfht DžHYHYHYHYHpYoHVYqHKHFHT$I4$ID$HFHHVHT$0HtHHt H9H-H1H5MPL1WTHHD$8Y^H;\$(H\$Hf.1L1ɺpH5DL-L|$8HD$8L0M&L9uKI$MM98IInH1HHHPH1HHHu}dL HUHH9HRPL1MR1ɺwH5LIIFHBHXZ_HD$0H@apXH=&I LQ HHD$(HD$@H\$HL Hl$@L-L9d$@DML$M1gH5M$$I9ueDH9H@HD$@L AWAVAUATUSHHH|$HH$L$dH%(H$1H$H$H$HD$xH$H$L$L$_]LDHD$HH@@HfH|$H$%=u>11Ҿu,LPk LH5zJHD$Hh2"H|$H$ !HD$HHuHD$Ht8Hu,Lh hH5OHD$H1HHHT$hH9t@HH9u0H\$HH3|H\$HHC@Hf <$ HDŽ$x HHBH9l$hLt$hL|$H HmI9LmMt1L` tIEH+L9"LH11H޿L1LLIHuA}dD IUHL9LJH1HPL1HHmXZI9FH\$H11H$L= IHHD$,HH$HD$`L+H9\$hLd$Lt$hMLl$HHkH EdHT$`HLiIDKEm)HK0HS(L HC sHIDHҍ~IDHIDfwHM 1H5))=VLH5VQ1RP1DŽ$D$ H H$IHt2II9u`fHI9KL;XufDI$LM9taIL ML$ 1ɺH5yH$dH+%(_-H[]A\A]A^A_Ld$HT$HHH9qHD$HH51HH@@HtH\$HHt$xLD$H,H$H$Ht$pH$H$Ht$`HD$8H$H$H$H$HH$Ht$hHD$H$H$CH\$hH|$8H$Ht$HHHL|$H$H$HD$XHHD$PHT$@H;D$8t~H$DmfAt_HD$@L9tUIH@Cft6fA9u0H} Ht'Hs HtDeD;cu?G HIL9uHmH,$H;l$8uL|$Hl$XHt$8H9Hl$HmHl$H;l$8f}uHD$@L9tIHHIL9tf{uLm0MtLs0Mt܋M;K $uL LLH  $uMLd$W)H{HM LC H-MLHLD$H $$HU(Ls(H $LD$(HM&LHLD$HL$H$HL$LD$Hs0H$HH ML \ LDCxfwHM H)=E P1VH5 RWAVQ1APL H0HUHEHBHHHCHBHH$k%HD$pHEH$HEH$L H$L$4%HD$`HH$HCH$L(H$L$HD$@H$HD$XHD$PMxM\$(Hs(MHt=LDD$@T$4L$(Ht$ L$iL$Ht$ L$(T$4DD$@aE1f9HH~ LC0HDHo yMLDMLDH fwH= HHJL fwDH IIу= H)H1RAPLASVH5:AVAUP1 H@I$ID$HBHHHCHBHH$'HD$pHT$I$H$ID$H$HH$H$x'HD$`HH$HCH$L8H$H$L$HD$XHT$@HD$PLd$XHD$8I9Ld$Ll$MHD$@L9tlHHLMw0ILIMt9Hk0Ht0DaD;cu&LH $ HLHH $HIL9uMIM?L|$L;|$8wfDHT$8H9T$PHD$XHD$(Ht$@HD$H9CHD$(Ht$IPHh Lp(Lh0fT$4@$HtHH$Mg(ME1MtLLE1҅AIO0MDT$HtNHLHL$ fHL$ DT$u0AGf9D$4u$$tHT$(DJE9OuEDM?L|$L;|$tYI_ H41HMg($MKE1MIO0AM]HtM?L|$L;|$ufHD$(HHD$(HD$PH;D$8L5L L|$8L%+L4$MH-)Lt$XH )IN0IV(MIF AvHHDHҍ~HDHHDfw H<$HL 7U=LQL1RP1pM6H M9_ENEs@H1L?UfDMEIE)H{AL$SMt$ Lk Bf9AAED$MD$MLLDD$4T$(L$ ?DD$4L$ T$(EM\$(Hs(MHHLDD$@T$4L$(Ht$ L$L$Ht$ L$(T$4DD$@} f9 HC0MH= JLDL Y fwDHH IIHھ)L1ɿRP1VH5AUH LE)H5 HɍxHHDHL HDHHEfwHIHX)=PL1Q1RVH5yIHt$HH HHFHBHIIGHBHH$!HD$pH|$PHH$HFH$H8H$H$!HD$`H|$IH$IGH$H8H$H$HD$PHD$XH$HD$@E@?LH=J)SDAM ()H{HU0Ls0HCMtHLHT$ E1HT$AHM(Lk(HX Mt1LHHT$ D\$HL$i D\$HT$ 0 HL$E? H MHS L LDHHDMLDCpf=HN)HLнPH51AVQ1AUR DH0 @L1?H=) AGI_ Io(IO0LH$HD$@L5- HT$L% H-)L- LH9T$@L4$L|$Lt$@~f)IN0IV(IIF AvHIDHҍ~IDHIDfw H<$HL 7U=LQL 1R!P1@M6H M9t2ENEw@H1L? YLt$hHt$LHt$`LH|$8XH|$pXHD$HLd$hHI9u=HI9t.HkHtEatuXH=OJHb= HI9uHD$HH@@HfH=Ht$HLT$hHLuI9L= L%n L-RH)fDILM9IH}uDME ˹)HM0HU(MHE uHIDHҍ~IDHIDfwHN &L$L=SLQ1RP1HEHUH H} HBHgH}(^H}0UHLJL$IDŽ$M9&HD$HH@@HWf$BuHD$xH9$ H|$HvGL 81ɺ1LH59It$(HC(H=w L Hk0HHDHHDMLDMLDyfJL f=H")H1RUVH5UP1AVAUAPLH@ H$ Hh28fEf7fx)fH|$H$%=o11Ҿ'YLU ^H5_DHH-{Ht  Ht$HHH==H-6=9IٺL%11LLf.H:L%LRR 1ɺL~H|$HoH\$HHC@HHD$HHH9\$hL%jH-)L5 L-j )Hs0HK(LHS CHIDHIDHIDfLCMMtIHL9LHHLŻ1UVLQ1RWH0HH9\$hDKE^@H1L?@|$ LC0H MyLDMLDHj fJL V feH)=NR1APLVH5AVAUP1H0DH II\DH= JIL If6L 2AɺL@?H==)HyMHK0L5 H ML e LDCpfwHM =UHٳ)HH5P1Q1RaAVAPLDH0D$E HD$HLT1ɺ 1H5=L%L 11LLHHD$HHHt &=c=fL%:L ;1LL1H f9 LC0L %E}EtHH=w HC0HDH=h JMLDML LDf=LF1ɉH+)RP1ASVH5cAVAU/H0'HD$Hh2 Ltb1H5'tHHCHBHLR@1?H=)AAL&D$@?H=h)D\$14$HCHHHH9HRIHL9LHL\$H1ɿRL/1H54A[[E1Ht$1HL(Llw 1ɺH5HL$H|$HLŨsME Ha MHS L LDMLDCHfwHM H2)L;1ɿPH5g1AVAUR+H HUHEHBHHHCHBHH$HD$pH$HEH$HEH$HH$H$HD$`HH$HCH$L L$gH{0qHM HHs L HDMLDHHDMLDCxfH)=}PLE1RAVQ1AUVH51H0H|$HN}E1MALWH1L$@?FL$HM(H| HHu HDL HHDExfZHQ)=PL 1RQ1VH5rBH 2E)HC0MH= JLDML I LDfwDH4 IIу=6H)HL1RP1VH5AVAUH0HHHH9HRIH1L9(LH=LH11RH5qIٺH11UL%LOL_AXfxfƄ$@)$ )$0HD$HH@@HfxHP1Ht+-t!Hc4Huރ lLI1]H5:HC0LϚ [HS0L5 H ML  LDCHfwHM H)1ɿPH51ROAVAPLH f9|HC0H5J :HS0HH1 ML LDCpfwHM =}H)HH5>P1RjAVQ1APL4H0)H HHK L  HDMLDMLDCpfwHM =H)HLAPH51RAVAUQ1uH0EHH'=IٺH11UL%]LL#Y^LC0H5 L 8D@LfAHJ<(Lml 1ɺEH5D1H$.o}fo$HD$Hfo$H)$ )$0H9D$hH$ HP0Ht|H:HrH39H3qH uiHrHRH3qH3QH uTHPHHHH9LHL1cH5lDHH9D$hmHD$H@Hx诗HfL$ @ H$@@0fo$ Xfo$0`(DLt$xH|$HH(HH$HPH$HLH$H$Hl$HL9u?&@HHsAHH HH;\$x`HM@Htfu1% fJfHBLMH;A<$H- A}HLAHfAuރ1H-_LH%Li 1ɺH1HS0L5ϕ }d] HUHH9LJH1ɺ=PLH5ھ1AYAZHLLD$H$H$LD$HS0ffƄ$@1)$ )$0HHe-tWHc4Huڃ 61H$qkfo$HD$Hfo$H)$ )$0H9l$hL$ HE0HHHPI3 I3QH HPH@I3QI3AH {HEHUHBHHD$HHH9D$hHP0HH2HJI31I3IH qHJHRI3II3QH Xp(Ln1u(H5_AX]L L1H5ۼ(HS0L5p H i ,H|$HP^Lg 1ɺx1H5WLf 1ɺuH5c31Lf 1ɺH5=MLԞ1oH5[L`f 1ɺh1H55Hs0L5} hH5` HHD$HHH9l$huf.HmH9l$hLu MtfD;muHLuLeMtIH|$HLt4H|$Hyhu!LH=~H1ܺ.H\$H11H %HHHGHdHu(H=Ǡ*} HALHDH1P1D B)LLiAHE11H$UXZHT$dH+%(9H([]A\A]A^A_IHt L9L LK1L1HD$yD )LH-~ HW| HALHDH1P1D c)LLxAHE11H$nY^LHG&L1LDz01jLL |ff.HHG@Ht?ft51L1ɺ>H5ѲHf.HH 1E1PE1觡ZYHAWAVIAUAATUHSHHdH%(HD$81H\$ H\$ H\$(uHG@Hf(-1HIHHHXLH E1MDPHD$ZYf%f=tgLH HD$8dH+%(D$HH[]A\A]A^A_DL1H5lD$fHLHD$L9u|HL9mfxuHD$ 1H9VLd$IAHl$Hf.MeH\$ DHL9t H{ Htf{uL`uAMmI9uHLd$Hl$E%=L;0H薮L1ɺF H5$1 O%=rdHWfDLC1$H5D$+11ҾHvk6Lt$ 1I9jLd$H\$DLMfM9uMmM9tvI} HtfA}uLuML(11H5%0 P CIUIEI} HBH+I}("I}0LM6L;t$[Ld$HNL"1ɺZ H5/ s=ff.fAWAVAUATUHSH8LiHt$H|$AudH%(HD$(1IEHD$HHMH\L`MOID$`H"H!L ; Ht$ LUIl$PHHt :BIUH|$L?AMH]v L IULJH5 LDIEt$=R^AQ1P1H HT$(dH+%(H8[]A\A]A^A_DLt$/LLGLHXHIDM9u0HDt$ LϗLL$#DM?M9tMwHIFHxHluHD$H-L%L5~HfH|$1H6 LjLU 1ɺYH5جsfL k L71H55LT 1ɺ\H5n H1t$ LL$Lҕ1H51XZCML$H>LXff.AWfAVAUATIUHSH8dH%(HD$(1)D$HD$ ^L*LbL.IL1Å)/L Ht&LHIHtHLyL/L/HPHLEHHPLEA}-A$I<-LA}LI)L9A<$Lٖ4L1+L0LLL\$,H}LxL~HLLHLHD$H}LhL~HLLH1HHD$ BIH6HD$HE1LID$H11PAHATjLHD$,H D$ LIU<-IջLy1H5~HT$(dH+%( H8[]A\A]A^A_@I4$1-Ml$/Md$ILHLH诐HHxLH(eHMSLfLQ<1H5L@/fDMeILP 1ɺH5fLaf.HMAWL1H5 XZLTH5ӧnU@HMAWL@1MLғH5Lmff.fAWAVAUATIUSHHLo@MtfA8M1HHID$(@JfwHHcH>f.LiVH5x1E1IHD[]A\A]A^A_Il$@1HtftHHCxHfC1f/C1f$C 1fCMLH5  E1"LAƅH"{ LDLMHCHH;Il$@Hgf8)0)kLtDHdIl$@ClHCpD$ Hf+f H{$E1HresizeHC$L= GfDG GCIl$@LAƅHtfHmanageC<HK41fK@CB@T$ Il$@2H.fX'<'ChtP'SlT'Spf'H'HS`H'LCpSlJfIl$@HtZftHHCxHt D$ vDIl$@D$ PIl$@HuD$ H{$1L=J HchecksizHC$Gefw GiHIl$@HClCE1;lf8)&=AL11H57HfHHH5 Ht*H5b HtH5~2 HH{4HC CMDCTHCXAfD)PE‰CPf&tP|&CTtJ&LEt't"LDCTf&bH&AHCXH&LяfD1Ht 1f)C[@E1+1f^1E1H-ʞLˍHH1L_v(L1H5vLf LpMH5% LL=? tUH5E0 LL=% t;LLxt,H5+_ LeCH{$4DH{$L'CHC$@f&f&E1@1ɺE1LG H5kF1@fLf.Ltqf.AUAATUHSHdH%(H$1HHtO1H:IHtbHXHHU`HE1MHP薍HLHAH$dH+%(uHD[]A\A]ÐAATIUHSHZW\HvP~HHHLHB9t@LhA"IL11UH5ЛfD[]A\fDHG`HE1HHiHHiLE 1ɺNH5oJL@Iu+1L1ɺUH54 []A\1L׋1ɺUH5 :IL11UH5ۚ ff.AWAVAUATIUHSHhLjW\dH%(HD$X1HvPHIHHE`t H$UH%r @{HEP L0uRLk1H5 HT$XdH+%(tHh[]A\A]A^A_fDHVHE1E1jH1HjLHD$8PgH AD$ E(fHE`HUPH%L2*@L1ҾL1ҾAƃ1{c"E/HE`H%@'Ht$ H HD$ P H8T$^oE1ҋD$5i@B9'i'LڋH5o DDdD9ALH1AVSAA1ARDT$,kH EDT$ ELHLE5AE;H=A=cI11LH5@Hr&EDHG`HE1HH|IHKL-B 1ɺ9H5LEXML¾LHUXHEPHLAƃ1AL1ɺ L=n 12LEHHH9~HWHB HZHHNHH@Lf.HE1L1AVDH5|m 1SARDT$,^DT$,H EeE1@LEXML¾LHUXHEPHLÜAƃ1AL}1ɺHt$Hs Hc$E1҅L=l H9;LLI=1膾K1HT$ HHHH9HHPhKHt\HfH* c^YN ,Ѕt)Kt@x}9Oи)HiCH2Ht$ E1ҋVw/9Ni@B9~ i'D DPE9ELAAFH>DT$ D$kDT$ HZ(H9H#LSI1H5Lk 8XZ1L> 1ɺ!H5?L1ɺ1H5j 1Lu1ɺ$H5Ƽ@AL1ɺfHPXWLBX$HPXgLBX4L= 1ɺ1H5= ? f.HЃfHH H*Xf1L= ~H5= L=i Lv= 118LͻL=i LE= 1ɺ:L螻fL=i L= 1ɺ*Ln@AVAUATAUHSHdH%(H$1H\$0HD1H袽IHHXL5HHU`E1AVMHZY$Aąt/uL@1H5őA蕺LHڿH$Ht H$HuHH$dH+%(HD[]A\A]A^fDDŽ$5L5 1I1LӄrLL-eH|$j1H SLcLQH `` 1L X UQH g QH jX Hl$XE1LH0t$HL$ HLl$ Ht H}fLtD$ L1L:ABIٹLL@1f.ADIٹ}LLAٸdOff.@WAVAUATUHSHH@dH%(HD$8HG@H/f!!D E-L-oL%;uEtE1HH{HhLjHuhDtDZYIHEPM=3H51HAVAPLuHP1SAT脷H0HD$8dH+%(,H@[]A\A]A^f.HMtDݘEHL$HE1E1j1HHjj"H |$HHtEdt;L-|fDHL%vEdHLDbuhHt$ H6-|$ u!f1fDHH8 LtZݸָϸL-L%AUATUSHdH%(HD$1D$$FaHI1ID HL$IHEtq|$tjHBDCLʼnEy@.M1PLj1H5sqXZ|$u61&1L%H5V,1HT$dH+%(uPH[]A\A]?=LMPH5 1sLsi+1ѴY^[EDAWIAVAUATIUHSLHAA@I@(HMLLPAHޅH8^EAtOLH$IHXHC(AH@Ht!LL$E1LLLHAƅAEAHD[]A\A]A^A_HHHHC(LLHPAƅuLQ5 1ɺM1H5΍褳fL,5 1ɺV1H5xf.LLLHPAƅNL4 1ɺf1H5_5.1LjH56 HC(LLHL$HPfL~_H51E1ɲ@L1~Hff.fAVE11AUI1ATIUSHHH6dH%(HD$1D$ jLL$mAYAZHHsHH1]Ht&LpMtH{HL讼IE HSH= HL11RH5LJ~AϱY^HHtJ>#tELT&t` β ڲE,HLJ"HHD$dH+%(jHD[]A\A]A^fDIE H=@t HI#V`LIE(LHSLLE1PHIAH8ÿfDLT2 1ɺH5Ί詰B@H}@E,葩@fDs$fDHLKE1D$ LP|H5\P14_AX@ILN|1ɺH501A,fLKL|1ɺWAWIAVAUIATUSHH8dH%(HD$(1BD$ D$D$SHH31jDD$LLL$nA[A\HH>HsH2ZHL`MH{HtL諹kIG HtHI#T$`XL,HKLLL$ MHLAą7HHtV>#tQLN#5tZ ȯu" ӯE,tH}@E,lHL8Hl$ EAGH;1E1:HHEAƅzH3HL$H LmAąXLK1LzH5ڇ谭vIG HS H= LL=H1LRL1AR_AXHHtU>#tPL!t P\E,tH}@E,HLyH!EH3HL$He Lqlt1ɺLL&. 莬TfL . 1ɺH5a @LH=tLHD$AHL$u HD$D5DEu=4~sH|$HζiuQLBLM- 1ɺH5Dž被vD fD놐H-1ɺ1L, HE1YLK1LxH5HD$(dH+%(-H8D[]A\A]A^A_Lr- 12H5n- ALW, 1ɺH5ф謪IѺLv1L=1ALt H3HL$H Lj11L+ H5R(ADD$LK=DL= L11LvA̩= LKLYv1f.L=1ɺ1L + Ll1ɺLL* EgHL=UE1PLmvL1AYAZ7Ioff.@AVAUATUSHdH%(H$HG@HfXf8&Ht 0&Ld$ H21Lf1HH)$)D$`HD$H]IHT$HHD$L轨5H]@HfXL5I tL01f{Xf8&&D$4D$(10&T$ H5 LD$$CHD$@ HHD$8H/ZHD$HfLH L∅H$dH+%(H[]A\A]A^f.Ltc1H5ODL|( 1ɺXH5ѦvLathDLmDD$4L5H HD$ D$(MB1H-LHF1L' 1ɺ[H)H5R L虰uMHL HD$8HrX^DLt' 1ɺSH5ɥnH5 L9uH HD$8HWHD$HH5C L H HD$8HWHD$HH1fD$(1D$ D$4_蠯AWAVAUATUHSHHRIHvH;,H{!H{H{  HRIHL{L趩HLpLRHLLH蠲L{IEL耩HLpLQRHLLHjL;IELKHLpLRHLLH5L{IELHLpLQHLLHIEMl$HL[]A\A]A^A_@Lq1H5}蜣ID$LHE1U`LQq1#H5}\f.IELyq1H5N}$LH_x@IEfDIEfDIEfDL 1 H5|輢AWAVAUATUSHhdH%(HD$X1H}HYHpHD$ LHHD$HD$(HD$ HH$I9IL%\|LIGHI~Ht$0L|$HHD$8HHD$0HH|$ }HT$(HL$HPHT$(HHHD$(MmL;,$M}IG`H#C tHC(LHD$@HbStLLpOIH5{1\Ht$ H;t$'HT$XdH+%(Hh[]A\A]A^A_@=iLL$@LLo1ɺWMmL;,$1Ll$ L;l$HD$H$MeHIt$KHt\LxMtSI|$Ht Lu=HC HtI#G`t.IL$L $ILHLD$uCMmL;l$uLl$ L;l$fI~\D1Ljn<H5zf.LnaH5y讟MfL,! 1ɺqH5y聟 I~L@\H  $H5$ H=$ ©fAWAVAUATLUSH8HLydH%(HD$(1I9IL5yXHCP;LHCHL $HD$tkH\$IHLHtI@ HmL9toH]IHC`H#B tHB(HHD$HuIpu=LHLx1P1|t L貢f=LL$LLp11ɺ褕HD$H$dH+%( H[]A\A]A^A_f-ZELL$=L/h11H5o'HvH9YH{pHt-H5, HL$(H|$ \H|$ HL$(tH$H@H@@`Hf-,H<$IL$@fDHf$H{pLL$GLBdL=n1L4LL$1LLgnDHjHE5;NgIL eH5| 输@fHC`@` QHLH(Lct$YL=!nfH<${L4$LnLCfDf$BHkpHt!HH5C }H4 HD1H=cHiHL%;91ɺT 1LnaLLm@Mu_1L%9HeHa SL `L`L1謄A[[@L%8fAtIZffA88HM&L%u8+HPHcHQH8H@TfAmH@L%&81ɺ- 1LY`LLm@M 1H JIH4IG1L5_H1L< PL _1L_莃H0LY^@HL _LSLe_[ 1E1A_AXfL0l@HPHHQH8H@L 1ɺ 1H56ׂ3fL5^L5^1LX1# H56舂 1E1LXH56\H@HPHHQH8H@Hw 1SH5%6L A^L]Y^JfHHMF AUL]Hr SL ]L]H55@L5]HMLAUL]7 E1fH AWMAVIAUMATUHSHHdH%(H$HG@H1fxX$f8&$ D0&AW1A$1ҾH|^HU@Htf8&t& $$L$$H$L$tD$EL$ HL$1HHt1ҹLfH=H=̲5ޒ$t DŽ$M_H$LHD$ H豳 $Ld$ L5 lAPfDL%YLU1LYLL 11A6H$dH+%(m HĸD[]A\A]A^A_f.D$H$ E1H|$XLMHL55H;HD$PL1LGUDŽ$~1Ht$PօHXt" uYDEA1ҾrH~JǯHY1HAă^ 1~H D~3 D~ A_HE8L L虂H5XLHҿH`sDŽ$$3DŽ$E1䉴$$T$H跋H=tH襖MLHAE1H$`$LHt <$mAHL WLEH1ɺPLRH5V1d|$AXAY@2L1L0|V}BLHL蔲D$ r$uHLHGHD$8$HL$0u HD$8|u||H|$0Hm|J%D1H}H$H=H $H$11HD$0H\$8E1E1HD$0H\$@HHH\$@HAHPQ1j荈H AăL1ɺL%U1LzLLb11eAzH4$HoDMfDLYQ1ɺ>1LszfDL1ɺH5nTACzvfDD$Ew1H|IHH$L5RIEH L=pfD{ZH1E11DŽ$1HAAVAUj.H HHAܽA$$5zHD$8HD$0uzzkH|$0H_zC2L1L yfDƄ$L%SLSOLxufD$E1f1ҾHaV$nDLq 1H5RAfxHD$8HD$H9ILl$M7I9u"s$ IMI9tVIIHt$0L芮RD$HT$0tIIGHBH뼿{Dy)HD$0HD$(HL$ u HD$(D5xEuxxH|$ HTxxL|$8I9Ht$Ht H}4fH4$Hw@IwHtL1ɺ*H5QvLl1ɺ1H5Pvf.L%PL51ɺ%LvfL 1ɺ1H5PAYv@ 8D}LVQLIG1!v$L1ɺCH5PAufDLl1ɺL1H5OAu~@L<1ɺ>H5OAuPfDL12H5\u 8D|L5LLIS1!uL `H5OAtL{1ɺIH5NAtLQ1ɺ/-y=ukAuE1DxI~8{cLAQL` L OPHS PHM P1JtDH u4xH=_O}HHt8>tw1 H |A9dH<Hwt@}8t4zOI1PH LPH5_M 1sXZ1Hx {A9pD}8}zIكARL_ [LPH~ PHL P1IsH ;wff.UHSHHxH1E1HLI HHQu" t5RՀ4wEIr1H[]fDuAHI9uDEtԅuо<{uEttDESHHdH%(HD$1HH$褈u8H$H HH%H)HvCHT$dH+%(uXH[DL1ɺ71H5SMqD1Lz1ɺ=H5+Mq1F|fDSHHdH%(HD$1HH$u8H$H HH%H)HvCHT$dH+%(uXH[DL1ɺL1H5L7qD1L1ɺRH5kLq1{fDAUMATIUHSHHuTHHt<;1H|H9u+;LLtHxI9H[]A\A]H1[]A\A]HLHL[]A\A]|HHG(H8 Lz H5(lDH@HkFHкNP1(pHff.AWAVAUATUSHH $HH $HxH|$HHHHt$HT$8HL$@dH%(H$h 1t$0zHD$HHE1L$`L$_1ېLHAH@BD=EDC>< IIuHAALHt$\L$ LL$LL$L$ u|AH;L$v|$01HD$@sH0HD$8Ht$H0H$h dH+%(Hx []A\A]A^A_LcC ,L~e@Dl$4DAADH|$LITHTAGHDH9D$LHD$`DMHD$@1LHH|$HfDTLc؍HB ttHH=uܹA$`HcAHō;D$0_HD$AN4>E1M\$ 1Dl$$EMHl$(L+ IcA\`L9t"A\$I ttuˀ uL9uߐIcHt$L\$ DAD ` Hl$(MIcDD$ Dl$$.{DD$ DDH;D$D$4A܍C9D$0|$4DfDAdAHt$QATHt$fTfHH5EA1U LFi^1_`f/tIOIWLH4$zt^LHLzAELF 1L:i1H5J7@Le sAWAVAUIATIULSHHHFPHL$LLmI|$LxLHLLHvIEL{HLmI|$LhLuHt`LLHvoHHD$HEoKMoS U o[0]0HC@HE@H[]A\A]A^A_HD$H1LEZH5dgH1[]A\A]A^A_IEff.AVAUATUSH@dH%(H$812IHIL_HE@$0H$/T$H5E HD$\$L$$}u*|$L'E1ɺ)H5?cgH2|$1HmiIHHHLCLHEAAkH$8dH+%(H@D[]A\A]A^HxqD$1 L,DH5nbA8ffDL1ɺ+1H5DbA fZ@ @L 18H5bAeLL1ɺ1H5aAepAVAUATIUHSHPdH%(H$H1Ll$L5HE@Hf.HHL$(fCLC,ucH-Lt$lLHt$0rHE@L$HvfuVLWC81H5`dH$HdH+%(HP[]A\A]A^fDHfHT$8D$HT$(H1HPIHHHH9OLt$lfDHAH0HPI36I3VH HpHPI3vI3VH HLH$HH$HH$$$ŏLHHE@HtfhH5A H\$Ld$s6@H/1HeIH LHHcLHD$ hD$ 3H H9LHU1t$0LL$@LAH5^{bXZffDHD$(HD$8 fHD$(faf1Ҿ6Hq.PHE@Htf.%DHL@ flH$HD$`ZDf.LODLL$(1LM@OH5]_aDL1ɺH5l]1a1fL1ɺH5,]`Z1L H5]`,L ?&kff.AWAVAUATUHSHHxdH%(HD$hHB@HtHHt H9L5ALcpMtH5eLcDD+LHE@Hf,HH}L$LjD"M1H$L>1H5}[_XZHD$hdH+%(QHx[]A\A]A^A_MH5wLbujHH}L$LjD=O`MH$11Lm>,H5Z^AYAZHE@Hf#Ld$ @HL8|$ H` DLDLkpLDD)LM$AAMtGLLT$H5hL\$L$ DD$aLT$L\$H L$ DD$LDHC@HHHH9LJHATL% APD$Lj=LP1Q1AVASAWARAU]HPfLx@Lr.Mt!LH5`H LD=^MH11ATLw<(H5X]LcpA[A_M0Ll$ @HL[DHYL b L% ELL YLD11\HC@HHHH9LJ11LXLL=XY\LspH LDMt!LH5`_H LDH1LAW1MLX[DHYLH_LH9bIM)HH}$LjDIXZML$HH}L$jLD]LL$1LH$L;)1'[A[A^AD++E4LH{ L 2WLELW11ZDHH}D$LjDAX1AZILrWL1>dZD11BLyWL@Z11ELwWCL ZD11LlWDLY|$ EL  MELݼ 11LYL 11FLYHE@Hf)9HHL-WH9fDHPLWLHBPHrH1Lh1(YHE 1LVDH p$DΉL$1XHmXZH9t`DMEH1LMDȃP1XHE Y^HPLV1ɺ1LXHmH9uLt 1ɺ1LmXL%& L1ɺL>XfL% L1ɺLXWfL 9w@L 9@LT1ɺ71LWfDALT1L@1W/ML1T1L,1pWHII)Hf.LT1ɺ1L3WafHHE11PE1j葙Hff.AVAUATUHH(dH%(HD$1HG@AIHfH1HH$HD$YIHHE11DID$HP2LHPAAT̘DL$]AŋD$+D$LK6=dW$H5S11UXZLHA[HD$dH+%(H(D]A\A]A^fD10L5E1@H5SAUF1E1L"4H5YSAcUbfDL9 1TH5$SA.U-_@AWfL=/SAVIAUAATUHSHXdH%(HD$H1HG@)D$)D$ )D$0Htrf)X$}L Rf L=R11ɺL>5LTHE@Ht fx"t% 1HVIHHD$1LDID$E1E1HH>PAT谖AXZL$?HH}$DjLHt$0D\$ $$H}HD$DLD\$Ht$(H+t$0Ht$($$H}HDLDt$$D+t$ ZLT$D\$L=TL$L41ASSAVPDL$D1 SH0LHKXHD$HdH+%(HXD[]A\A]A^A_D=TLL311RL31H5PAvRvL1LB AJR?DL *PL=RPf|\ff.@HG@Htf!tMff.fATUSHYHLb@C@HHL_HHt:LC HK0HS(HAEt C8[]A\MtSI$HtJL9tELH=RLv H5YM11.QC8[]A\DL 21LZ H5MP[]A\f.ATH1A/tDA\AL911ɺRH5NPDA\fDUSHHHt.H?BHH:u"9hLrUHDmH9\H[]fDH@L1!H55NLHH1OH1[]A1'Lz1H5MOH1[]LKHL0H5MO1^AWAVAUATUSHHhH|$H4$dH%(H$XHAHD$HB@HtHHt H9L%0H<$wL~ HHD$LxHxHHKH[L9uL1ɺ1H5JGKfH$XdH+%(2Hh[]A\A]A^A_HD$H|$HL@ HH0HP(AEtEHD$@<1HoL -1H5FeJK1ML,H5`F4JHD$@<HL$ HHH9tHx1(\HEPHH8 1L%ELi1ɺ-LID JEML1Ll1IL1ɺK L+@HD$HL$E1H4$Hx)L1ɺIHHD$huH$hPHD$hHD$HHPHD$Lp H4$ALHD$@H] H|$@Ht$@HHH9ul@HHH9t=HHQt H{@H9z@t9uHQH9HHWH:HH9uH9HD$H $H=FDp4HD$HHD$HH``HD$HxHD$ HHD$ H@HH$HHHD$(H99D$8HfH]H9\$9Mt-H$LHx RHH'H{HRM,$M9uMmM9IuHtHK`@HHL$0HL$0DH sHLH1I9LDIE|$8HPuD$8u 9H$L$HHL$0LL$HL$HxޘHL$0ZMA?HH9bH@H@mbH{HLPNH$1ҹLHD$HH$H$H$HHD$0"QHH|$0H5 LIHf HD$PMIy_LL$XNLL$XH Hp1ҹLL$hL$Ht$`LLD$XPLD$XLL$hHVHD$0HL$PIyHO L)Hp~1kH[PHt$0HH&HpHHHT$HHxODL$H$L;T$HLMMIHL9tjHUHHL9tRH;SuLJ@11LV*LT$0H5@IiDHCHLT$0HBHH$HmH;l$HuLMMpL%K@L"&1PL D1LL*BCHD$@<H$L9tKH|$@HH H9u9AtHpH9rHL9uH1H9tHH$H@HmH;l$(H$HH;D$(D$XD$HLd$xD$IMnL9l$AMtI}HLMD$HIIHL$0H9^H@H@ @HD$xHH9H HH9HsLtAEa@'LL$8HŅH\HD$xLLHD$@pLT$PD$tZLT$PHD$hMIBHP@HHHH9H@HL$LT$PL*!H5 LIHP11AuHA_MAXL;d$0LT$PL$ML$MAD$LE1LLuN fAE;D$L7 DL<@I$IL8uH@HJHpHI@H9N@uHJ HH9tD$IL@HH;Z ( I$HDDpAD$PkE|CŃA9rA9wIt$AFtED$LA9A9vLHL$`D)HT$PAAt$ HT$PHL$`hL1ɺ!H5X I@L1ɺ!1H5< (@L%C<11LL@L11L?fH2HBHFH09HHH9m[M,$HhM9uH\$0LIDHI9$HsLtLL{'IL%s;1LB?L1ɺ1L%? L1ɺ-1L>1LL">HHL$0HHH9qZHvIUHL$0FHRHH@`H$HD$8H\$0HK`AH$LHHD$&HD$@H8 HD$@H $HLHL$H@L9l$HLd$ MIHO@Ao$AoL$HIt$ Hp H}HuH(HpHuHM$$HEL9(LHuL H5D i=L%91ɺk1LLE=LѾ1ɺVL%>9LEL =L1ɺ4H59LxXIVL0HPIVHIFdL L1ɺs!H5 Ll$Ll$P1L xHlLC1ɺc!1H5 Ll$Ll$P1L1ɺo!1H5z Ll$Ll$P\1]L%c-LL21H IH4L%2-L1ɺL0L H5 0`AHH9\$0L$Ll$PL$HD$L$t;HpIM`@LHL$HL.H5,DIpP11D+$G0[]`LH|$0H5QN 97IHHj HD$PLHt$`L%,L_Ƅ$IL/ LN1ɺ|!H5 Ll$Ll$P/D$XH+HkI|MLL%q+1L@/Lë=r0I11L-H5,+/D$XL1ɺ1H5 .L%*LL.f L1Lz.L%*LL^.ML,HWH|$HGL觪=`/L1I11H5*-D$XH|$HLR= /LIPH8 P11H5)-XZD$8D$X1L%)LLZ- "1L H5B 3-HD$LT$P1H5% Ll!LHHH ,P1AuH,Y^LT$PLL$0LI+v'!B7H  $H5H=S/LL$0L%(L+Ly,@AWAVAUATIUHSHhHZPH|$Ht$ LHdH%(HD$X1I92E1I}gMmAI9uDt$,M;$$qHD$@D$<HD$HD$HHD$@HD$H@@Ht.fxXt'HHH9GH8n1A LD$ H5o `&IHLMHLX%PML$HWLbPVH5& uHQAF P1&H0HLMHLh H5 QP1%H LN1ɺ H5 %kL$ H5 |%Dr &.I$LL1E1}7%rD$<H譡LnIH5+#1$1D$,HlLLIu1$L# H5 $Z1LLm$=%LL 11E1C$~Lʥ1ɺ7 1H51 $s.ff.AWAVAUATUSHHHYHt$dH%(HD$81HLbpC HIMtH5ިL'eHE@E1HtD/I~@LHD$0HtHHt H9KIF`L-@`HHt$0D\$LT$9LT$D\$Ht$0L=I, Mt`I9L=4, Eu I9I9VMLM1ARL1LT$ "AYAZLT$LT$0LHMLI1VL1"HL$@_L AXL9ML9AI~`LHT$D$HGP0HD$Ht)HHH5O%11M麡L L!MH5 LD%D$LH`H5զL %t$H|$ H|$<M麵L="L= 11J!C@H谑MfpLhIF`@`Mt1L H5*  Lk1ɺ21H5 HT$8dH+%(] HH[]A\A]A^A_fDML+ {H5) k fD\$HH}L=y) LT$$LjD.1LMH$Lc 1A[XD\$Ht$0LT$ELT$HH}$jLD蹬Ht$($H}HD$ $DL}AYAZLHL$HH= 1@ L1ZY9s AWAVIAUATUSHXHo@HYH|$dH%(HD$H1HtyfX$t t6f)t\MfpMt#L-ݚLL I@HD$HdH+%( HX[]A\A]A^A_MfpCL-MLLIHCIHCHCIF@HHHH9HBHD$Htf,kH{(S 1 HD$H@@Hf-tfLd$ (LLCs MHH{(LD$H10;HC(2HD$HD$H@@HMfpfx"LnHD$Mn@D5eTAEbMH5LPASAH 1HPLH5PH P1Rit$8H0AAHHCNDH HD$gL-!HHCI9L%fImHHtH5<HstH;CvCM}ImI9t8fIGhHHLHt H9tHy;CvCM?L9uMmHI9vCsVp4HHC HD$KSHx]HC(HHkDL댃CMH5^LLd$HL$uxIU0H HBRHrHDH 3 f0ASAHLPH H5Q1P1Rut$8H0IE0Hn L= Lh@MLDPfMt!H5LH IE̋CAAHL${AUH5@AWQ1P1t$8H0vSAAH 1HPLH5P1ATRnt$8H0+MfpMgH5ӕL KHD$H$HxL@t$IjD^IN`AXHE AYHtHQ(=KAHL%PH H5'RP1Q1t$8H0YLL$=-L :11H5 $MH5ДLACAH1ɺ_H5\ L!VH5| P1t$(PH AAA+HHHD$DLHxшT$$AHjH|$IA$@t$AHHH$LD蛛ZYH IIF`HtHH(MnpMt+LHL$H5HL$H֯ LDCATAAW=xLi QH51 1AUP1t$8H0hL1ɺNH5  DHjٚH\$IAH{$L@t$A$DH膚I^p^I_Ht!HߺH5H߮ HDATA麉AU=L@ H5A S11t$( H wACAH1ɺcATL H5 P1t$( H 5HIHHHLH 1TH5  44fDAUATUSHLaHB`tH[]A\A]@HHHHtHt$T Ht$uL-$ 1I1L L E1H޺H )uHu@#HL SA1L XZA$;IٹLL W DAWfAVAAUATU1SHxH$H$H|$(H$pH$Ht$0L$8>L$D$L$L$`HT$LL$LH\$ HD$dH%(H$h1LI@D$H)$`HD$XHD$PHHmL$dE|LϦ1;$`H5A%r0N*>H LVM2 x[H3$lH3$dH H|$Aă$tt0HL7 A1j1H5  _AXL;$xt/H1H5 AAUL 1 Y^H$H9$sH1A$L' 1H5 A XZEHD$$H$1ADHIM(HD$PPHD$`PHD$pPL$QiH IM@ADd$HHD$DH$HD jjjL$ iH LL$XMO|$8H$HpHH H|$ ILLH$7HT$Ht$0ILL$H|$(蝨H 1fH$`H=E1fHA1PL 1H5 AYAZ@HAL 1PH5 1wA[[7f.$81H|$LԈR&H$HpPHHH|$ ILLH$YH|$H5e IHDH$LHHHt?He1$LL$ L H5 {A]A^$Hh LPLXD$$؃Eu f.1H$hdH+%(Hx[]A\A]A^A_DEfMh1fDHH A1AUL 1H޿A1ɺ $pLH޿$1XZLHt$`2dHA1PL H޿1MA1ɺ$LH޿$1#Y$AL1ɺ1H޿^$AL11H_AXwM1ɺLJ H5 1qHML 1$XH5 kHc ZY,@HD$PLL$D$LHpHD$cLL$HH$HD$KT HT$LH9$Ll$L$LLL$(HT$H|$ LޒLL$(EH4$L|$DҿϦIAD$ AA9t5jL 1ɺULL$(H5 1xAZA[D$ 1pmD t$8HHH4$E1LHPL}MbM'Mt L IIHtHT$LH5ǰ 薩H}mEGD$LM(LH1ɺPL 1ATL% AULL$8L|$XH tUH|$H|$H5*a iIHhH<$HQ LInL <H<$8H0t$ =$L$LLL$0H|$ D)HL$(HL$(LL$0HD$H|$ LLL$0ID$<+$F,H$HT$(LL褐HT$(LL$0DT$<HL 1AURt$ AQAjH5 \H0H<$Of.HMLJ 1$QL1ɺU1H5Y 1fDL|1ɺo1H5+ f.LL1ɺm1H5 Bf.L% 1ɺ1L LlD$ ED$LH1ɺL LPHP1AULL$8)D$XH 1|fHL Q1t$(t$ AQAj|fH1ɺt$L% LL$(LQ LH}D$0#AXAYE>31LLƙ 1sH<$L 11LMHL 11t$H5v AQAjH|$ H L1ɺ1LLo1ɺ1LpH}8EtD$L1L% E1LT LL$1_Lk H5 iHa1,L1ɺN1H5 9Mt$AL 1jH5c []LL$LL 1ff.fAWAVAUATUSHH $HH|$HH$IHL$ T$XdH%(H$1H|$@HHF@H$H f HD$0t H HD$0H$fX HD$ H5 LHHD$\AAEmA$tL8Ht$L Ht$11LbAH$HID$@HD$(H)HD$(f HHD$8H)HD$ H$ HHHD$$8%= HD$(H$=`V HI\$HID$HHD$H9t&Ld$PIfAM6L9t$uLd$PID$@Hf$fX\ H$HD$HH8H\11AƅH$N{H$H$HL{LH$IH(HHD9 ADDL$A}#IcA^IUHHDP t$IUDP tH5 LH"@#A|u A|  H- 1ɺ_ 1L HH$LASH5 LzHoXH\$HHH[oh)\$k,@&C<A$fC@DLϦcH\$HL{LkCkH$HI$1LA$HA$I$1LH$HHP1H$Hߺ I$1H$LH H|$8Hr A$H5H|$8H5  H|$8H5 H|$8H5 Å_ H|$8H5ǭ rH|$8H5 YlI\$@H$Htf$EH$HH$LZ H 1H1{AąH$XL$MVL[IHQ%LHDaD9I1H-D L HLD~=fDLLy1ɺ> 1HH$dH+%(#H[]A\A]A^A_DIHh1fDHA]I9BIL$ L$1fLLLL$H5^ )$ )$0)$@)$P)$)$)$)$>D$HmetadataH9$ $ seqn<Hbackup_fH9$ Hmda_offsH9$ DHmda_sizeH9$ tHmda2_offH9$ Hmda2_sizH9$ THdevice_sH9$ Hdata_offH9$  $ pv_u$ mda_ H- fD$(_offf$,se$.tHT$@1H5{ L$5D$$o1H$H5- LLv1ɺH-e 1HML H11Lmv1ɺZ1HLPv1ɺ f$(il$$*eLLxHD$PLHxeHHAA[ Et$A H$ f$Df$(et1H$H5 LgLzu1ɺ1H$H5 L/$@H$f(^H$H$HD$(H HD$@HD$8H HD$(HD$0HD$@f$(se$*t1H$H5 LyLt1ɺDMS1H-$ L' HfLH- lLm1HH$fDDŽ$ $ID$@H- fXH0HA$H5 H7H5a H @H5ͧH L$HL$0LHT$HHt$@!H- Ll1ɺQ H\$HHIL? P YH-T =$1H$ao#$LL$L 1 H5 ^HD$H H- Lb HL1o{HE1jLk1ɺhH- 1H8H$HD$(H$xd_HL0 P LL$J$ECD=BD:HD$H L LH- 1Hf$$nu$&m1H$H5(" LCLj1ɺ->Lj1ɺ 1H;GH\$HHILA P [HD$H L L'L xHD$xE1HDŽ$HDŽ$HDŽ$HDŽ$D$xPH$PH$PH$PHT$HHt$ H|$PL$$D$H E j1ۅLE1E11HD$xP$$t$Ht$(Ht$pH0 H$HjE1E11LHT$|R$Pt$Ht$(Ht$pnA$H0Et8T$tt09t,L% 1ɺ1H5 sL 1Lh1ɺ H5 4ECD=fBD:HD$tH|$011HDŽ$HDŽ$IHDŽ$I HDŽ$D$xPH$PH$PH$PHt$ L$L$3"$H AH- H$H<$LH HLABELONEϦDŽ$ H$H$HLVM2 001H$HD$0H$R1ɺH$A1L ID$@H fX-n L 1ɺ1H9$ D$UL$M¨ E L efDL$HL$0LHT$HHt$@/H-s 1ɺ 1LfH H5$ L[LH$H$LHDŽ$HDŽ$tLL$L$}fo$$fo$$$41L ; H$HHHH9LHH-d 11ɺ}L: HID$@Htf/d1H=Q 迺 X _LWLd11 H:Ff(t{A$L$LHL$0HT$HHt$@-L$HL$0LHT$HHt$@TxLhd1ɺ^ H5 |$X~ LL$X%D$1H-ʽ L$E1H$$AHH$HKD$IH{L9rLHH1L 1t$8HA[A^$DD$EAEH9\$XHD$ I$1LL,L1&IH7HD$x1HDŽ$MD$d1LHDŽ$HDŽ$HDŽ$D$hD$lD$pD$tD$xPH$PH$PH$PH|$PL$$H zIHt?L9t:LHH1L D$L SL GHH1$L 1L$e^_LHHMPLe 1r .Y^ZHL4 1H$1L$AYAZ HT$tE1E11RLHT$pR1$PjAVHt$poH0D$tAD$qHT$pE1E11RLHT$lR1$PjAVHt$p#H0uAD$p$L$D$H- M!EALL$xH$MM9 HL 1ɺP1HXZHML 1AVH1IvA[HXH Ht$(H<$ILLmHt$@IMLLL~H[Ao A E1M$  $H-` A&L$H$M9MHL 1ɺPHML 1AVHHAYAZ1E1I 1H-Ǹ LO Ha1L 1ɺrH5 ;D$E1E1H-a 11ɺj L HID$@Htf/1H= 輳 1 H%LXA| gEAaAC|$pL$ML$MwH- H $HHHH9Hp1H= mL|T1ɺ1HH- HD$8HD$(yH- 1ɺ 1L"TH~L T1ɺ, 1H5 \H- Iك1L2 $ H/L'LZH-e 1ɺ 1LEl HL.1ɺ HLl ATIfHщLHPdH%(HD$H1H)$HD$@)D$)D$ )D$0H|$AvHD$HdH+%(u HPDA\HFL9w efDIHLv HH5i HR AQI11HfAWAVAUATIUHSDHH"HsMMgIH[H H $~L$HILLT$H}HPHH$X~HH$Ht$HnLISH}HPHH$~H.H$LH7LIGH}LhL}H:LLHLIGH}LhL}HLLHMIGtH[]A\A]A^A_@HMH[L֩ ] A\H %A]A^A_ Nf.L %L%Z 1L)1BLL  dIGL% L 1L2H}L荋IGfDIGfDLY *CfIAWfAVAUE1ATIUHSHxdH%(HD$h1HG@)D$ HD$`HD$)D$0)D$@)D$PHtDhXH5!} H OHctIH@ H@XHt<11HЅu/H- 1WHL ID=1EudHU@LD$PE1HL$HHtE1f"A1Ht$HhHT$hdH+%(Hx[]A\A]A^A_DD5!EHH=:DE%DEYeH}HzIHM$HD$@LLD$H}LxLzHHt$LHM$HD$ LLD$H}LxLVzHHHt$LmHt$1HHD$HD$HtHE@I\$4Ld$8Hof)tHLp)LH}L`LyH-LLHHD$(HE@HfD$0D$XE41HIHHD$ HT$E1E1ID$1ɾHHqyPAT ^L_HDD$`EDL$XEH5 HLHE@HE1LD$PHL$Hf"ALyfDL a1H5 Rf.fDH- LL1ɺ.Hnf1HIHzHD$ HT$1E1ID$HzAHPAT XLZH\L$`|$\1LK1ɺH5 D$\sHD$ vLJ~ fHD${L"~ L jf.LD$PHL$HE1hfDL) pkf1LJ1ɺH5; D1LJ1ɺH5 }DL5 f.HD$(L ff.AWAVAUATUSHH $HL-x 1ɺLd t$AdH%(H$1V1LAYH=m/ AZ^HaHfHHH<z.tL$E1HLLHHRLLM L . Lt$0*LLHD$,LD$(_AXLE1HT$Ht$9\$WD$ 9D$I1ɿ1MLm L)Lt<8t0 1LMPH# PL7I1Y^|$ L~$L7H^HHfHu,H$dH+%(uVHĸ[]A\A]A^A_38l 1LPH L - PLH1?XZfDAWAVAUATUSHH $HdH%(H$1HGHIHL=" E1L5 LhHHz.tLHHHHL6 1RIٹH HD_AXt(8t\ I1PLGLAW19YL^HHgLHu,H$dH+%(uVH[]A\A]A^A_8#I1PH L GPH5 1XZ&fDAWAVAUATUSHH $HXH-, H HLH|$Ll$@IHLdH%(H$H1 jL1.ŅL5- M11L` 9LLLd$HI9uM?I9IGA L!oA)$oHA)L$fDL$01HyHD$t~HL M1ATLAUM?_AXI9uf.1H$HdH+%(QHX[]A\A]A^A_kATLAUAL 1AY^DHAt7H1ISL .H5 A\1A]TS.UALE= 1H5| R[1]fHM1ɋLt 5H5= P1AZ1A[D8EM1PHLPLD1XZ?ff.@AVfAUATLUSH0HdH%(HD$(1D$ )$)D$I9tIIIH@HAEL9t-HCHo)MoP)U+uHAL9uHD$(dH+%(u H0[]A\A]A^t@HHG(H L H5 DH@HkFHкP1Hff.AUATUHSHHH9t4L-5# L%"d LK(M1ɺrL1CHH9uH[]A\A]ff.AUATUH@SHH@H9t4L-" L%c LKM1ɺ{L1ӿHH9uH[]A\A]ff.AWfIAVAUATUHSHhHLD$dH%(HD$X1H)D$0HD$HT$0)D$ )D$@H9HT$ 1AAăuQEDNE1Mt IGHtDpHD$XdH+%(NHhD[]A\A]A^A_f.L|@1ɺS1H5u ϾDIE1AֿHD$LHLHAMtIGHt@DEAt+L?1ɺ^1H5gu DL$DDL$E9HELH9\$Pl1L@2H5@HLv?1ɺY1H5t Aý9fL5ILEILUILeIAWHIAVAUATUSHHH$H9 II1A~VLHLAAMtIGHt @EAt+L~>1ɺz1H5s DL$ ̼DL$ E9HELH;$ٽu1L?2H5 ?聼QL=1ɺu1H5ps ALHD[]A\A]A^A_1AfMtIGHt։hff.fAWAVAUATUSHH $HfHt$dH%(H$1Hv(D$pD$LD$H)D$P)D$`HHHHD$0H9H$@ILl$PHHD$H$L$H$HD$HHD$ HD$LHD$(fLpH;OHSHHPHSHHCIHAL98LHt$f11AUL H5 ݺXHmZH;l$0 HELHL " oL= A)MoP1HLA)UAU H|$1D$\HH|$D$XH_AXLLt$L$HT$ Ht$(L$@tH|$LAD$Ht$LLHH H 1H%H ƀ$HE$ IHHHL9H@HD$HEH5g H@HHHD$8uH|$H5A .IPgHL:1ɺb1H5` 6H=Ot(E1HtrH7t(H$dH+%(;HD[]A\A]A^A_HHD$&L y@Al$H\$LAu> AUL t$AUSMH5 1jH +HALJ AUt$UfH$@LH=uƄ$At$8Iك=Kt$11H5 LJ ]طY^l$H\$LAt$AٹL7 t$ EAUUL"91ɺ5H5 w<ݻ]=HA1t$@Lݻ H5^ 1t$ S2H 蔻HLԺ t$A1Et$(H5 AUUSH0H $H5 <H=<u@AWAVAUIATAUHSHdH%(H$1HG@D$DHD!L|$P1ҾL|$Xf%Dt$L|$Pf蝂ÅEL 1ɺH55 1AH$dH+%(HĨD[]A\A]A^A_L|$P1ҾL|$Xf%L|$PfD$HE@HQfh tH(1;Dd$H= oDL5 LXDpH=? DD4D\$ELd$`H=: D$LLd$hLd$`LH= H;@{H 1ɿ]HD$HL 1jHKHt$11L k4HhL51ɺrIHu:DfHXH|$`_HT$hL HPHT$hHHD$hLHHHqH}aHuIEHth I}蘸L萸L51ɺwHt$1qAcfDHE@H#fh ft(HHtH5 賽SC H$H\$pD$HHH\$xH\$pHD$ H$H$@耗Hs L H5 A蓲fDtDL$2LN 1H5s AC;fD L- 11L L B 1ҾH# nH1ɺLL+3蓱fDfhtnH= A謳dHt$L21ɺfA=5L 1ɺD=BAL" 11H5 ҰDLT21ɺH5 詰@L,21ɺH5 聰l@L21ɺH5d Y-@IEHth I}:L2HL$LMLHDT$AEL9|$P1H聲HD$HHL$Ld$PHD$DHAI$M9Hܭ HD$CD=Ht$ML 11"脯HIL9EHIt$HEtQMd$u辳"=HA1ATHt$L 1^_Ml$tz=KHt$ML 1ɺخMl$Ld$PM4$M9uܫHB)|=ALR 11H5 芫DDD$LLt$LIDD$`HD$HD$`EL|$(MI1LLLH52J 虭D$`DL$LD H}(XHfH@ @T$`HcL$LHcHH H HH H|$pHPtlHHT$xHPHT$xHHD$xL9|$M'IA<$/1L% 販t$HH;M1PA`11t$ HjH AHt$H蹮H=d(HtHmd(T$DHDE t Pu[Vk|=:A11L H5 AǨf1ɺLL=*襨1ɺLL*腨H1ɺyPL` H5 1ZAYAZML 11tH5V ,L" 1ɺ1H5) f.1ɺLLm)է==ALʮ 11H5 蒧DL)1ɺmH HD$H1_L(1ɺ@賫LϮ AH5H 1A{=JA11LA H5 AצHt$HAQHӤ HD$L|$(LeHLmHM9ufM$$M9fA$`(T$LtA$@(fA$D$`T$LtA$D$` xH}()TH fH@ @T$`HcL$LHcHH H HH H|$pHPHT$xHHPHT$xHHD$x;Lt$pL-SG L%أ I9/L|$0%HIF Ht_M6I9CIVIvHuHuL&1ɺH| HD$H1HL&1ɺDIFM~ % t7QMML! PMDͿL1ۤ_AXDML$(D$MD,HLL$0AL 1QT$RAW艤H HD$ H9$S< Ht HD$Ht$1L 10#H$HD$ IH9 H@It$H M$$I9uD$(H$IވHt$ H9 H1HH9uIL;t$  L|$8L-+ MILt$kDHH9LH=LH11RL Y^IIGHBHHIH;\$ HI$1IWLHuIo}dA$HHE^HtaH9t\HhHT$0HT$0ML=ܣAR1U1qXZVf.L @H-Ld$pL|$0I9Ll$ XfDfH@IT$ H$HPg H$L(HPH$HH$M$$I9t.I|$ tH}OHuL?#1ɺ=Ld$pI9uM$$I9I|$ uI|$Ht@  L|$8H$LA$H;\$ t&Ld$ HHS1HHPHL9uHt$L 11)Ld$`QL$HM.L;t$ L|$0HM@DT$`MGE.|$(H1LHHuxMwA~d-HI|HL9LH=L H11RHt$LXZ@IIGHBHIEML;l$ IILa)IGHgHH[H9RLJHt$=Lk 111}h#MIHL9LHHt$=L 811HHHH9LrY1=(HA1AVHt$L 1跞A[A^fDHIH9tBDHA0Ht,H0HPH37H3WH uHPH@H3WH3GH H H9u~MIHL9LHHt$=hL C11L|$0L$\$(tH\$ I9Ht$11L X譝H=etE11H1H1HT$ HL$HM1HJD\$HE-HDL L5~RMIHL9Lp艡8=XHA1AVHt$LV 1AXAYHtgL9tbLpHT$86HT$8= ALi 1R1ɺLAVHt$蒜A^XzL 3~=L5'~TL5~L ~L, H5S A(L 1ɺ>1H5, W#HL.SH=| KIHLLt$L[ 11L蝛M1ɺLA L1}H}L1H^D 8H{H,@L$HH59 ťH N HL$HHt$Ly 11H$HHH9ufHH9fxuD$(L AH5 1dAfL1ɺt H\D$(;DL|1ɺ~cMIHL9LpC=HA1AVHt$L6 1oY^XL {8=Ht$ML 1ɻ#L5zl/Ht$ML 1Ԙ:= APL| ATHt$11虘XZrH | $H5H=#Ht$LG 11 TH|¢L1ɺH5s #艜L: ASA1ATHt$A\A]Ht$Lp1ɺ̗HH$HHL$ H9HBL@@H9H HH9L;@uHL1ɺL1ɺ\$ptaQML SHt$11^_t^Ht$MLU 11MSLŢ ATAHt$11赖XZL2 ARAATt8Ht$ML 1A_襺軚L ARA1ATHt$AA[A]Ht$M1ɺL& 1AE1H޺H7Lt1Ht$ML 蜕D$DAL WA1AUHt$aAXAYff.UHy1HH@t)j1HE1jE1yZYtH]Hyf.L1ɺSH5a ]f.HHyI1IH@t3jE1LE1jLxAXZEtHf.Hyf.1L1ɺH5Ա OHDHHzE1HAt,VE11E1j1DwxAXZEtHHzf.1Lz1ɺH5T ϓHDATUHSHHdH%(HD$1FHtqu_Ht$eAąHL$9tKAHD$dH+%(HD[]A\f.tʋFuHHxL IH5s 1@Ll1ɺ1H5D 迒`5DFdu fUHSHHH,thHPBu\EcuVHC@H3 Htf!Hݯ HEHH1SIL% 1H5 "XZH[]fAUIATIUHG@HHt%f!tLLH "H]A\A]aL(u]A\A]fAUIATIUHG@HHt%f!tLLH N"H]A\A]L'u]A\A]fAUIATIUHG@HHt%f!tLLH "H]A\A]LX'u]A\A]fAUIATIUHG@HHt%f!tLLH !H]A\A]AL&u]A\A]fHHH f.HHH f.IHHց v@EEtEH nu:LHNfDtS@H LH'EEt H .tt H /uH fEEHP11MjE1 ZYHA1GL H5Ǭ BHLLHLf.EEtHNtEEtHZtHGH;DEEtHtH Hff.@H!USHH>tVDH5j HAEt H55 Hݐu)1H[]D@fH5< H衐t[H5 H莐tZH5vB H{t'H5eB HhuTu/v1@H[]ÃETJ1ILԚ :H5 AWAVAUATUHSHIt|H+LxLpLIH@C|/_LDMH]1ҹ LHHBD-A|$H](H[]A\A]A^A_fH)kP H u=- _uw$HD@@}>K1E1L H5 fH$dH+%(HĨD[]A\A]A^A_@I$pBHS(HtHǩD$4.fvb]AE@HD$L=n=Lpf.L1ɺLI A?uA\Iu8HD$pT$t@Dž H N@ HT$L(AL\ 1ɺVH51 A諈H|HD$H|$HxDL 1ɺL1H5 AaL 1ɺRH5 A3뉐A1ҾL{TAL{@M AL$DL$8f.<,u@AGI<,tLAGIt<,uLH) HL$|HLD$HT$(Ht$ LD$HT$(Ht$ AHf 1L=ئ VL L0iYL^1ɺq L1iL 1H5 @AU@th;tcD$47I$pBH&)LM1ɺH5" 袆DDL$8!fDH fDHE@HU@H9t,$t$|fDHH9t9H,u9puH(AS1Hɟ)@H諟 L H5a @DL$8L^IU8DD$tDL$pHHt$LOAmHLM}EuHD$(HHD$@HޞHD$HHڞHD$PH֞HD$8HHD$ H$HD$H$H$1+E AFH\$hALl$`IDLl$Hl$XH@Z I$I7L,HH1HHt H;Xh4H ,fHH9ugHH=fH9MH;Xu赇H_H$HXGH$H|$HPH8HH$f.II9Hl$XLl$`H\$hL$HD$I9Hl$HLl$XLl$H\$`kDƄIG1HHHtIwLgI_1H赇Ht H;XhM?I9`tL12H5 gIU8HHHL$LAIu8H9HT$H L ALN 1H5 A苂\IU8DD$tDL$pHHt$L A+DSAuIUEbDL$tD$pE]H uHHDIL$@E1HtE1f!APLE11t$|_AXAEEH~HHDHIUAuE1PLD$1LIA[A_AnCAuIUEID$@E1HtE1f!AH_E\EHHSHDwL 1ɺC1H5 HHE11IUPE1Lt$jAujH ALj1ɺ&H57 A蹀HD$(H HD$ H HD$@HHD$HHHD$PHHD$8HB@L12H5D}HpXHHHtjH9teH@LLHHH= ÃH HDA9HHHEDL@HiaM2LX H56 1AHpXH2IGHtnHHtfH9taHBLLHHH=ڜ ÃHƜ HD#A9HHDLH`M:L <…tH ?@tH ;H Hl$XLl$`L> H\$h,H55 1An~I$AsIHRH\$DLLEHHOA1H_HtH;XhuHpXHtHFHtpHHthH9tcHBHT$LH2H/rH=K ÃH7 HDA9HHDL2H_L12H5E}%HHPE1E11t$Lj螊H AEHXHHE5EH HG HEHHc뜅H HH!HEHl$Ll$XLO H\$`R H\$IGHth I?yLqL1ɺF1H5Й AE|Hl$Ll$XH\$`sL͙ 1H5!3 H\$A{jL™ x[AR-p1ɺ>E1LJHl$XLl$`H52 H\$h{mAVIAUIATUHSHHYHH5~HAH9C@Hk8HHLLAă1L1H5h zK@IpBH#uLK1ɺH5 z^fDS@Hk8teHHLL(AăL1ɺ1H5З KzK@hHC8[D]A\A]A^@IpBHt11#uAHHLLAăAHHLLkAăCH8HLLJAă"HHLL)AăH(HLLAăhIpBH 11A1@AUATIUSHHEu9uH[]A\A]DzZuvH[]A\A]@IH=aX A_thELHqt[HD[]A\A]A^A_fHD3EuE1EAD}HHՐD}HDD}AHE1AWAVAUATUSHH $HfLH|$ Ht$dH%(H$x1HD$`H)D$@HD$)D$PI9Hl$@L=5k L$psHHعLHHUL . LLiG 1L$>yL$HعLD$LHLD$HHL_AXLMHT$8Ht$H{H$3IHt!H{H$3I`HLM1ɺL:1ɺ41H5r TpH|$89*HL$HA8;H|$8 *HL$HA8H|$8)HL$HA8L1ɺ31H5q TL1ɺHt$h2HL$LpHA81HeH-.q Le HSL+1ɺL1ɺ51H5p kSNL1ɺ61H5p ES(L1ɺX]ATUSHdH%(HD$1HxB1IH7HxBH4$1HRHE@HM@H9tDPPHH9uH]PLePM(I9u_HpHt HSH_HS8C0Ht'HBLExHHHu@H@HHMPPHI9HHu@L1ɺ<H5xq 31Ljd 9H5Qo QHT$dH+%(upH[]A\fDڐL,1ɺ6H5o Qf.Lo 1H5n NQ[fAWAȹOAVIAUAATUHSHdH%(H$x1ILH4$H1HT$@DD$HpSLl1ɺH@ILHH\$HHAD$ lBD$hBD$@_T$@|$Ht\HLLH AŋD$@tzLHUH$xdH+%(EHĈD[]A\A]A^A_fHHuD1M|$E1E1LPHATje]H AŋD$@uHpBHv!tiLb H5m AO<@HpBH1Hn zoLb H5l A:OLHTf.LHeTL1ɺH5{l 1ANdY@HG@HtfɀvfDbfHG@HtGfɁf!tfx"t% fffAW1ҾAVAUATUSHHdH%(H$x1#HHC@HtftHH1ҾfI!OLI1HHC@HfX D$@HtH5HXqD$@E1AAD|$DlBH=k hBAIHG(H HHfH@ @LD8LxLpLxLxHf@@ @0HUHH|$LxHBHE ЈEL$LHDŽ$LHL1j$D$DPD$HPD$LPD$HPD$XPDL$\LD$pH$H$NH@IHFH$HHkLxBL$LPH;LhLHLLHYHBHdHpBAHBHdHBHdHBHdHBHdHBHdHBHxBHdH$xdH+%(QHĈD[]A\A]A^A_DAL= HLpUL HLVU6MD$@D$DDAJ1ҾfHAąHtH5HTpD$@E1fDMD$@D$DDADL-g L] LJH;LE1=L!] 1H5Hi +1E1L-] H5g IfL-f L 1ɺ LfIH螌AątwE1&L] 1H5h +L[fDL] 1H5xh *fLl1ɺ&1LHfDL-,f Lg 1LH&@IH-e 1E1Lf H[H1HLr ARL LP[ AW)HXZfL1ɺ&1LH fDL-le L[ 1LHǃBGH]A\@L1ɺ1H5] ?>wf.AWAVAAUATUHSHH(dH%(HD$HF`H-sXt?t:HzLT 1ɺIH5 1A=HH9t-HHt!LbHI#T$`(H AAAAA 'LH=I9HEPLHHD$L9|I9HMGL$LMMHfDHBLHHM1L1LH I@IHH3FH3NH 1Ҿ9HHE`vHIHLS ATI 1H5i K3ZYAWAVAUATIUHSH B4u<4346HHAH9L-RL= (f3uIH{uyHH9tX3t12LLw23tL1ɺ1H5j E1I2ćHD[]A\A]A^A_fHsHHtFdt:LaL1LE11>uH@X@cfDۉfDAWIAVAUMATI1UHSHcHLD$A$2HCu HHE@Hf/1ҾHƾL O LO H5- ҃HD$XH[. LE110HE@H9DHD$PAbH1AeH5O >Aƅ1AbHAeH5O 蜠tHE@Hf8##HCHAu @AEH$H}AujLDLQJ 1H5 IX1Z/HE@HL$XHfx\HL$PL , tCL ^t7L t+Lc 1H5< I/L -L%N 1ɺ1H5? !/G@A $7L1ɺ1H5 .HD[]A\A]A^A_DAEHtKftAfC 1E1LI H5 |.f.1IfHAH\$hH5HAL1ɺHH5H@ H@XH11HAƅrLK(1H- LS H-LE11H-L1ɺH5 1E1l-H@+AL̮1ɺ1H5= -;f.ATUHSHG@HHfW Af&&ɉMt &CA D AAHVHHHHH HH H HHH HуH u_uZttMDME|=-LN(LIG *11H5* ,EDDeAtFE A 2 A9rcEt^AD$DuT[]A\f.Et=,LF 0H5 11+EH$DDLjH{LL}J IXZ?1H51 +[1]A\@HHNHA1EA D AA0h1LE j#H5 *AZ1A[[]A\ff&"|& AfD1L"E jH5b D*1~DH$@DLjH{Y;^IL9V 1ҾHHH{L4ju$D誶=*_IAX1LH 6H5 1i)DesHHNHuMtZɃ AHCJfuA%fAAff.AWMAVIAUATMUHSHHHG@Hf8#I#LT$A2^~LT$A.HA2I~AA$jMEHLB 1H5< IX1Z(IF@HUffU(f%HI<$uHtH5972AŅI^HIH1L9uSxHHHthH|,E1HHTL$AŅLHL9fpt諾IHHtHhfpuL1ɺ1H5 LE1&E1fHHmHxPHuM'HD[]A\A]A^A_fDEI$fDHt{HSHHH8t#HxH5IHtWHID$L#IA`Ļ1ɺ1H5= &Rf.AE17L1ɺ1H5 E1%H{Uz1E1H- L;A H%L211H%@L 1ɺ1H5} E1\%HnfDLԦ1ɺ1H5E LE1!%<1$fcHI$ZL1ɺ1H5 E1E1$f.AWAVAUATIUHSH(F4HT$D$F5D$HtMt$HMl$HM9#E1BMMtfLl)E1LIHIM6M9fA t螻HH2MtLxfA uL1ɺ&1H5 #E1f.HH[Hx@HuH(D[]A\A]A^A_fML_H$H I|$H5j .D$H$L(McLd$1MeH5IL裴IE Ht DE~L 1LL? H5 E1"H$Hxh-fDLl1ɺ1H5 LE1"HH@UH9tEMmM3ALd$LfL1ɺ)H5j Q"o@H5_L虳IE HDEH@U H9rE gH$1E1Mt$@MtffA8t(1ҾL\D8D$ADՈE4AfAXt(1Ҿ!L)D8D$ADՈE5AՋE=v E1H HD$AHtD(H<$KL RH56L耲t2IE H8H@UH9_ETH5WL;IE H0H@UH9E 1ɺtE1LH5 ~ .1ɺ.LLH5p W uH$1E1PL GL  H5( LytAIE HttL  LE1H@UH9IE>L5]LL"tIE HttML5ϬLLt)IE Htك8uH@U$H9E$L5LL趰t)IE Ht8uWH@U(H9E(H5wLztAIE Ht,8u'H@U,H9bE,WL %L /H5]L&t)IE Htg8ubH@UH9EL5LLt=IE H8H@U0H9E0L ګ'L5^LL蔯t6IE Ht8kH@U4H9sHE4dH&LHHAƅt5IE H Htr8umH@U5H9%HE5HyLHts|$H^t8IE Ht 8uH@U H9E I8HΪIL9 }H5K 1L(.H LHqt7|$H tIE Ht8uH@UH9KE@HLH$tC|$H^IE HB89H@UH9EHLH˭tD|$HIE H8uvH@U6H9HE6HۨLHqtX|$HIE Ht18u,H@U7H9FHE77L L yH5,Lt=|$@IE H8HpH}8t6AƅtGH5L趬AƅtRML7 11YH5I +L1ɺS1H5# LMLS: ]L ]f.AWIAVMAUIATUHպ SHHH5p HdH%(HD$1H5N H; H5A HH53 HSH5& HH5 Hs}fA}u7DeAa(CP@HS(H5oR L1)AăL91ɺL% 1LLI 1E1L. \HD$dH+%(dHD[]A\A]A^A_fDHH5& LL1ɺAăl1H;dLTKPfDHT$H5Q LD$4LP1ɺAăD$==L1ɺHSH5eLAăKPHSH55LL1ɺAă{1H{dLbKPAHSH5L=AăKP\H5)H AąCP HS,H5(P L1AăL1ɺLܘ1ɺDLĘ1ɺDHS H5L}AătL1ɺZfKPH5(H<H5H  H5(H,H5HKH{@Io1E1LT9 H5Y ;fDL9 1H5*  KP L8 1H5 rKP@iHS0H5fN L"AătAL61ɺHS4H58N LAătNL1ɺKPHS8H5N LAă%L͖1ɺKQHSET21LH=,1 L<Hallow_diH9D$pDHA I9D|$xsectIf|$|or<|$~s1HD$H5J? LHP1 MHD$@AD$A AA=UHD$H<ff|$xim |$zeHD$H5> LHP(1L1ɺUDHD$H5> LHP$1Vu!HD$x$dRHD$H<@LL1ɺfH- 1HML] H1w1L1ɺHZ1H$dH+%(H[]A\A]A^A_|$xscar)f|$|dsHD$H5= LHP81c1HD$x8;HD$H<D$lHD$H5Z= LHP,1L#1ɺ@L 1ɺD1ML H5_ A1Lƅ1ɺwHD$H<(fH- 1HL3, Lu11H-HD$H< LE1ɺfDL,1ɺAWHGHAVAUATUSH8H_HHt$(HL$DD$$HD$H9IcHLL,@IL,$HMPHAH@@`|$$HL$JL HL$LhHyLհHLLHHIHEPLHxH|$t,HD$LLH@`H@HxxA…DHH;\$:H$HDfx(tL8MtH|$(Ht1҃|$$LHH|$t|$$jHD$LM.M9uIEMM9hIIvLa uI6IFHFH0DLHHD$MuL9uFf.IML;t$t/IIuL uIEIuMHFH0IL;t$uH|$:HH;\$f.A`LHuHL) ^H51XLyZ1ɺH5 1E1H8D[]A\A]A^A_fDHD$H@@HtHHt H9H:D$HMPH- 1L) HWYL^1ɺH18D$gHEPuHML( efHEPuHML jL_ 1H5Զ E1HB$L.11H5 D$AUATUSHH*dH%(HD$1Ht`IIH/H4Ht9HHLHHM,$Mt|LH u}H,$H+H^u*HT$dH+%(H[]A\A]fD1IL' H5 1DI$f.H1IAULq' H5q SX1Zef.1L1ɺH5= 13ATSHHt)H;Ht l^AątEAHD[A\@ALY11ɺH5ʴ HD[A\ÐL,1ɺ1H5 ff.fATUH SHHDIHfH@@HS@H(1Ht 1f(-AD$AD$ HtjH[HBHUHBHOHBHIHBHCHBH=HB L[]A\@HpBuHfuH{LE1C͐L% 1^H5j Lf.AVIAUAATUSHHHdH%(HD$1HH@I1DfHHɕAą~H6H T Dm ASH} L PH@H5t$QAH HEHt\InAHD$dH+%(HD[]A\A]A^fDL|1ɺ1H5M /DH{HE1L|11H5 y1E1L$ H5 J?ff.@HUHSHHHFHt H8HtqHBHBHBHBHBLBH5H LH=HHuH}t%fEEH[]f.HpB,=t0HxBHǃpBHtHǃxBLD{1ɺH5 AWAVAUATUSHL.H|$Ht$IMdH%(H$1H $L9D$II,$I9MuI1fIwLM?M9uL}1LoLt$ L)L$ oP)T$0LP։T$GT$H=LHHH@Ht~HH|$luiH}Ht$P@}MHUHEHBHIM9tBI}LIHuuHEfD$@)D$ )D$0H'IM9uMM 1L! H5 HD$H&H@ HHHHfHHHHJHHKHQfHH9fxuL! 1 H5e GIUIED$HBHL,$IEL;l$tqH$Lx1ɺ H5 @LQ! 1 H5 xD$H$dH+%(uD$HĨ[]A\A]A^A_fAWAVIAUMATUSHHH|$0Ht$ H H$dH%(H$1HL$D$<H9H$L0ILt$HL$L9LcLH\$(MHuLIHrt'I$MLL;$$HuHIKuHuHEHFH0I?IGL}HEIGL(MoH\$HH;\$ tHD$NfDH$dH+%(Hĸ[]A\A]A^A_H\$(HD$0H@ @L$<4LKL 1ɺ 1H5 Hl$0 H}̢IHIH@LsLH}LhL蜢HLLHI?ID$IGM<$ID$IGL MgfLKAII1f.<-tqHcD4@HuD$< H|$@1xD$<H$L0ILt$HD$Ld$`L;4$Hl$Ll$I~@L&yH{L2Hl$HMN1AT L H5 lIIFHBHI?XZIGHT$M>MnIFIGLHIW;L`HD$0LHxHHtLLH HHKm@IELML;,$I @ID$;D$<H $H5wH=wF ff.AWIAVAUL- ATI1ULSLL HH$H$' L$DL$4HD$@H$H$dH%(H$Hb HD$hHf HD$`Hb HD$XH^ HD$pHZ HD$xH. ( HD$PHG @D$1H$0AHD$8H$8H$0H$ HD$H$(H$ H$L$L$HD$(H$H$ML-IHXHIHtHLHIIHt$L HD$H9$ HDd$E:H5\W L4D$4 uL謇Lr1ɺR  1ɺ] L1L^ Y1LL$} Hl$H9$ DŽ$L9$L$4y H|$(LHD$@HD$HH HD$Hht HxH# HDŽ$DŽ$H$H DŽ$H$HDŽ$H$HH$HH$HH$HD$H9$  H$H;D$(DŽ$DŽ$HD$ MH$@HU 1DHL$ HH8I1t$(L - LH!1AZA[$t1H$HL=5 HLHLH$P\$DD$L$TAHHD$(^_LH$PH$PLD$ H$$iAXAYH$Hta}#t[L{bt ua@ H$HtP,tHx@P,HLX^H$$ $$4D$EsH$ L|$L9IH$0HH;D$8 Htb}#t\La=t u`5 HL$HtA,tHy@A,HLp]H|$ $HHHD$HHD$H;D$(k7]$[DŽ$HD$DŽ$HhL`HLxHtH'$Ƅ$@HtH5pH3H$@HD$ Mt@HL qaHLfDHD$8H9$01fDHt H;; H$EALt$ D$$HDHgf.L1Lc/HIHzMIL L1$HH9[L3A>@uA~MfLcVLILpLsIHtLLHIIHt$8LIuL @LA11Lk1ɺ6 LHD$@HD$HH|$@^HD$hHRHD$PHNHD$`HJHD$XHFHD$pHBHD$xH>H$dH+%( HĘD[]A\A]A^A_f.LIHPHHT$SIHtHT$LHkIIHt$L'_L QLA fDM8L HL9tHsHXu@HD$HXtNHt$HHL$E11LHF@~HL$HHAQ@t DHE_MH ILHED$ H1ɺS L P11AZA[HL|$HHT$LH$LЉIGHtD@ED$$H={ t$Lei11X LH=Z $9M؉$LHLOЉ$H9$ bHD$8H9$09HD$@AHD$H9L  (LAH|$H*D1Lci2H5fi$LWh1ɺ 1LMH=? ~DŽ$Uf.H$H HL&1ɺb LLgCfD11Lg8 LH= ~H$DŽ$hHt[}#tUL}Z t H$HtP,sfHL`V H$DŽ$1ɺ@ LLf=1ɺ) LLfHD$HH611L G LHtZ}#tTL^Ytj uXjHD$@,tHL$A,Hy@rHLBUH|$$@1ɺ0 LLe%H= |DŽ$@1ɺ^ LL}eX1LfHD$HH1ɺ LLEeAHt$HLfDHL$(Ht$LLzfDD$$Lt$ AzMHD$HH@Ht $HH$D$H~H$HwH$HpH$HiH$HbH$H[$D9DMLLd1ɺa LAHD$@HD$HHD$8H9$0$KfDH$0HH;D$8HHD$L$H$H L$IHHD$HL fI\$I9t>M M6I9t0IvH|uH$L$L$ M$$L;d$8uH$L$HD$L LL1tHD$HH@@X1ɺ< LLb={]Hx@P,]UU=1Lb1ɺH LAHD$@HD$HHL|1ɺ LL1bA1L 1ɺq LAkHD$@HD$HRD$11ɺH LLa.tf.HHH9кHDHt GdvHHHQtE1xLAADfDHG`AH$rH%ArH0ArH-ArA uA@uAHxH1ArH A{A iA WA @EA 3HAHA H$AH%AUHi(H5 H$AtH5 H EAD]@AvDAWIAVAUATUSHxH$Ht$8HT$@H$H$H $D$LL$pH$dH%(H$hHEHD$xHIH$HBH$H;H$H4H$HH$H$HD$0H$H$H$HD$`H$H$D$lHt 1H9 D$lHD$@D$HHt H9D$HHD$pHD$(HHD$(D@Et HxD$lD$ L$H HL$8HLH4HHH'D$HL$#D$lD$LL9FL|$D"D$FImHE H]HHHE`HI|$2r Dt$HEyH7HD$H@@Htf!Ld$@I,$I9uHmI9kHuH?uAQSHD$HH5 1L L1{IE^_L`HLt$@II9Hf.HmI9HuLuH+Lt$@H9\$@u;fHEHI9t-HHsLuHCHHHBHHEI9uHD$Ht$`LHxuxL 1 H5Ǒ L|$D$HpI]HC`H70l$LQ\$IEHD$ Ht$(D^EtXHFLD$ 1HL$8H|$@]pHL$(HADY@Et DPEIEHD$ HD$ 1H5 L\ LHH1HD$Hx虇H fH@IUHPBd H$HHL$0HH$HHHBfDMmL;l$L|$AHHkH$H$H;D$0TD$D$LG k H$LhI]HIE H5H&AEf@H$Ld$`L9uQ @HmL9@ HuHuD$hIo(DfEfAAG\L ÃE1Ll$PMMMHl$XH݉L$HD$ @II(D9|$EIEt7IF`/JH$HxL L IH1D$LfDH$HH$H;D$0H7HD$(H/@ t D$l HD$8@, |$LV'L$HHD$@L L9H H-i Dt$LHL- HHID$HMH޹hHPHHD$HL1HA9DLXZDfM$$L;d$@uDt$LH|$pH2H/H,H)Ht$(L f11L411L4oH$H$LHL$JT=pE1HB1HI@H4p"HRHf|(tHH9tHHuAHH9u|$PDD$H$H$L耡1LO2H5PwLN1ɺ 1H5f H_D$hH$HD$XfE1Ll$ L D$AEH$ILH$LL$))@)@ )@0@AtSAH DtHsA@Ic1IE)LL{HIc A9~ AAuH$H$Ƅ$_Ll$ D$HL$fLlHt$X1ɺ $IL 1H5 XZD$ H$fLTHH1ɺ $IL H5 1HY^HDLM D$ QH$H}Lt$XfA)LA)FA)F A)F01uHLfGH1ɺ AVIL 1H5 AYAZHD$D$ Hh(H$HHD$Xf)H)@)@ )@0tLfA;GH1ɺ t$`IL 1H5| ^HA[A^HDH D$ IDD$ L|$EzH$HpH$HtL$hHT$(LЅH$H1ɺH- Lw HCHLHHHD$@1ZYLLt$(HsH$LH|$ptIFHt@DD$D$H= WajLl$PHl$XMD$HHHD H HLt$XfJ|=A)LA)FA)F A)F04rLlEH1AVI1L H5 _AXD$ g|$hH$H- HxEL! IdHH HHHL$XfJ|=)H)A)A )A0|qLDH1ɺ t$`I1L H5 AAZA[f D$ A11LVIHH=H _D$L9M؋$\$LLI1ɺ1HjD1LcKHDH HH 11LtQH$Io(Lh~CH1ɺ $ILc >DLl$PHl$XMAT$sLLÅBCHcH1IHH[ L HRY H-} 1Hu_AX?t$hDD$LD$LlBH1ɺ t$`IL BH1ɺ t$`IL3 HLD$ L~G1ɺr H5| fDM$$L9$$D$Lf 1ɺ1H5au D EH$Hl$0H;\$0HsLHH9u31LHD$(H4LF1ɺl H5-| H= ]D$LH`H]HZHW/f.KAH1ɺ t$`ILR |$L1HD$8Lt$8H@ L%Lr LHI9uZf.LHyu/HAuMH޿(L ^_IEIH9KIM IUIuAtHLe IDH1Q1RvVMHH B@H1ɺV jIL Lo 1 H5z L|$mHAH(H9=H HmH;-!#H}(HtHuH}(IHt@atpXH=軼LHH9HD$8HHHHD$H HL$H9L<$Ll$(H-y v@LcID$LpHHP HL5u$D$HD|$L%*L5kEuzH\$HH;\$'HD$LtLD12H5D[LLl$ H\$0MIIIGHAHL%L5EuEtRIEHL$81LH<$L@WIEEU@Et DPE/LcID$H1ɺFL HLHHHD$@14A[L[H5H<$H$H|$ptIEHtDHEDD$D$H=t XHD$@HH9kLl$ MIMH\$0IHIE8-uHxL#tMmL9uMLl$ H\$0MLH\$0MMLMLl$ H9L$@mLLl$ MMH\$0IHIELL9l$@-IHsLuHHCHBH1LA1ɺMHH=w WD$LD$9M؉\$LEvL@A1ɺT1HL<$蓿L L HiIE@HD$8HHL$8a,HHH|$8蘧@HD$8@,LD$LL<$HeHbAH>HH0H1HHgD$L_D$D$LL$@1ɺ,1H5u L<$sD$ VD$ |D$ APuHHD$H@@Hf!P1ɺ L sHHD$HH5u L1ZYx@H\$8H蓘u31ɺ1H5h M莱H=" }ID$DH\$0H9$DL$(1D$ E!‰$_L21ɺH51h D$gL=A$HM1HD$L0 H5g 1述XM6ZL;t$MH|$xH HHH H$|$DH= HH$HH$HH$HH$HH$Ht(L111}H5g H= \$DGL$tDl$d9MD$tEu$ B H$HD$8Hti8#tdH|$H*$lt6 um#DEH$Ht P,tHx@P,8Ht$8H|$Hl H$WH|$XMDT$`E DL$ EuHD$0H9$N H7H4HD$PHHD$PH;$IH$(|$tML|$HH$8$ H$HH$ HH$HH$0Hr$<D$tD$9MÉD$EuL9$`VL$1#HDŽ$LL$fH3LH$HHGO IH$H$H$H$H$H$H$H$H$H$H$H$H$H$H$H$H$ H$H$ H$(H$0)$H$H$H$0H$8H)$DŽ$H$H$L$H$H$ DŽ$H$H$)$H-3H9u_fH$HUHPhH$HHPH$HHmH$H܍H9N IYHuL H51ޫLj-1ɺOH5b 1轫D$H$`HL93 H- 0LJI 1H5b tHL9HCHt HHtH9uL fHD$0H9$L9$` kf.HHL9HpH9uL9tHBHHH9uHAHBHD$HML 1PH5a 1螪XZLH|$HHL$(Ht$HD$hH= Ãt(L+11H5ma TH= FBD$D9M؉\$D@H$HH;D$0I$L$I$L$IL$I@I\$I9tNMfMmL9t7IuHKuL$L$L$f.M$$L;d$0uL$bD$RfDHD$8HP 1t$`HHwHt$8H|$H1H$DhVH= @D$t6fID$@HbHHVH9MLJ1L H5_ 襨HD$(H@@lHMHD$LC H5{_ 1Z_AXfHMHD$L H5;_ 1AYAZHMPLw H5_ 1A[[_@H D$`HD$8H&H5,H>HT$8HF1L)2H5)l"1L(1ɺEH5[^ ML|$H5H= $?H$(D$tHm$8h$ _H$HTH$ HMH$HFH$0H?LC(1ɺ1H5] 薦hL(1ɺb1H5] oH= ^>D$LEHH|$XD$t>H$D$t$p$HH|$X$ D$@$LD$d+H$HD$#Ht$8H|$HH$DHc reL6'1ɺH5\ 若fDL )HپHھD$`H$$bL&11H5C\ %H= =$LD$tFHD$XHH"1L 1ɺnH5[ 赤HD$8Ht[8#tVH|$H<=~tH u5lHD$X@,tHL$XA,Hy@PHt$8H|$HH|$XzD$`L%1ɺH5[ HD$xHD$(HH|$H1oHD$(HL]%1ɺH5Z 貣DL4%1ɺH5Z 艣pL9$`HD$XHHtc>#t^H|$HD%1Et h-t?H\$XC,tH\$XC,H{@HH|$H3Lq$1ɺH5Y Ƣ$HƄ$ D$@$LD$dHD$XHD$1H?Ht$(H|$H˧D$$L 1ɺ1H5\Y 1<1L-$nL#1ɺHH}@HLIH6AFbt1#LHH$L$PH$H$ H$H$H$IHtsL9tnLH11L H5}X _1HL$xLHD$hLЃE$+2L1L#+L H|$H@H軤L"1ɺH5W ԠAhH$H9D$LH$`MILIDIMHL9HHL9H;Hu @L9tHBHHH9uHFHBHHE @HYHHMH9DLHlL% 11H5W IE1H>HHH@PH)HHHHHHHT$ HL$/HT$ IuHL$HR`H$0H$H$PHo)$o`)$HL$xHD$hLLHЃDD$D$WubMH$`MmI9t|$ED$MID$9fD$uL zL/!12H5+!衞uIEH$0HB`H$PH@ H$f)$)$L1ɺH5VU =D$+DŽ$<L? 1H5U D$0HEHth H}ŢH轢ED$D$HEH}$Hu莢H膢D$L1ɺoH5sT Z!M1IﺈLls1MLf H53T ID$PP$ D$tRH $H5"H="r8AWIAVAUIATUHSHXHHHL$HD$(HHD$ HHD$@H޵HD$8HڵHD$0HHD$HHH5S!H芟IID$ AHD$H9HSHB@HHHH9HAHHLLH HD$AHtHEHt@DD$ D$ H= At(L116H5QR 8H=Ѹ D)3E9HHHELH;\$$1LS2H5V̚LJ1ɺ.1H5Q A藚H=+ 2HD$(HڳHD$HHֳHD$ HҳHD$@HγHD$8HʳHD$0HƳHXD[]A\A]A^A_@IHHfDH{T@HiHEH\\$ XPfDAUIATUSHHHo@H/1҉F$F9'f `H fHC@71ҾJL&CXfthL&AąL&fC uzL ~@HF1Ҿ9\&A1E1Ld fH5O 薘HD[]A\A]HHHK0H `L 1H5bO E1AHD[]A\A]HC@1ҾLydIm@CXHL%HC0C HC8HCP1ҾLuHHCPHhL<%CHIE@HHtfXtHHHAH[D]A\A]DKX/L. 1wH5ON 1@1f(HC0w uL HHHs8H tL ofDHHHHtIHH9IE@Hfht+`L fX^PQL fDf(HC8HWH1HDfDH1IHH"DHAI}LEMjA$"I}Hs8$AHs0HA$EMS"1H,$IL& 1H54L XZHC0HC8r@IE@rHHCP"fXt PHXHCPH1ҾLarCHHC8ff.AWfAVAUATIUHS1H(H|$dH%(H$1HG Ƅ$)$)$@D$8H$zHD$(H$H$H$HD$0H$H$H$HD$H$H$H$HD$ H$H$HVLl$dI$A11J<I$NL L0H|$HT$HI$I$HD$@L+IH9&Hl$Hl$"f.IEMLL;l$IH1HSHHuLKLLL$^ZHLPLL$(1FLO tHHCHBHYI$^HD$@HI$HCI$L0M$IfL H5F 1E1@IFLp Hl$HD$D$8%D$H1A$0I$aH9+1Ld$8L$ID$L$0HT$T$9 M$$I9I|$LLDŽ$DŽ$2t$tWu$\$IT$HtHHt H9 L ~oL 1ɺ^1L豍gIT$HtHHt H9* L :oL 1ɺc1Lm#Hl$H I|$ H 1I|$\袑H LhhM I$L3H9 HM$HIH@L\$HL LT$LPML$ 1ʌHHCHBHAYI$AZ[I$L\$LT$HCI$LH(I$ILLM9K IL9ktIEHt L9NHmFLd$8A$0M$IMI9Hl$IFHHH5- HDH,H9#LIHL 1LR1跋Iv_AXHHH/HhPAFTHHmHHH5HHL$踎HL$IVHHHH9LHH1L@ LU1ANTHAXAYHPHD$HHT$Hx8HHtHT$HHИHINHi7IFA|3 HHHH9 LJL 1ɺ&1LRANTHR; I$(AFT :HD$HHx8HHfH@@@@ @0IFHA8H HH H9 LjLHL$ȎHPHD$HHT$8Hx7HL$HHtHT$8L褗HL$HHy(AFT` IDII$I$a}fHHH5* HDŽ$HDHNH9ELIH1L 1RLMFXZAHjIHH9 HAHHH3HH3GH HVHFH3WH3GH IHt L9HL jL/ 1L6IIFI$HBHI$I$IIFI$L(M$HIIA$0H;\$jHf.H HviH9LHH HiPHHmHHH5 HHL$֊HL$IVH HH H9 LHHLX 1LU1ANTHHPXYHD$HHT$Hx4HHtHT$HHHINHaIFA| H HH H9 LJL 1ɺ1LzANTHz7 I$(HD$H@@H`fRHI~H$HD$ySAFTHT$H9$#D$8D$@HD$HHx3HHfH@@@@ @0IFHA8HhHH\H9SLjLHL$P蔊HPHD$HHT$XHxZ3HL$PHHtHT$XLpHL$PHH$Hy(HAHD$HA AFTUDt$8IDEtID\$@EtII$I$HI$HAI$HI$L ofL cfHHH9LHLn 1ɺ1LxE\$E{ANTIvET$E_IVH HHH9LHL L eqIHt L9<L eL 1ɺ1LуANTzT$n$_9WHq1LPDL$(1L uXZ)fDIVH[HHOH9FLHLC 1ɺ1L%LA$0t A|$ I$HHHD$vDD$HI$HD$ED$8\$8I9$tLQ1ɺHD$I;$rI$I$LmH9H\$@Lt$LLd$)uHUHEHBHIELL;l$@|I1HHLboE@uHu8HI9tHPHHH9uHQHPHHHD$HHHAHHH\LHLHHHHH9LJL߷ 1ɺ1LqANTLHHHHH9LJL 1ɺ"1LANTLHL bHD$AFTD$@D$8IHD$H\$@I9$t |$8zI$D$@H9H|$11H5* I$LuH9_HMLIIH\$lfDuIIFHBHHD$I9t |$8~ B4u AFD} HEIL9HH|$LLlAF@xIv8IDH9dHPHHH9uHQHPHI1HD$HIHAIHIL12H52L1ɺL1E1 MH|$1H5] AŅ D$@I$H9\$Hl$Ll$Lt$ TfH@HSH$HPBH$L0HPH$HHH$H9I}D,HuE1/L-_vIVHSHHGH9>LHL -IFHHHHH9LJH1LQL }IIFI$HBH^I$_u3I$I9$L; L1E1QG}*L-^L ^HD$(H9${LŞ 1ɺL1ɺ*1H54 E1|L ^Dl$@E3t$8L Y^ L M^ L A^wL 5^DL )^AL ^HAٹLPL w1E1=|[L ]1ɺyL1|L ];HHL$LhHD$LHx)HL$HHtLHHL$HHy0YH$Hl$H;\$ t HHS1HHPHH;\$ uHD$tA$0u HD$1L 1ɺ LL{HD$DŽ$H$HH;\$ uD@̐HAE`H;\$ t/LkAE`tAuXH=tLʸLkAE`HT$ H|$HL$aD$EI$L3HH9\$DMAIELLL9l$IH|$1HSHHuLKLLL$HEH(LPLL$X1L zHHCHBH^I$_HD$HI$HCI$H(I$GEHD$I$H9t$uHD$(H9$HD$I9$t |$8wL$@tEHH9t$Lz$HHH9t$uHD$I9$t |$8I$H9t$Ht$H|$0lAD$I,$Dl$HH\$0HDHD$@L$LuI9uefDMmI9tVI}L[uIMIEHAHI$[HD$IEI$IEI$L(M$HH;l$@yDl$HI$HD$0A$0,Ht$I$lI$L3HH;\$0u=DFy8yILLL;t$0xILKLR 1L\1wHCPHSE1HsPAD$PH|$ EL$A[ZwHHCHBHI$,HD$HI$HCI$H(I$.L12H5*wI$H9HXL-XL9;LIH9LL ILIHSL9uDHL9H;PuHHHH9LH11ɺLLT$yvHHCHBHH$HD$(LT$L HH$HCH$L0L$HUIL9LHIEH/Lϗ 1ɺ"IIFI$HBHI$II$1LLNIFI$L(1M$uHHL$zLhHD$LHx\#HL$HHtLHtHL$HNjl$8Hy0&/IIFI$HBHI$II$1LL@IFI$L(1M$tIVHtrHHtjH9teLHLE YL*1ɺlL1ɺYAL1L1Xt;L U떹 L1L4 *t Ht$H|$0gL1ɺ51LsL 1ɺ01LsLMHUH9L VU H W$H5H=2v}DHD$I9$t |$8A$0M$(MLǪ 1ɺp1L!sI$(H|$/~HD$HI$HIHD$@HD$HHD$HH;\$0ECTHD$(Hx HHHD$LL;\$HvHCML;\$HbISH9B@uHHHH9LJ11ɺLLT L\$P1rL\$PI$I$ICHEHUH|$E11I$ HUI$ H*H$I$ o)$oP)$Hs@Lt$@ILL;t$08HD$@D$I$I$HD$H]IH9uYHuH|$b=rLML` 1L1'qHIHH;\$t}HH}+YuLMLL pHUHEHBHI$yHD$HEI$HEI$L0M$sH$L5KRHHHD$H;\$(H{XnH-RLSH(H9u|HmH RH9teL;UuMIHL9LH1Lb @H5LT$0oHUHELT$0HBHI.L9umfHmL9t[L;UuMIHL9LH1L @H5koHUHEHBHHsH|$^=pLKL\ 1L1#oHl$HEHH;l$(HD$L PgLKLLި nHHCHBHI$iHD$HI$HCI$H(I$hL 4PoH|$EH$H;\$ ud@HH;\$ tVHkHtEatuXH=gH΃sLM$(L nDI$Lt$H-b H9\$t5IF(HsI1ɺ LL1mAYHAZH9\$uHD$I;$ ArL1ɺ1LmmI$L5ZVHEHl$HD$HID$(H$H;l$0D$A$0t EThHD$I9$t |$8fHD$(HxHD$`HIH]L 1L1IlHD$LEH@hLD$@HD$PH@XH@HHD$hvIH6HxHH1HH)HIIIILD$@IIID$(ME@HD$@ID$0HD$pID$8HD$xAD$HD$XID$PH$AD$X$I$H oA]o`AeILHT$@IHtdH9mIU@HHHH9LHH1Lt 1t$HLDkHD$PIAYAZH eNH9HT$pHT$xH9H|$h(HHdfH|$PH@ @LhHXAH|$PAH$HGXHG8LIEpHGI}`Pdt$X1ɅtbLIH݉H~`HGH@ Ht41Ht$@I$D$L$Ht$@9\$XuHLIAomH|$E11H$)$Aou)$Hu 9H11ɺILAL6 iI}@XZQ`AD$ tTI1ɺLً L1iDjI}@Eu$H=-|11艄1ɺL1IL 1iH|$1LKIٺL=SjL̢ 11hH\$`I$I$LkHI$ HCI$ HI$ H\$HHT$0H\$HHH9HD$H[HV@HLHHHH9LHL1L4 :hILX L1hHUHEHBHI$HD$H\$HEI$HEI$HI$LL$L$ME@L GI)L LtgXIٹLL 2IL L1IU@HHHt{H9tvLH L1L fâL M IH5 1fIL L1L DH녹L1L rf3IU@HHHH9LHL1L9 'fIU@HtxHHtpH9tkLHL 1ɺ1LeWMtIIHtAL9tPjjfH HHH DE11PE1jjfH HfHtHG@Ht fH"u)HHIE11PE1jjDfH H1L ?H5 Xff.fHtHG@Ht fH"u)HHKE11PE1jjeH H1L* IH5? Xff.fHHG@uPHf!t}f(-uBHHSE11PAjj3eH Hf.Htf!tL I1H5ϳ mWHf(-ufDL Dff.fAUIATAUHHG@Hf!f(-uxf$t(L 1ɺY1H53 VHHTWL1PDHAjE1jdH ]A\A]@Htf!tL I1H5² UV]A\A]f.f(-AfL Dff.fAVIAUA1ATUHHdH%(HD$1H$iXHttIHHDID$E1E11H30LHPATjcH|$ H AZLHZHD$dH+%(uMLL%Lt$pM9D$ ]DfH@IVH$HPH$H4$HPH$H0HH$M6M91AtIIvH9IFHDH}HeLq1ɺHt$1=Dt$0Ht$H$8H4$H8H|$pHL9t)$HDHWHSHBHHL9u$HD$XL { HH1ɺPL=[ L 1L4=^_L$ H|$XE1BHM@Hft"RHH $|H $`A1HW?HHHD$`HDHHCEE1LHcLPSj JH HHAAH$dH+%(HĸD[]A\A]A^A_1ff&tgA@f8Dff8fxtf&Af*Afff/f(!1ffN@Ѓ!F= /f/1H=A $I9\$ HDd$4ILLl$8IL|$@HIHL9HI$1HULHuL}AdIHL9LI=6RHLQ 1PHt$1 5HUHEHBHAXAYH$HD$HEH$HEH$L0L$.fDL aq@L\$ Dd$4Ll$8L|$@L$L;4$t/\$ H$DHIV1HHPM6I9u\$ Ht$11L| i/4:L$HD$TI>L;4$S\$4LDd$8ILl$@IL|$HMLt$>f.H1IWHHI$LML;$$IIL Ct$TMGPL$tHHIH9fHB0HLHHL3H3NL HHH@H3NH3FH uoMIHzL9qHpBHJ L 6PfwHN V1L{ QL1ɿ2XZHH9LMIHL9LH=3L; 1D1L^2IIGHBHH$HD$IH$IGH$HH$RDIGH#HHH9LJ=33rLN 1`IWzdHT$ oHT$ H HH9LI=2LHL;N 1P1e1IIGHBHAZA[H$%MIHL9LH=_2zLM 1@L S@L @\$4Dd$8Ll$@L|$H|$t H|$pL7L9t1\$L fDIHWHSHm5HHM9u\$H$H9$H$E111HwH|$(ttH|$(1HHP0H@0H9y1fHH9uH$H;4$jH<$H1f.HH9u9Dt$0L|$XA M2fDH5A@L 1f@Ht$(L{Dt$0fHt$XHt=>#t8H٣6tA S0u^0LHt$XHܟE1DLv 1ɺH5܊ .D$0}HA IHHHt$Lv 11j.HPLt$pM9uM6M9I~uI~D IFHH} H`fH@INH$HHH$H4$HHH$H0HH$oHHH9uHH9fxu퀍Ht$11L @_-D$q1ɺLLϮ7->Lv 1ɺL=3 1L-Dt$0rL \L - QL<1ɺIVI Lu AVA A%A кPHt$1S,AZA[Dt$01ɺH5RL&,H$1H;4$/PH$E1fDH6AH9uH1QHt$1Lt +AXAYHHt$/&H4$H#&LL$XM9LVu 1ɺnH$1H;4$E1u5H }$H5H=-DAWAVAUATIUSHHHG@Hf( H HL5 HL{5LMmHLX5(L*H踌AŅMLH5L5H~L=I HL4Hc`tLDHhHXHHt H5: 4uID$(fx=E+LLZo D11H5 )H[]A\A]A^A_fDH)HL5 M1ULLs q)XIZL1Ls L)A$HNHHHc`LHǃH9HPHHǂ H9u@L)H)0LHHD$L9tSM~Lt1Lt%H5 HA3uH I M6L;t$uL5s HL2uK,DHHLHǃuGLH2LE1L9l$tXImH4t3H(t'HMHHL LuL MmL;l$uc,JfH5c H2II Lr L5t 1LO'L1L֨1ɺ+2'H[]A\A]A^A_fDLM1AuHc`L,'k1ɺHLr~L5 tH[H HHc`HHHǃH9tHPHHǂ H9uHCaL-! 1LyfI$HǃHt2H +H{LhLHWHLH 4HHf.1LZ1ɺ1H5ρ %H[]A\A]A^A_HI1ɺAUH5 Leo p%Y^H[]A\A]A^A_f.LLo Hp#LH=Hp蕡L >IH5 1$@L5߀ ILo L$T1f L5 Lso Lk$CatL-ÌLzLL- gL-1LeDAWAVIAUAATUHHHw@Hf( ^H f/HH 1H>&IH"HHWD1PHAE1AWLj0H LHA(]DA\A]A^A_f.uDD%<E|H5 HAąj]DA\A]A^A_DHD1H=On #fHA"#-L1LL j Hl$ M^(ff.AWfAVAUATUH0D%L7dH%(HD$(1)D$E6A1HI IHHE@H}f tf tbȀ 6t;H5ڃ Hu!Li 1ɺ1H5$y @ fHD$HE1E1IEH1LPDHAUj:*H AHE@Htf tT$u`LH!HD$(dH+%(CH0D]A\A]A^A_Lh H5Yx >@5H5Ax tf.L{LL|HsHFPHt$HHtctZHt$1LLxHsHFPHt$HHt'btHt$1H L HL9THHM`HHDžH9tHPHHH9uH$tXHhtL=LL"T 911H5^ rH[]A\A]A^A_fD1L1ɺ7H5^ 7H[]A\A]A^A_I1L:S H5[^ H[]A\A]A^A_DH[]A\A]A^A_@H{O~HL&PLS 1H5] XZAWAVAUATUSHLqHt$ANHI_ I1E1H$HII?1L,HLEHIH9uHH9HJH9A@uHHAM1LR .Ht$1XZA9nWELL.=LL$L~P H4$K119H[]A\A]A^A_DH%AHnf.HMA1LQ 0H4$1Le1ɺIH[]A\A]A^A_H] H$H4$1DL}_ H[]A\A]A^A_ff.fAUATUSHHB`VHHHHHB`H[HHH9tHPHHH9uHTH=LLQ 211H5[ H[]A\A]DLMt2LtH{LhLDHLLH] ILfD1L1ɺ0H5tZ H[]A\A]ILO 1H56Z H[]A\A]fkL/1ɺH5pI!LO fE1AVAUIATI1USHH@I4$dH%(HD$81lIm@HID$H7('t '*HCID$t*fHCAD$ tfh,C AD$iL,`,CuOL^ H5 1E1pHD$8dH+%(,H@D[]A\A]A^@H9X,HAI}E1A$jMEAZA[ILuN 1H5 `HCAD$HCAD$ C AD$C1ҾLaIm@C(HID$0L5 HC0HfxHPHrL:HC0HHt8u&LN 1ɺK1L$Hk0Ht#MMtLH@1ҾLIAIE@Hf( 8H ftHHvqw EwHC0Hk8ILZ 1ɺL1AI@Ct 'fhf1ҾL藇C(fxeHPHUL9HC0HHVMMLHC}HILL 1AVL5 1<Lt_Im@AX*/L4L (DLK #fIL`Y L1E1|@ID$0HC0f.fEP$ 1H|$E1H-X Lc1H . H9Ld$(E1Ht$HL$ LD$ Ll$ :4MLfLL L1E1xH- ,@Im@L5ٮ ?L5ͮ 1ɺ?1LK LIm@LE1L9K of.H1LIATLcJ O1:Y^;L1LK $kL/W 1ɺ1H5 H-"W McLHrP!L1LK  Lx1ɺ61H5u E1TLCJ H5 -Hl$ MI|$蕣H L.V 1ɺ1H5 H-!V LU 1ɺ1H5 H-U MueLLI LI 1H58 g5I|$آI|$ɢ#I|$躢L2H#ff.AWAVAUATUSHdH%(H$1 L$HL2LI襞LHZI1ҾQH$ $L$HD$ HD$(HHD$0HD$PHE@HD$8D$@D$HLt$ Htcfh#tYLI H5% 1H$dH+%(P H[]A\A]A^A_Ll$pHT$ HLktLH蜑tH511HH6zD- L$E"@L-%1ɺ1L>I LI>L 11L!% tH.Ht$pHc@HH|$p1}HH1H7IHn LHH ^ %=uD EtH?Ht$pHbLs1ɺoIH&H@H@@atIEH0HIEXt$xL(#$LA+$L,$xA;EPtAEPL$M A?t7LI}HPHH$uHHO H$LHH1 D$IL LH5+ EdA%HE@_AXHt%ftH~uIM`LL蹁M AL%gQ IH9$tL'H 1ɺ1L濄AIH9$tL6H 1ɺ1L濄xHE@HtVftLH]HL}HI9t?ft%HHLHL9uLNL>H$1LH<Ht$pHt0>#t+HgPAE,tI}@AE,Ht$pHu`h IHP HB =MPLRLBG 1Ƀ1IIY^Ht^vtU1LHL\ HH5N3=WH LG 1ɺ1LL%LHLC H57O @L P bf.L=01M1ɺLE1L[D FHD$Ld$H$HD$I[fDDL$A1ҾHD9IL 1L1A#4$E1E11ATL1H=Ȕ jjSjbH0zL LLo1ɺ@1H5N cYfL5M1LB H5Ln1ɺ>H5M Ht$pHtA>#t#tVH`t u_  MtAE,tI}@AE,Ht$pHj\LLHeDLL$pL QH5K 9/Ht$pHt?>#t:H_D%Et )u^4kHt$pHL%dK [v1LMl1ɺYL@Ld$A.\$L-J LLكcH3L5,L9t+HHtL(HL9u܃=eLJ L11EA-Aa%L1L '1ɺLL(k 1ɺ]LLkpLHLj1ɺi1ɺXLLj2j1LV cH5I  u`L,? LPL1L + L1L ? { ML]? L#1NL ? L1+1L L1!xL1L@ LL@ 17LGi1ɺ1LL%!H Li1ɺLrq1ɺLLhRQLH L1/.y1Ll? H5! IDžL溤L$L1 MPILd$IIH $HH?HLkIPIXL;HCIXHIXHHmH;$uLLd$LFqLg11L98H H1ɺLLg xH $H5,kH==kLG3 1ɺ1LH&LLxF AWIAVIAUATUHSHHLo@MtQAH(fL> H5c 1E1@HD[]A\A]A^A_fDrHrMH{rAHH5J L$ :L$ t$D AAt H@ A%AJf.L$ qL$ Au7fA $L= 1H5N 0HqMHqfA(A HH5I L$ tL$ AL$ t Ef|$|$IIH9ufHH9HPHz@uM1ɺ1LB H5= D$ H$dH+%(D$ H[]A\A]A^A_@|$IMI9tIt$HM$$I9uLDAą'H= D$ HD$5&u 8ML9D$,D$$D$(bD5EMgLvuL:ID$`I$HtHHukudu]@uVHC@HtD(DDt$LDru.AT$LH߃D$(谡D$$M?L9?5Dt$(EtE|$AD$,L kL: PHk@ Ht$ LD11s]A\D\$$Et|$tDEI}SD Et WDbEq|$,HD$HtsHPHHI3H@ I3H uTHQHAI3I3H u9u0h2H$KHh2H4@LI@=AHA1SHt$ 1L9 HXZL`12H5`D5AEzHt$L_11_Ht$Lt_11D$ A$uHJXHQ`utA$PM?L9f.LILXID$`HHcWHHIH$Hf@AE`]t|$DILRL>HAA1L58 L7 1LLt$ {AZA[D$ dHL$>Ht$LM\11=ffDM1ɺ1L4 H56 hD$ LH L$ 1H5G6 'D$ LH_7AD$`&q/D$,Ht$Lk[1ɺD$,5Ht$I1ɺ9L: 1ff.AWIAVIAUATUSHHo@LidH%(HD$1H'fHH1ҸL @HcCIn@Ht%H@Hf|(tLLHL9uŅtRLAL聳=ML 11H54 IF@Ht5f!AMMELL!HT$dH+%((H[]A\A]A^A_Ð`LefLY1ɺH53 f.1LZY1ɺH53 afM1ɿ1H-3 L8 HHlLL11ɺKHLX>LX1ɺ1H!ft!LD$ 9ubIF@Hf(LL蕻wLLX1ɺH52 StHL$LL H-2 Hw HHL.2 HDƒ=1P1ADL$%Y^"LW1ɺAWfAVAAUIATUHSH8dH%(H$(1Ld$@HD$0HD$(H$H\$`HD$8HD$01D$$Ld$HLd$@)$)$ )$0)$@)$P)$`)$p)$)$)$)$)$)$)$)$)$HW@H\$hH\$`)D$p)$Ht*$fx  f&$$H5BH Ј$EH|$0EgAFMtM@YH H|$`Lx[ HT$hIHHPHHD$hM9HIu1HjIHuMM Lw5 H5`5 1AH|$(Ht%=uݹt HQH$(dH+%(nH8D[]A\A]A^A_@H8SL8 1ɺH54 1$DAuDLl$`I9t%fDHIU1HHPMmI9uL~4 1ɺ 1H5D4 L5 HHH'L|$`I9u@@M?I9HIWLHHuI_{dGHHt H9L H/PL3 H53 1AA]A^2fDh2L6 1ɺL|$`I9Ld$L5V @LpM?I9IwHHH@PHtLhHMtɺLLtH|$xHuL3H}L`LHLLHHD$xrLOH52 AUH$Hh2;IGHfHHZH9QLJL5 AH|$xLd$7Lt$`I9H11L/2 wH51 H1IHDLHIHHD$`H9tL;htHH9uH H|$0Lh HT$8H $HPHHHD$8H=AuXL( M6I9MnMtAEatLJL ʰLP1ɺ1H50 LP1ɺ|H50 1A$IFI>Hth LL0 11~H5>0 Lt$0L,$L;4$t"@HIV1HHPM6M9uHH$H"11LH`HE@Hf"L"L$1HqLLYHL$xLL$HHL$PHL$O1LLD$HuƄ$L|$@M9uDM?M9ILuD$DD$1LH/ L yAWD$ML%3 PL2 OH5. 1A=LH}L`LzHAA.Et$AWI1ɺH$L. H5. 1gLd$0L4$L;$$u\fDM$$M9tMMl$MtAEatAuXH=L H|$xL. UH1ɺ1H5- LG. H$H<Ht$xH}<tH1HxHE11HD$0HPH$LL$4eA[A\IH_DT$$EH@`Lt$PLt$XLt$Pt$MIH$I9|E1M$$L;$$ID$yHp@HlHtID$HP@HrHHfH9]LH=1AL1 H5, ^oLK1ɺ`L$HL$x1HmLKL$HL$x1H\, LD$WH$HxLHHDILHLHH)A H)HL$L/ f.HD$xLK1ɺM~1H+ LVLL$xL. pL ֪LL$xL+ H5* AKL{J1ɺHDŽ$LL$xL. H ά$H5MH=MFL"J1ɺH5&* AqLL$xL- L* 19H5) -H5) L0 1 LQHt$xHt>#tH:?uHt$xH8k H$Ht>#tH?#tHs>Ht$xH7tfH$Ht>#tH>>yH$H7=LXH1ɺH5\( AL.H1ɺH52( v$ECT&BT )1ML- H5' :E@IH;<$LGHD$`Ip@HPHHH9tMH9uH$@LHPKLdG1ɺO1H5k' fHQHPHH|$PHD$XL1HAHD$XHH?HL$XH;<$XHD$`H9HPIHHHH9LHR1L- [QH5& YL- ^\1H5& fLL$x1H5z& L1+ Ht$xHt>#tH;3Ht$xHq5t}H$Ht>#tH;H$H95LE1ɺX.1ML)+ H5% LE1ɺH5% _LxE1ɺC1H5% !1LKE1ɺH5T% IFHth I>LL ':LH7$tIg`MLIGIL$ILLD$.ILpLpH>Ht$LHL1ILJIILJMt8LLD$ILpLpHHtHt$LHHIMH\$Hǹ 1I^L$I]LLD$aIHPHHT$,pHHT$Ht$HAHCpIE$tHooPH P0I}EIUIFoH@@obIIIEIIEIL(M6ML;4$I(boIHLB1ɺy1H5" ELB1ɺ~1HCpH5" LB1ɺH5" H\$II*HPAo,$*Aot$rHPHHǂ H9u$LzL7jLHt$xHt>#tH7Ht$xH1H$Ht>#tHg7H$H0$u tH8A#LSA1ɺp1ILJH5O! 蛿iL"A1ɺjH5&! wEL@1ɺH5! SYL@1ɺH5 /L3H5 vL@1ɺ1H5 Ld$`M$$I9H0HHM$HNH1I$rI$L8HHI$HI$HCPI9tNLHHT$`AŅu.L*01ɺ51H5 }HCPHT$ooKHELtx1L D9]Lv`H @HHȃ8uH@HtHL9u KH?L9t@H;GuLLHT$HT$uE1 @AHD[]A\A]A^A_I$I9tH;AfH I9uE1fH7H9HDI6iɡfAWAVAUATUSHdH%(H$1H5IH[AH31LHeD$(HD$HCHD$EHDHD$ HD$`HD$@HD$1LH0efLI1:H|$LD$, (LChH\$LH LLuL-1ɺSIHHt$LNHHfIhHt`LhMtTAvp9ppLFL( kH5 IL 1Ы1ɺLLhVHL sL{tHoL-1ɺvH5 1fHD$8#t>L51t iC uE,Ht$L'HGA<$#t?Lʱt AE,LLLD$(9MHD$HD$\$(H9D$ H$dH+%( D$(Hĸ[]A\A]A^A_ÐHLUHH(LL>IHHD$8#tNLD-Et uD%"EE,tH}@E,躢Ht$LHL$+1ɺ^f.H5 1hML GH5f 6L*1ɺqH57  L*1ɺH5 C@Ld*1ɺH5 蹨@I}@AE,蠡H}@E,艡k@LxnHhHt1IhHt%ZpL9XpHBYHL蛸EMIHD$8IL9>Ld$HLl$0aLJH1QH5 L ӧIFIH@H HA[[L;t$8HH|$0L,LH+LMfL茬IHPHHT$WUHHtHT$LHoHIFIL$pHH@@HtHHt H9"L ˈfDL(1ɺLH5 VLd$HLl$0HHIMHt$0H\$8H9Ll$H\$8L|$XLd$HLd$@Hl$PLIM^H9M{ fHMIIGH3Q H3A(Li H upIWIGI3UI3EH u[L7*I@LL+HEH1ɺLA H5 LHHAT1AYAZHmH9gHD$HM6L;t$0:ILd$HLl$Hl$PL|$XH\$8L9u7I~HGPooM6OL9rI~HGPH9tH`WuL&1ɺfD$(kfD[HfD*fDIL IFLd$HH5 Ll$Hl$PLHH1L|$X裤8fDL$&1ɺH5 Ld$HLl$Hl$PL|$XeL%1ɺmH5g <L H54 D$(L%1ɺZnLz%1ɺ6H5 ϣL[%1ɺyCA<$#tNLMtY ǤuD5ѤEgAE,tI}@AE,gLL7tLL$1ɺVL$1ɺUH5? L$1ɺ]H5 SML9t$8tQHL$8Ht$0IIFHBHH HI6IFHL0LML9uI}HGLGL9t@HULJH0HHHNH1HzHJ LHHHJ HHB HGL9uHG(LG(L9t@HULJ(H0HHHNH1Hz(_HJ0LHHHJ0HHB0HG(I9uHhAL$,1HAHIHX1ɿ1L H5 股HtgH.|t[H]=MH11L H5G !_AXdL"1ɺG!L~"1ɺH5 ΠhIhHh,ff.ATUHHHdH%(HD$8HG@HtftIH6>HEDEu)HT$8dH+%(HH]A\HEPHUH1HHHxHHHjE11jE1ɿjj)H 1ɺILX!HD$EHUPHHMHL 0A MȿHHHhPWY^L[d 1L 1ɺH5 4f.HLjuLt AD%*E{$qH5t4He`%HHH9Htg|$ u Lh!Hu,H| u HuHH#E`t@HLfDLEDLt1ɺH5 1ǝD EbXDfDHH- L HI1f1L1ɺHI躧f.AUIATAUHSH#u5MÅt?tDHLE1HEE1DHPdZYH[]A\A]f u1LA1ɺ(H5 薜ff.@AWAVAUATUSHHuHF`HuH-OHB@HHHIHH9LjHL511AULLL Y^H;1LHHHLHI9uM?I9IWH9B@uH1LM1L= PYH^LC HCH}@HH@HDžH8HEph+L)HCHpH8HD$HHHE]OHHWu1HLb|ML=L H11F_AXMH|$2f1L H5H[]A\A]A^A_LH-ӂ1L,J H貙C`t DH1LL ' yH[]A\A]A^A_DHMLL L13A[[Mt%I_HtH{hHtHGH@PhHChH|$LK1LB& H5ׁ̘fH1M1LL E1蓘XZI@L-1zb@HE@HHHH9LJL1L2HD$@1ML LH1MLL ×XZL YyR@HML ;HMLL RAYAZI_HH{hHHGH@PhHChAWAVAUATUSHHt$HdH%(H$HAH$HH9FII1fDHPHHHH9uH$DEudLL)H<$GL~LqH$dH+%(HĨ[]A\A]A^A_@LAMMILEII9u:fHI9,HkHE`tLHI9̱IT$BjH1$IW@Htf(t ĀH+tHL% 1ɺxLIL\ 1=1ɺHL j#1ɺ{LL1L1ɺLLMHq1L H5 踔HI9@LMHLIDf.H$@LL$1L H5t ?JH}PHHID$HP HMHHALIHL 11S>H5“H:AXAYfHD$P)D$`)D$p)$A|$LHD$H)D$P-D$E1Ll$DHl$ L|$(Lt$0f.AI$KDmHHlHHHH9HH HJHIHLMHLvME1tu HL\AFcAGc7MtxACctqHLMHAsH1L, mH51dAZA[LMHAwH1ɺtAvHL H5p13D$ BD,`AXAY@A;\$LHl$ Ll$H1L|$0Lt$81H5 uH\$ L {Aϑ^_-AL$L1Lt$I@H@I$HH|Ht/Gcu)I$HHDH@c L 1ɺIH5q14I$Ht3H|Ht) L 1ɺIH511I$H|җI$HtH|賗A;l$LLLt$1HoL1ɺ1H5r^HLXL%| L1ɺlL6)L1ɺ<H5HL%6 1ɺf1LLfHh L 6IH51豏LH(L\$8LMHH1AvH1eH5L tAGcY^L\$8t9L\$8LMHH1AwHi1ɿL H5j4XZL\$8MACcI$H| L IH51ێI$H|T Lh IH51蝎Ht$HHk H L ~IH51T=HuH{1E1LG 1ɿH5Z$XZX蘘AWAVAUATIUHSH8dH%(HD$(1HG@D$$HD$HD EL$ @ څH.f(tLM E<!I4$1HEH5kHI{{n1H謏IHHD$IFEHU@1Ht$5D$u HHL1PAE11AVHj%L$DH T$ AIu D$ 7LH贑Mf%@L H5R 1AHD$(dH+%(H8D[]A\A]A^A_ E11L$ 0L8 @Hf!L 8V@=ɌM11AL H5| Lf!EL L f.HiE1HLPIT$sAAVZ_AXA<LD 1ɺH5 A蓊yfD=ыM11AL H5 TL) 1H5Y A蔔@AWfAVIAUE1ATUHSHhHt$dH%(HD$X1HG@)D$)D$ HtD$ELHI9E1fDIM?AI9uEEubHHH9t1E1@HPHHHAH9uE<Ht$1DH=M `LE&HfD$P)D$0)D$@HHI9Ld$0fDHCLoA) $oPA)T$HI9uLM,$LM9tYLP@ILH HPHXM<$ID$HXMHIEHXLM9uHHA.pHD$XdH+%(lHhD[]A\A]A^A_HL91fDHPHHHI9uLH-p1L iHH1L k҆L^1ɺMH5 1A諆E1f/AfL1ɺ@1H5d of.LI9I|$M$$AI9uHEHIs1AUL H5oXZ L 1ɺ31H5 х@LT1ɺTLA1ɺJH5 A萅L1ɺGH5\ AfLL$L 19H5- A2H Fi$H5T H=e 辇艏fAWAVAUATUSHH $HH $H8fHYdH%(H$(!1Ƅ$II)D$`H)D$pCLstL31L9H@HSt4H1<-tHcD4@Hu CHHR\D=ELHHLHLLH$H|$ jHT$H " Lc1RL ," 1QH " AWQH %" AVL5^ LvL|$hLE1H0t$ HL$LfAƅt Dt$AALD$0MtIL$0L$LDL$AEHH5 uuyL51ɺLL 迂Hp3LHXu#tML5t , 84E,tH}@E,zHsLHcHHt E1H$(!dH+%(H8!D[]A\A]A^A_@LsLL4%ML H5 A!1H|$@foL$@foT$PHt$`I|$)L$`)T$pHHLKMLZ P1H5 A裀XZ@*L1HOAąLL 1H5 9@LKE1L H5 AeDHZM$hH$ 1MHLH<$苦HvLC1LL$ LLT$YhDaE$ L<$H$L菄xx$%=@ueHML+ 1LT$1LARLT$D !_AXLT$EL 1ɺ1L~LM,L~EǪH5 LHpL6HHLHL$H$趂H|$ jHL$LcL  1QH \ QHT$H a R1QH  AWL=U L HT$hE1LH0t$ HL$H$#tRL DJEt ~uJD ~E)E,tH}@E,#vHsL`cL L=D~L AHs11|_AX/L 1H5t|L5h 1ɺo1LL||O1ɺLLU|L 8H5 A(|#HsMAWL ~1AUL{H LL H5{1ɺLL'{1ɺLLo{L 1H5F{LLS 1H5{q\HLT$ HLGLT$RLL ARLL$zY^LLh H5PzL|$0Ht Hz'L_DL$1L H5 8zHpASL LH5υpH1yA_X_qHzL$d'L$ff.AVfAUATUSHPdH%(HD$H1)$HD$FI1HI4$1It$1HI1HhIt~LHi~A~A)IDI9LHLL賃L#~H}LpL&HjLLH LH$}H}LpL&HWLHLنH5FWHHD$ AEcIM1D<-tKHcD4 Huރ -H|$ 1T$ ˆT$ 1HzIHHHLAIFHE11P1HAVjcH AD$LH}O@LA 14H5`wL(1ɺH5V 1AuwHD$HdH+%(<HPD[]A\A]A^ÐL H5 A(wfDd$LL蠁xL$fHcD$LHD$ML H5} Av$fL1ɺH5E AkvfDL1ɺ:H5G_Av@L =H5_vuA<$#t9H|t wu&wu %DLHLD1ɺH5m u@H$L1ɺDHD$L1ɺL5 1H5 A*uUHBHL m B`H H@LDʃ=>vL 1p(1VH5: tXHZQ]f.AVAUIATAUHHHG@Htf8t51Ҿ@AHD]A\A]A^Dft61L 1ɺ3H5 AtHD]A\A]A^HHE11PE1LDjHjjH AHE@HrfXdLDHA9DLH]A\DA]A^@L )H5 AxsHD]A\A]A^fAWAVAUIATUHSHLzH4$LHL$LHAL9u_M6L9tPIvL,tMOHW1L H5 rHD[]A\A]A^A_fDH $Ht$HLdAątAL9huH$LhHDžhfDLHtCHXHLE1HOL SI1H5h (rXZQLE1L QIH50 1qfAWAVAUATIԺUHSfHdH%(H$11D$$HE@Hf)؃~H5OH蘵@CLm@MtfA) Mp)I4$1Hf)It$1HIHD$O)LHHD${gHH|$1IHL$E11HHMDŽ$jHt$蜅HD$(A[A_HgHME1DŽ$1HjHt$ _Y^IHqIGH@HEhHE@Hfh#:LL$L-D 1L XLoAHD$8#tGHvDvEt pD pExHD$@,Ht$He}H|$ÛHD$8#tAHDBvEt  ypk=p AG,Ht$HLVW@HLm@MfDpL 1H5 AnH$dH+%(HD[]A\A]A^A_ÐLL$L /H5 ASn뤐L 1H5l A&ntE1L1ɺ H5, Am9fDH|$D$P Ht$H Ht$H HD$HL$1E1HDŽ$HjHt$ LL$8pIXZMLL$(}IGH@HEhAD$xAH$AH$AGP$Ad$IH$HD$HD$pHE@Ht]fh#tSLL 1H5# lL- 1ɺe1L+LAlLHT$pHLL$(oLL$(tLHG $H|$^$H|$u$H|$̦$iHL$;APtAPL$M!A8tELLD$0pHPHD$HHT$(HxIHHT$(Ht$0HyHD$HD$L=  LLH5ԥDd1Bk_AXf.L1ɺ4H5L A kYfD1ɺLL}jcff*f('fhHt$LzD$PL[FJCMt$I\Ld$fDII9#I>11至ILL$uL1ɺ~L-A ALi 1ɺLLmiH\$L- 1Lk OLIi;#tXH4DupEt>| juuD jEHD$@,tHL$A,Hy@DbHt$H H|$AjhDI@AG,bHL$A,Hy@aHfDfDL- L=1ɺjLAhc1LH5ihfL1ɺsL- L1A6hI{~fDMHD$LLL|$`HD$hHHLJ& H|$JLd$`H{1HcL+7H{LG{MMLt$(I$HD$`M9L|$0Ll$Hl$8M|$AGdtRIIH9u=HmH9t-HuLKtH|$0HL$`LLLd$`I$HD$`M9uL|$0H\$(Hl$8IHHD$`H9tnMDHBHH`uCH r<ŀu7H%r0H$r)@u! uH0rH-QHT$`HHD$`H9uMI$HD$`HD$HL;d$(@Ll$Lt$(L|$0Hl$8Il$HE`H ĀML9uf.M?L9IwHtLHI9EHLEIAqH4vH| HB1fDHHt L;jPHH9uIHHHH9iHWBV1L9hP@Dž@Ld$`I$HD$`M9L|$0Hl$8MI$HD$`L;d$(HD$L|$0Hl$8H(@H%Ld$`I$HD$`L;d$(Il$HE`H$sLHI9IHHH9HHhHD$LL9upM6L9IvH@tHtIHL$H;MP IH4HL$H;HP%HL$0H9L$HtL|$0L9}PHt$H|$0HL$`L7L- L1ɺcLL|$0Hl$8ccL1ɺ蛇fDLL$L 18H5W Ac_@L1ɺ\L-) fDLL$L =H5 Ab fDD9DD9yH|$0HL$`LL\L- L1ɺLL|$0Hl$8@bL1ɺL1ɺxL-N LL$L HH5, Aa4LHI9~ILhHD$LL9ufM6L9IvLtIMtIUPH9T$! HHL$H;HPHD$0H9MtIUPH;T$0Ht$H|$0HL$`LcL-? L1ɺwLL|$0Hl$8`|GLH@L1HILH4HIP1I9@HH9pI9tHHH9H0H9uZ1D9rI1L-{ MNHL LL|$0Hl$8#`HL$LLE1LM9txAJLt_IH ILD>u=HNLaMIIH9ufH H9L;auHL9uMM9uM9Ht$HL$`LL- L1ɺLH_L1ɺMMt HD$LL9ubM?L9OIwL tIL9u3 fDH L9! L;auMML 1H5G^L1ɺL- &1ɺPLLV^'L- L1ɺ>LL|$0Hl$8%^L1ɺL|$0Hl$8MI$HD$`HD$HL;d$(Lt$Ll$(L|$0Hl$8&@Ld$`I$HD$`M9EID$HP` tHHH9yHH@HHH9yHMHhL9u@M?L9xIwHXtH|$0HL$`LLKL-6 L1ɺLL|$0Hl$8\Lg1ɺ}HHH9xHMHhL9ufDM?L9IwHtH|$0HL$`LLL-~ L1ɺLL|$0Hl$8#\CfDLHHL L-2 1L[H1L|$0L9xPIHl$8OIL- H9H\L SI1L[XZHxH9UL|$0Hl$8IHHD$`H;L$(NL|$HE1L|$E1HD$@IHD$8Hl$XDH-&H4wH}HH9H|$8>H|$@I/HD$8L9xPHD$@L9xP8 E1H|$HHL$`LL Ld$`I$HD$`L;d$(bI\$1H HHH9HC`HDHtH0HLqHHHH9HDH4~H|$8D$0H|$@L$0 ȈD$WMMIL9uMmL9IuLtE1HHL$8M9~PL9yP8HL$@L9yP8HL|$HHl$XLHL IPSL-F 1LYA\A^L1ɺf.Ht[IMtOML9ufDMmL9IuLt|$0tH|$WtAIE1fIHLH@HD$8HHD$@^M9~PL9{P8tHL|$HHl$XLHL IPS@HLqHhHHH9HDIH}E1HH9IHtHLpHC`IH9If.MmL9IuHtHAM1H5)@LQ WY^HD$L H5?L1VUI1H{@ML9H\$0LLl$8f.HH9HsLtH\$0H\$BL- L LIMV;#t3H"]th ZWu#eWmHt$HAH1ɺCLLrU(IZD$WD$0IHHL$HI9u(DH L9L;auLt$L1ɺ H5S>MUHL|$0L9xPHqLHHL-I 1LR LHl$8TL|$HHl$XMLt$`IEHD$`L;l$(t:Hl$0LLt$MMl$AEaLd$`I$HD$`L;d$(uHl$0Ht$L duAHt$H|$iZH\$I1ɺL-~ Lt HL1+THK`L$$1HH1 L$$1IL H|$†_H|$@<:H\$H{.%HLAt(L <LI.LyLHD$H``H;tH\$H._HAHHt6H9t1LJL 1L|$0ZzL 2L1ɺH59PeL- Lu1ɺLL|$HHl$XPLl$0BE1"([tH|$@L|$HHl$XH|$8H L IPSMHL|$HHl$XLHL IPS1ɺLLA P L1ɺ1L- L ALOHD$L yH5(Hǀ1O.L1ɺ01ɺLLAZOm1ɺLLA4OGL-^ L1ɺLL|$HHl$XOL1ɺLw1ɺkkf.@ fDHFtRH<\uWу0uOAAA0uDGEAA0uAHAD@USHHX8u 1H[]H-0&U;IٿIH Hz'HDHH APH5U^L:QP1ոH AUATIUSHHHRH{HDhHt HcC)9%D9DM։3HcZHHt)HCHcCHIcL[kH[]A\A]H{KRH1HCUHHHMu ]HH5 1]AUIATUSHH_HuBhMtLQ1LHNLQH}QHQHt(AHH[ LeuLzQIE IEH[]A\A]DAWAVEAUATIUHSHH4$dH%(H$1A=HQDmHEHD$0E1LE1HD$HD$,M1HD$DIIDT$ fIE,D*HEHtHL"H=LHt0uPUB->B62BHLL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$I$(HD$HD$ HD$D$0HD$dH+%(uHLf.HLD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$IIHD$1HD$ HD$$ D$0MHD$dH+%(uH@LAUATUSHH $HH $HL$P!IAL$X!t@)$`!)$p!)$!)$!)$!)$!)$!)$!dH%(H$(!1H\$ IIH$"!HHD$!H$0!$ D$0HD$mE~IL1DL1"H$(!dH+%(uH![]A\A]KATUSHH $HdH%(H$1HHHK11H1UGAąx.H$dH+%(HD[]A\IH-!8F<$IٿIH{ HPHDHH KAPH5L+QP1HkfAWJRRu6R0Rff.PfH=X@HHe%c%H`%H]%[%>H=rHtGHrHff.f1%GDAWAVAUATIUSHH4$dH%(H$1D$(HH$H<$Il$8:HHD$HQ$Lt$E1@E.DEXCHfDEnIE6IDA uA#!A'A"IE1LA8tHBHEuDA tNtILrI@TA@L 1GH5 Ad=H|$ZBD$(H$dH+%(3HD[]A\A]A^A_fIFI9HcÍSHL?YHDŽDHcHDŽ H<$H5w AGH<$H5l )G H<$H5a GGL<$H5` LF H$H-W H$EHH$/H=B=LuLBHHPLELAI|$LhLHDLLHI1ҹH=1/ID$HFHu5/1ҾrLBm$}H9gHD8-ux-uPKHH$-YH9tQHHV=u1܋?<H-uDHD -<A1HLm :L˩At`ARLI[$GD$(IH L 17H5 Af:LA1Ҿ LLHCiALH1LK 9D ;DQHH9t$I|$H5 DT$HL$H;DT$D uA HL$HNAID$@Htf(-u먋l$`LEh <$%f ft$tDl$ D l$@A<$MD$@H|$81MHRd$IHH8@LHD8@D$pD$XAHt$`HD$ HtLHDmHf|(t8EIzKwH5 HcH>fHHAHuHu닄$L㋬$Mԅt9$`Dl$XERD$p$fo$fo$$D$X)$$D$)$$$$pvAhA$t$H|$ HH4LH(H9D9(u LT$@LT$@KDEA}AOAAxAmAbAoWALAAAN6AD+A f.A$f IcH|$`M$L vHILI(M9E1fA$4Df{(H5 tH3IpLT$HL\$@6L\$@LT$H[ fAy(AF$tIQH9f{(A|tHSH9HLD\$lEo|$pD$X]HcDGD$pFvgDDH\$ EE1E1D$$%$;ED$AH(D$E9t"DL`uAAH(E9uދ$H\$ D$@ID$@H f)!Hp)H$`1ftHH$h1ftHfH$ptHH=Z H$x4HH$`Ld$IHHH;Ht/c3H HH9\$XuHLLd$HcH^L$HiH QfIL$(H- $AT$0taHtIHcHHcXL,RIIfB|((t&[ 1I1L)ID$@1fBT((IL$(9|$\$A\$\H\$PI\$`HfhH@LID$@HfhLbL?,A$BID$ @@ID$@1Ht fhID$(LAo$HAo$XAo$hAo$xHA$Ao$Ao$A$Ao$f|A$A$fA$HA$ A$H+H HI#$H I$AŅ A$L.A$:A$LKA$ A$)A$J"(A$umD=M:(SEu I$Ht1ҹH=W 2Huc I$(A$A$A$I$0A$@QI\$@I$Hfh)tH@)LA$ID$hA$ f f c 1E1L H5 f&L11 LI&H=HtH=HtH=Ht=HHHtLJL4H=8tLu?A$tHpHHuI$0HǀHHApML$11L L$I|$ID$HID$PID$HHGHPHHHuH=GGHt&[)HGHGHGH=GGHHhGft1AfA$IcE1L @II$t$!u<9t$x|$@9D$tDEʼn|$xD$tHpSD$l$t$D$@D$xZI$0HǀLnLˤ1ɺ 1L"#LHHcH=qWH4HiHH$DL0M/L襊A$ID$ @@L1ɺ LLA|"A$*I$ M$ L9!L=g ATUHSHHdH%(HD$1DƒHSL:M=LH$dIHLLE)jH1LLVH/ ƒHSL1HLDH5 MH4$HHH<$ /4HSHBHCL:M3cDH5ZLH/ƒHSL1HLDH5 HM[H4$HD 1HT$dH+%(LH[]A\A]A^A_HSHBHCH5 LHt|/w]ƒHSLM1HLDH5c LZf.HSHBHCHSHBHCf.1HH5%LLL_M#1H5 L3 H4$H5 L: 1)H4$]ff.fHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$H$HD$HD$ D$0HD$cHT$dH+%(uHfDATUHH}IHt5H E1HHTL襦tAHL]A\fD1LJ1ɺH5( HL]A\I|$E1L11H5 Qff.@AWAVAUATUSHH|$D$dH%(H$1Eo$)D$ Ll$(MDAHHl$0L5 HD$ALH`E1fDANjSD9HsD)IcDHHc)t> AL$'  IH1۽ E1K4.D)Hc}IDž~~Ã~$LcH5 Ol.LsLc)؃L9MHc8H>I늋T$$qHt$(H\$ c EPv Ht$01HH4$HIcH4$HL$1H L0E11ɿ1HHIcH|$HE1H |011SD9eAD$hhE1H|$(H;$ t $$HL$iY LqLiH$dH+%(HD$H[]A\A]A^A_EL 11۹bE1E1H5 DApAEL$HIŸGED$>LD$ 1H1H$(H8OÅtDLl$(M1L 1pE11H5x  1E1 ! \ 11L1E11= fDAUIATISܗHtG1LH5 HHЇHHtXI\$L[I$ID$A\A]fL1ɺ1H5 1f.Ll1ɺH5y H{15xAWE1AVAUATUSH8dH%(HD$(1L$MoE1L$HGHD$ M&fD$/ƒHT$ D$L:M=L,HHL(I~HPHHT$HHHT$LH HH5 L)L{DLY AC%teML H5~ 1}E1DHT$HBHD$L:M-E1MAAs]%uAtuAyD$/!ƒHT$ D$HI~H0HVH(H@H@MIT$HPID$IMMD]DD$/;ƒHT$ D$I~HHDD$ DD$HHH@ H@H@H@MtID$HEIl$I~ DD$"HfI@HE HX?HT$HBHD$DAD$/ƒHT$ D$HLHLAIHDE1HD$(dH+%(H8D[]A\A]A^A_HT$HBHD$DHE DD$fIoHT$HBHD$[DE1ɹL ^L{ 1H5]{ .IfHH|$ Ht$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$H$HD$HD$ HD$ 0HD$$$$UH HT$dH+%(uHd@USHHHHt 諨Ht6H1HI@IHtAHL[]ÐHE1L[]N79}+AABHtD@f 9}BHtE1UHH}PteHtW 16HH}H}H}XH}`H}hHHH]fE1HPHfFF HOPQAAADpփp pp P,Qp(P$QPQ HI(PHHPHH  ʉPDfDADfDAVIAUIHATUHSHHwZ(IHLGID$HH1ID$HtNM,$I\$[L]A\A]A^fE1I1L4 SH5s[L]A\A]A^L cH5FIl$HtH1HH HI|$LE1YL ^H5fA(X1L H5;fDATHdH%(H$1HhALb%1H$H U%HR%H5SR~>=;%w~0.%AH$dH+%(u}HĐDA\LQ 1H5kf+L%T8]LIH51AE1pff.H=tË %uATAH_%M%C%1%=wntnH1DH5YH={r H<t`HA\@+tnDH%H5@YH=&r ɫHA\f.H=D$ D$ HxHeS1t2t4H5m1Htڸ#[f.B%1t19[ff.AVAUATUSHH $H dH%(H$1=RD$ D$ %H\$L%n1Ls LH HD%:%(%=# ADHYL5u1ɺ.X@L荻LADAm11dEAUL%1IUL1s 1;LX ZH!Aվ!HAƉHH DH H%H :D11ѺH1TzAąAH$dH+%(H D[]A\A]A^ )E1fDHT$ H5r H=o 諨t7HT$H5VH=q 芨tDl$l$ 2Lls1ɺL%31L1LLŀ 5JLL E1[fDLr1ɺ{DLr1ɺ9L%1LLr1ɺ1LEL 1H5NTfD8H-|$ILIH3 HH p HDHBAPLQP1H Do11f. H-4L%86|$LIIH HH THDHAPLQP1Lyq1ɺL1H  DHiLLn 1H5:s91H$dH+%(HĐ[]A\A]A^IAt'EHHCH_fH5j HHt\H1UH-rL  Lyp H^1_1ɺCHL!ox1:}hM_IEALLH5 H́0AVANUH`( L L%qLE1LV} LLZYHCHMLT} LR1xIHL| BIXL| H5bqf1(ff.@AWAVAUATUSHH $HH $HD/dH%(H$!1IEuUIhL| H5pH$!dH+%(rH!D[]A\A]A^A_L$HLILAŅtpLHv/A?/t)IWL11:/@HH9usM~Lk H5.p1E1(DH$MH~HD$H1HH H|$Ht$ (H$HD$u H;D$H$HIHWH$@L$HD$L8H/x.LxuAtހx.uA.uAtf.1MHپH LHt$LnuHD$H9$hwLd$LLL*tNH8L 71PH#LlPH5n1XZLd$fD1LHAMs1Li H5YnXLcH5/nMLi 1E11Ms1LZi H5mH$MH>HD$H1HHEi t#H|$Lu+H$HD$MLLy 0MLh HE8N=Hԉ H P"IHWH5 mHDAPgL uQL(P1Ht$(H Ht$H8H5l1L *PH!PLi1Ht$Y^Ht$Rff.AUATUHSHHHD%dH%(H$1SHHǃf.AF\DH-ѡ%HH#xLLT$8HL fW PHlW LEPH7H5(n P1LT$(AHEHEH H4$L$W110mH-v P@H4$ 1Lh .;fLLDT$@@DT$@K f-%Hu Aw0 fAnG4H=sf~RL@ L L} HIcPHr ARHWQ1AQL :1VAPL m ATAUHt$PHP1A$Jf.H4$1Lah +ffDHIIIMf(MIF0 HD$IHHlmIEPPHH0HW1PHH4HI9uLd$Hp 1LLCAG4AT1L$h cP1Ht$EO0AXIGAYH4$1Lg YALɴL eS tL gS HqS LEH$1Li HAL7j H1eAN ELc 1E1H5%H$(dH+%(rH8D[]A\A]A^A_f6%H4$Lg Pt%1ɺ1ANfI@IWIH1HD$0HD$8ifANH$H CA_01HDŽ$)HqHYHHVL%P HWHH x.LhuA}tހx.uA}.uA}tLL>t/LH HPLL% 1ɺH޿LQQm@SAw0fAnG4H=nf~tfH=q f8=f~L L  Lx HIcPHm ARHWQAQL F1VAPLYh ATAUHt$PHPJ% %"fD:%D9 H1ɺMPLc Ht$1DLc %EO0AZA[AuAO0fAnG4Lf~…H=mtfH=p f8=f~H5 LuO Lw HjO H L$HZp MIEHASWRVQAPLEa USPHHHD$P1AMc'HPfH=p f8=f~AuH$Ht 8 AwHALIF(tJHHjH jE1E1W щHo VPjH$H0IPHtW 1"HMwPAEE HH MoMt-/LH HPLH8 IHtH AG0HE0AG4E4LuLHP H&HHu1IHEP@A;G(cMWMMMDMnL$LL$HHPuDHrMnID8 tIIIVMjH9 IBINH9 HLLT$H$H$LT$I IzIvL$L$ALE4DM0 AULY^ 1ɺPH޿1AY^LJM L$1ɺH޿1MJMN1ɺL+M H޿1L$MR Mv Mt MM G HoALJaAG4QAO0U@fAnG4fLl 1f8=LMMf~qL`LL11H5qIHtHUAG0HE0AG4E4AGLQ H5AAAZYfADfL9Y 1f8=MMMf~@LKM+L Y HHH X AWAVL5<AUIATUSHHHdH%(HD$81=HD$tAL5; ;uPLQ L1E1HD$8dH+%(wHHD[]A\A]A^A_fDHvŅFHT$1c3HD$HLIٹAPL28 AE1#Y^ڷ^ݿH-8I1PH LPL:81XZfL=yq%AA1H hHQP L111L讼LD$ ljD$LLD$ȸDT$LD$LH 1DT$D KHILPL6 UATAAE1DT$$H D貶6赾Hޖ81ɺLPH L ip%PL71AYAZ@kL%8蝻;ILIHV HH a6 HDHAPL|QP1AAEE1H L51ɺ1LE1Vf.L5 #f.諽H-ԕ8ݺM1PHLPL61_AXcH8蕺=.o%MIHU HH5DHDHE1APLkVLP1DT$$H /贽@HFLH T DFHH5 HDEHH5 HEȋFwFHL5 QRWLNH571H HDuHLM QRF8PF4P1WLNH5W7[H0HfQL8M RF0PF,PF(PF$PF P1WLNH5 7H@HQLA4 RvWLN@&AWL=AVAUATL%m%USHXH-dH%(HD$H1H]L9wH=3 dEUHu8D]4H}@DM0DE,M(DU$Du Lm[wqiLotE@A,HUHHEHHBH)HL9HDuLHEjH=3 EfuAt HŒHD$H1MASL)L H55D\$$ARDT$0AVLT$(AH+D\$4H 8tEDT$ A}<LK 1;H505/KL. 1H52!LLT$ζ8A}MIHN HYHDHH W/ CAPH51LQP1LT$(AH L/ 1&H5w1vLjD\$LT$+8d1M6PHH5,1PL.LT$1AY^D\$L- 8=g%MIHM HeHDHH w,APH50LQP1ADT$(H 02f=Su H=Aw%蔰[H0w%+x#HL8UL - 1PH L-PH51XZAVAUAATAH5\USHHdH%(HD$1۷HHHH1HT$H5 E1裬t6H&uRHD$dH+%(HD[]A\A]A^fDD9d$uE1HD9,$A޵tf.H-D8M;IٿIHK HHDHH ,kAPH5.L(QP1H GtE1:ff.AWAVAUATUSL$HH $L9uHHG |$t$dH%(H$P1|$4H߉t$8H5ѣD$<aHXIH$0L=+ fDL蘴L H谭HgH$ 1LHL$pHL$0IHT$,MjYL$,=H5CH߉L$L$HIL$IHAV L$H$ou#HH=nAT uLt$pLLT$LƄ pY/LƄ$FLT$HHLHPL蹻LT$OLHL9Y|$,;|$4t$0;t$8HL$4LP>LL(kH8蝮HL mE PH)L$PHH5P,P1Dd$\H E8fD=xHx$D|$L$ D?t$LDL$01HپH) LL'HHL=) @HXHx.L@uAxtހx.uAx.uAxtf.1MHLL8H$pL萫8xH!,1MWPH H5*PLS(1Y^H(諯Hԇ8ݬM1ɺ]PHL(P1H5*XZ@Lt$pfDL)A H-f*1H`1ɿ1L&HBL躰L&1ɺ1HDd$*L: DH5/1E1I{Dϣff.@UIHHATHDdH%(HE1A<wZEfL׸ZFH5P |AąIAHEdH+%(DLefDAuRFH;: LHA H5 HD1AąuL1ɺ^1H53RzL9 1bH5 +zVfDFHVBH5 P L1Aą&L1ɺW1H5yHFYʾE1DA\tHT0tD€"uHAT0uMcIJTHHI)HL9tHH$L9uH)HsLL$H5 IH8 GHDL(H\t!8HqH@9"u\HNfDH5 6 L1_AąLP1ɺY1H5sxDL$1ɺR1H5GfxHH9tHH$H9uHHL$H7 H Ht$HGHDIILLH5\ 1AąL1ɺN1H5w@HL4@UHAWAVAUATSHHuMdH%(HE1HIHc}HӅg HM9HHNH rbDID$ EL-6 Ht"DpL- > H6 ALDADuHCHtHHt HSHuLH;Hc`M4$#L违HA1u"f"tHQADtH<\uHQADuHcHD1HHHH%H)HH9tHH$H9uH)HtHLL|$IA"I$MIOu#4@Hȃ"t2HHH@0t<\u\HAL՘"fAL}1LHLH5g-0Mt$ M1LLHH5vDI~EA>t1LH5:K HXLHA>fDHLHCHtH@Ht HSLLMd$Mt EA"L賛H!L蝛HA1 fDL%/}E1L 4 L5tL1ɺL1tDMHEdH+%(aHeD[A\A]A^A_]fD1H5CHw~HL?EI|$1HڍHzH;`1LH5I HnE1ɺLH5'|KsDM/f1LH5;I H+A>tnLHMvMtRA>tL1LH5H HuE1ɺLqH5{rDM1LH5 H<E1ɺL!H5M{qrDMULH%ML1ɺ1H5 {+rE11LH5} HE1ɺLH5zqDM HfJ HeA1AփH<1D9rHʨ9fL%?zL:1 ELGqL1ɺ E1ɺLH5yqDM1E1ɺLH5ypDME1ɺLbH5ypDME1ɺL6H5bypDMjE1ɺL H56yZpDM>E1ɺLH5 y.pDME1ɺLH5xpDMEL11H5xoDME1ɺLXH5xoDM*f.H6H?!AUATU SHHHLo LgLoM9LHH2Dq tVI9ufDDA t!HHS I9tlH< uC(fDHSI9tSIHS H2Dq u@#uMI9t(HB@0H@t@ tHC HI9uLHSC H[]A\A]Au@t"HB@[wH=J @Hc4H>C I9u38HDq u%#t =t{tHI9tuЅtCHC H[]A\A]CtNI9tH0Dqu@.uЃ{tCHI9uDCCC C I9vCCnCbC VCI9FRH"t"t\t.HI9$QH"uI9HHI9QHtCI9uDtHI9'uff.fATUHSHdH%(HD$1@GHI HcH>HXIHH}0H$HIHHx}U(HEHH+EL|, RLHf1H5tE1kXZHD$dH+%(HL[]A\HwHW H0H)IH(}U(HEHH+EL+ RLH ffDH0 b7IHf@H}1H輗 ZAD$}U(HEHH+ELR+ RLHHIHH}0H$HIH(}U(HEHH+EL* RLHffDH0 b6IHf@H}11H@ID$te"Hu@HH=d.裒ID$[EHPUHu%L) 1ɺH5riDuU(HEHH+EL) RLH{LQ* !H5Fr1E1`idW(HGHH+L) RLH"fH'fD1HfHsfDH[fDLl1ɺ1H5qhfL<1ɺ1H5_q~hfHgfDL`> fLb> 赐DATUHS>Hta 4IHf@HCID$HsA$HtHID$HL[]A\f.LfLĊLHHIHuLw( 1H5JpigL= 1H5p;gtfD1ɺE1LH5o gFAWAVAUATIUSH8H^PH|$Ht$L$$DD$ HWH1IHx׉I9LBEHH@HLHxPuHD$HhpH}t0H}藉HI9LBH H}uHH% Hl$E1L5ԣHD$If.E=Ht$H^pH{uUDH H{A;uL{H, MLDLeM9A9t"L, 1ɺF1LALeML&< 1LG1AL襈1ɺHLDHH& PL; 1AQYeZYt$$LLetc;t[H[L\$(HOHI1ILLH; PAD$D)t$(L; P1L\$HALdH D$ u}Hz$ HT$HHHVHEL{; PL1RQQ1uHUAMH0AEH,@IHHl$H}PHH8[]A\A]A^A_fMHvʁt/w\HX/ t!H@tHZH HEH5# Hz: H B HDH5B+ $@HL: tH)HR HELL$(L% 11@LcLL$(HtDL=9 HD$HhpH}ff.@UHSHHHH84/Ht/H;HhtQHSHHPHSHHCH[]L9 H5ibH1[]?uff.@UHHHSHHHH9u&fDHH9tH;XuH[]fDH(tH{XHH[]fAWAVAUATUSH(DL$dH%(HD$1HHH?HIIHM-IHHxHHHǀH1H)HL݄H;HPHHT$-HpHT$LHLID$裄H;HPHHT$o-HHT$LH膍oEI$ID$D$AD$oMH{AL$(oU UfAD$pID$HID$PHID$HID$XID$`ID$XI$I$I$EHl$M|$xHH AT$8H H%LH кHD${qA}L调H{LLPNq~LJ" ;H5gS`H{HqH;LE1;:fID$$1E1L! H5f_HD$dH+%(u]H(L[]A\A]A^A_fDID$DLq! 15H5af_H;LE1m:fDAWMAVAUIATAUSHLL$HtQD`0I@8h4t|LAąu}L1ɺ1H5e _L&L1ɺ1H5eE1^HD[]A\A]A^A_f@|x@LL5AąH\$Ht9IFPHh0H蠁LL`Lq*HLHH芊HH|$PA:IFPHHRLLhL#*HLHH=z.%Dt %E,ADžHT$XdH+%(Hh[]A\A]A^A_D1H=%Ll$R1yAą LDuHD\$RfEtEAM Dv%f|$RtDt$HEL  P Dt$(L5D$L1S|$11yZYDT$D\$f1D1 D\$DT$yDT$D\$PE1L AR LDT$(D\$vSAXDAY*sD\$DT$t(L1ɺ 1L>SDT$D\$DT$LE9z8 HRL5wL LI 1DrtL[1ɺ# 1LRA1ɺs 1L-L|RE,1fDL L5F1L@RpL9 D1ft$R@DT$HRy8wL LPD$ P1DL$ELL v 1D $QY^%L<1ɺq H5|QL5gL 1 LPQyL%uMtFHB11UL H5KOoFMd$XZM?|f.MMd$M\HE1QH-N11HL FL11MHEWAWAVAUATUSHH $HH $H_dH%(H$ 1HIeHW HwII)IH0hL1ɺyIH] U(HEHH+EL RLH{1H5ME1EXZH$ dH+%(H L[]A\A]A^A_I LLfB4 m H"A<$?M8H}0LLuIHEEU(HEHH+EL RLHf.L1ɺgIHtUHݪ};U(HEHH+ELH RLHjfLl1ɺmfH5L1E1C@ IHtÃ} U(HEHH+EL RLHoBU(HEHH+EL RLHfDH}PtELH}LHHu1ɺE1LH5KBfDH;fDLL1ɺ1H5oKBfHfDHI}HE@HIHI t%ML 11H5J BMo HsHuPHELELLljHEHMHPHU H9HDHE HPH9HЀx u8}ux uEkH} 1E1f.IFE t$ t|HIdHHtMuIf HEL1ɺH-I1H@Lu1ɺ1HE1@ H&kL=1ɺ롾 HH}0 v IHtf@"h1H-IL H-@OATfIUSHdH%(H$1H\$0HG)D$P)D$@HHHt$0Ht$HHt$P)D$`)D$pHD$`HT$8D$XL$hL$fH9 HD$(H$D$D$fHHHtp|$@ uH\$1I$HDHkH{HCϺHCHHt HfDI$H$dH+%(ubHĐ[]A\H-GL1ɺH>I$1L_1ɺH>1H-rG%gDATUSH@dH%(HD$81Ht_HHI @H[HtGHf11HL)D$)$HD$)D$ HtHT$8dH+%(u H@[]A\1fATII1USHH@HzdH%(HD$8HHLHD$HtGIt$ H{HHE HtUHD$HHT$8dH+%(u\H@[]A\1L1ɺH57FV=1fL1ɺH5 F0=1eATIIHUDSHAHt3H@ Ht*8tcILT11-H5E<Mt-H11IATL21ɿH5zE<XZL[]A\@H@u8u Mt@IATAH5 UHSH`dH%(HD$X1H Ht$0H\$8HD$8H HD$@H HD$HH|[ H$HJHD$H HD$H HD$PHD$HD$ fDH3HHt4H\uHT$XdH+%(uHH`[]A\f.H\$H5Z fH3HHtHL\ufDDcfDSfIH1LH@dH%(HD$81H)D$H|$1)$)D$ HtFH@ E1HtuAHtH@HD$8dH+%(uH@D[f.E1FcfDSfIH1LH@dH%(HD$81H)D$H|$1)$)D$ [HtFH@ E1HtuAHtH@HHD$8dH+%(uH@D[fE1bfDSfIH1LH@dH%(HD$81H)D$H|$1)$)D$ HtFH@ E1Ht8tHD$8dH+%(u*H@D[@H@AHfE1bfDAUATUSHHL&AHH1Mt L^\HLHIHC(Hs AD$(HtHID$ HtYHsHtH{ID$Ht9Et HsHtHVID$HtHL[]A\A]fDLD1ɺ1H5gAE18Ő1E1LZ H59AX8fDL 1H5 A+8jfDAUATUHSHIHt>1L-HtR@HDHH@H9uH3LL螮H9t'HL`1ɺ1H5@7HL[]A\A]@ATH=UHJHHH[IHHxHHǀ1HH)HID$`Md$=ID$hID$`ID$pID$xID$pI,$FID$HEID$HHL]A\fD1L mH5a=6H#HL]A\1E1mL[ H5=X6HL]A\DL |H5<%6I<$E1HL]A\fDL  H5<5I|$EI<$E1_f.HHHIILPI9t+HzڳI9tLLLʳLLHHB`HJ`H9uqfHH9t`L;HuHzI9uISHIKHH9tHfL;PtHH9uH9t1HH9u{HIAXIqX1H9tfHH9uuzff.SHOHHQDK4DC0H HHDHH 1ayx H[H f1L 1ɺH5;N4HC[AWAVAUATUHSHHLHdH%(H$1#WHD`DBH}DHމDHHt L`MuZMI-HWI1M|$M)MtPT$ MLL)\tuD$ LH-n3HIPH5:`1Lw Y^H$dH+%(HĨL[]A\A]A^A_fLl$1ҹHLI\HHI)LBD$ULD`DpAH}DLBL=2HHt7L`Mt.LAVMPL mL=y2L-3LULHHISu}N,#LiULD`D@H}DLYBHHtIL`Mt@LPHML P{1H58AXZIL 1E1H5n8AmƄ$&ZfDHAVAUATIUHSHRAEt^1HvVL52LiTLLHIRt2LLHRA1EuHJ4+LL)R[]A\A]A^ff.AWfAVAUATUSH$PDD$@L$HD$ dH%(H$1)$)$)$HH:IHDLg|It$HX1ۋ$@A$I$D$ Mt$xfAD$pH$dH+%(HL[]A\A]A^A_HHT$AIHhHT$HE1ML$LLSHHHHHxHEHHpxD$@DI쉅At$I\$HD$XHD$`H\$hHVAL$$HD$`M|$AT$4At$0HL$xH|$XPAAWL$ňA]ZAD$4I1ɺCL-o5L PAD$0LP1.A[]HHEAD$0E8HE0AD$4E4.gLHD$@R:DT$@ENH\$`H\$H|H=o/:QD HD$(ED$ Hl$0L$L$Ld$LLt$8D$D1Ll$ A@HL$DHlHL$I@HL1I LAI~A HEH LH H H$1@H‰ Љ1H9uL 1к^=HH&HxHD$AD;(5Hl$0Ld$Lt$8Ll$ HPH|$XHPD$@f.L\1ɺ1LE1,f.La H5331E1h,WHxOI?LhLIHLHHbXI$DL-2Iٹ?L5 L+2fL1ɺ1H52+fL-t2L 15L+L,1ɺ1H542n+]fLL IDŽ$fDIٹLL G1+H|$XHFOHuBH;I<$HIHIٹAL FfHHH<8,D$%=`IMLd H5p1E1+;1E1L H5>xH$dH+%(sHĨD[]A\A]A^A_@:H?LLLmAŅLjHHt*I<$LLAŅAuDL1ɺXH51E1FfDIHL3 L41ɺE1H5<vL 1ɺ[1H5NfHT$(I<$E1E1LHHH  L1ɺTIHy;fAWIAVAUATAUSHD_H_dH%(H$1Et-Hu/1ɺE1L-H5>}BHHu]IٹL H5A9H$dH+%(aHĨD[]A\A]A^A_DLPIH@ H$dH+%(HĨLL[]A\A]A^A_霃ALJL9tDLHHLM AVIrH5"1AYAZADH\$LHAƅuaLͰ1ɺl1H5f.L1ɺ1H5E1fDLt$IXIHMHI9IVH9A>L95D$HT$@jL% L- L9A{ACIcL>L\$Lt$PH @L1TL\$AS(Aw4LL\$A0 L\$=A{Hw7L\$8#H-p1ɺP1LHHL71ɺ1HE1z<DIKMC Lt$PL@L1L\$,TL\$7fL\$AKLt$PH @L1SL\$fL\$AKLt$PH fAKECLt$P1HY @LL\$SL\$fDL\$Lt$PH fA{tYML9=ALJA>H-$L \ 10HHHLL\$L\$A8Lt$IK I9uLHL$H :HL$L IH51QAVE1XZfD1L9LL% H)HSAVIz1L H59E1A_AX7H-i L-H IDL%h LE1{HLs AUISH51ATH H- L-* H< L%uML%H- L- HhL- H L% _HBLAkLHL UH-0I?H1Y^1L\$HL GEK5 L\$H1IEKL!  Ll 11KH ML1ɺ1H5 L4ff.AWAVAUIATIUS1IHH|$dH%(H$1HGHD$,HD$HD$`HD$DMtcM?L9|$tiMtdMwMt^IFAvH$H<$11LH5 MuDHD$LxHL9|$uE1HzH-MtbM6L9t$thMtcM~MtZAuAGIH11L&Hp MuHD$LpHL9t$uH$dH+%(D$,HĨ[]A\A]A^A_H=H<$LLIHB`H`H9uDHH9L9puHAv4A~01jHL$(E1E1>ZYD\$`ENDT$dE@AvDL$,E(IT$|LL$0t$xH<$DzfoD$0foL$@foT$PAFAN(AV8@I~HL1ɺ1H5@HLLR IIWHIOHHpH9HH;pHH9uH91HH9uLLLL 1ɺH5OD$,fInXIFXH9QL|$ H5DHuBL1ɺ1H5HmH9tHL}AGIuH=}LL>tM9tEEuL|$ VfDL|$ D$|H5ILx P$P1LL$gY^D$,EFD$,EtA~ uoLH5pL IH5 1AL1ɺ1H5 D$,xLLLD$,rLM1ɺH5R 4/AUATUSHdH%(H$1?u/H$dH+%("HĨ[]A\A]DHIm)uD$%=@tL- M11L .LL-HHH/H{/,HH}tھHm2yT-8 HauL 1ɺ=LQHY(1L1ɺfL+1@L1xH(f,8tbHt)}H|IIHKH ¾HDHPAPLQPL1H ALzsL1ɺMHhj)}HIIHH 9HDH@APLPQPr,LE L12ATUSH@'HH@Hx0HtSx.HPu ztx.tHE1-u=D[]A\z.uzuH,0HuHA-t)+H-R8[(Iٺz1PHw[LPH5 1XDZ[]A\*H- E18(1IٺqPH[H5 PL81Y^5ATUSHH $HH ^H dH%(H$1H$AAHYGHH%tR-*E18tTHLW'-I1PH LPH51XZfHE1AH$dH+%(u;HĠD[]A\DL 1ɺ'1H5E1<*ff.AWAVAUIATUS1HH|$HT$L$$dH%(H$1HGHD$ HD$@Ht[HH9\$taHt\HkHtSuLetxMO11LH5HuHD$HXHH9\$uH$dH+%(ED$ Hĸ[]A\A]A^A_H=MIHT$L AHL$@Hu4}0jE1E1ZYD$@ D$PD|$$EtH5]XLe%HHEt$\|$XDEVMLe W'H51Y^D$ H}HL_1ɺ 1H5gL@LMYM~XIFXL90HL$pHl$8Lt$HH\$0LILd$(6HuHL1ɺ1H5)HH9LcE\$I|$EuH=LLhtHAt$4E1E1A|$0jLQAYAZDD$pEt$tH\$0MHMLd$0PAF4L H55PAF0P1lH jHl$8Ld$(H\$0HtHT$LHHEDEpLT$\t$XDHH`T$DtD$Ht,HHtHHЅFHEHUHHMHHpH9ZHH;pFHH9uH951HH9uD$$HT$LHHL1ɺ`H5.D$ A=Hh BHMPLP 1VH5WLy11/H5H D$ Zf.D$\ML5 KPD$`PL1ɺWH5]L1ɺH50D$ CLd$(H\$0L1ɺH5|$$D$\ML: <PD$`Ptt$\|$XH t$\|$Xot$\|$XH x$ff.@AWAVAUATUHSHhH<$Ht$ HL$DD$HH/HWL}HD$L97E1fM?EAL9uH$H8HD$HrEAODH4@HD$(H$HH?IL9Dt$0E11Dl$8EIHDDI|$AH@LtI>M$$IFHM9uDt$0Dl$8HDHD$0HD$HЋT$HHHD$8AFHHD$PL|H$LH8HHHT$8HL$(IE1Dl$LMLt$HDHl$@HD$XLxHHPHD$0H@LdDIuAmHtIUH%AoEIAGAmM9uYHD$ADl$LB Hl$@HD$HXHD$HL$XHHHD$ AHXH\$HX HEHt$LDHIG%VfL}H"HD$HD$L9H$H8HD$HOHT$HL$ HbAHHAHBHQ HhD[]A\A]A^A_LuL93I~Hp!HH$H8gHHHSIvHAL,q$I]HD$I]H\$ IEIEHkH(LhHC fH$Ht$PH8HT$HBHBHt$(H LHHD$Ht$0HUHHHD$8HHAHAD)HL1 @o HHHH9u1fDL 11L9 E1H54O f.Ht$(H HfL L 1JH54H$Ht$E1H8L d L 1H5L41PdL % L H54|놃*1L L H53PWff.HwHtHW H9tfHw HG@( tL;H1ɺ 1H53%AVAUIATUHSHH?kLm HHcUIHH;IH}GH}LZC:xLLL[]A\A]A^H;L~Ld 1H52[1]A\A]A^DLLH5[]A\A]A^H;LxL fAWAVAAUIATUSHH- T$ H}PHE1E1fHI9LBAGH<@IHHHPuIm`H}Pt;H1E1@HWI9LBCH<@HHHHPuM9MB\$ DLHLAL11iH5t1ADLH5 HL[]A\A]A^A_鱌E1QAVAAUAATU0SHH?|IHhfHZ @@ EHDmAl$HH‹rB Et$, AD$AD$At$(;HCpHxurLJ1H-0LY HH11LpH;LE1[L]A\A]A^H Hxt;uA ID$ HS@HC@El$(AuCHHCHI$ID$HCHL LLcH[]A\A]A^fDHS`HteI$IT$L`LLc@[]A\A]A^fD1L H5/[L]A\A]A^H:61AWAVIAUATIUSHxT$ dH%(HD$h1fL<,u)fAFI<,tLAFIt<,uLH)H$H$HL$8HLLD$<*|$ DD$@ATIUHSHH>K 1LHHHu.uHHHADHuI$1H9E[HD]A\fDAWIAVIAUATIUHSH,HfH@HI9ttL)L!HuLIHteL9LLHHFHI>HKt}IFL3HCIFHI^H[]A\A]A^A_DH 5HC1Lj / H5![H1[]A\A]A^A_DUHSHHHHtHH[]mDH= T$ T$ HHCHu1L% H5k!H1[]DAW11L AVAUATUH-2!SHHH11L Hl11L HN11L H011L- H11Lw H11L H11L H11L H1LI 1H|1Lt1H^HBLt 1ɺ1HE1/1L 1ɺHHDH$IE$MnI}Ht!E1I}IM|HuM9MBEF I EuLd$L<$L- H; MwMΜII>M9wtH;H5`tM&LaH;LHCuH1L) LS 1ɺ1HHL%n 11L7 H1L/ 1ɺHH L fDHCHH1HPM1iL Y^MuLY1ɺ1HH:L%; 11L` HH L  DHCHHMP11HL XZMuHHL¦1[]A\1A]A^A_%H;L(HLHPHH0L2LH @8AH@0Hwt3H] t!H9@tH HX5HDHLL 1PHAw1I AVDL$(AH;LH 边A?.Lͥ1ɺ1HH tH! HݣHDhL} He됹H1L] B/ff.fAWAVAUATUHSHHLn8 u:AL` 1nH5HD[]A\A]A^A_úH5`- Hu@L%L 1wH5)AHE0E1E81LH{L%dt1H5 H_L%HtH5 H@L%)pHEHU0L%L(LHHE0E8M@HC(L=xDH Et@HCHLH uL |@ Q1DH1AHC(L%_AXHSHx(Dr tJHx8tCHH41LPEN1L® AHCL%QH DqDp Y^L\H1ɺAUE L} L1AHCLHA@ XZܶAWAVAUATIUHSHHHHD$L5p L=X+ Yf.I<$H9sHHH)ŅI<$LtZI<$LytEHkLl$"HI)LIHHuI<$HLBŅta,DLy 11H5H[]A\A]A^A_HHHD$L$ 1H5C@L 1H5{fAWAVAUATL%) UHLSHHH?Ut4HEH.H,uHS`@H;H@HHt1!u=1E1LW H5HD[]A\A]A^A_H;LtH;H5 tHMHQ(taH;Ht H@8LADžL 1H5?Uf.Ht H@8.H;LADžHHuHt H@81HADžHHt H@8H;LADž#AfHu1HADžLx1ɺ$1H5UkL 1`H5+AfDLw1ɺk1H5fHuA(>H HDH5ADžHE8LHU HRHRLlAEHD$H)IE1lIUAuHHulADžH;LQADžsH;IL9t$H5IADžH;LADžyLB 1GH5aH;LADžL 1'H5Lӻ 1oH5UkH;H5LADžU1L{ H5$HE@(^>LO 11H5nHML 1OH5;L5u1ɺL1H5wL˺ 1AH5McAWAVIAUIATUHSH(dH%(HD$F<thЃdt1E1L H5pHD$dH+%( H(D[]A\A]A^A_DL~H^I9LLLIAtM?I9ufEtEAEI]AI9uHL9tL}HCI9ux,LS H uIN`PHHRHLDMDH(AWA~AA_LLLLdnfDE1`L~H^L9LLLAAąM?I9ufASA PA@qIGAHHD$H x IHL$M@T$$$T$f/f(\fT J TL f/=DAA.IGMHHLLT$HL    wIHL$MLL$L$=L$LL$41M9AIGH0 `MLE H51q@H11APH5E1L :Y^IGLH8AG @EQI:KIGMHHLLT$HL `1IHL$M LL$L$ҭL$LL$1M9@AL޵ 1E1#H5 5HN1APH5 L XZV IHL$M L\$L$L$L\$1M9`IHL$ML\$L$蘬L$L\$1M9tf. |M91M9!I OIHL$M LL$L$L$LL$ 1M9E1+A `Df(f/~ \fTw f/f/\ fTf/pIHL$M@L$$00$L$f/f(\fTi sk f/\@IHL$ML\$L$躪L$L\$1M9 t `M91M9!mIHL$M L\$L$EEL$L\$1M9! T`'1M9LJL=U1M9 ML S`IHL$M@L$$e$L$Zf/P\ fT f/2 ` AIHL$ML\$L$L$L\$1M9D C\ fT 1f/.  IHL$M@L$$^$L$Sf/f(\fT )@IHL$M L\$L$L$L\$1M9MuL M9M9 IHL$ML\$L$藧L$L\$1M9sMLu IHL$M@L$$<<$L$f/'f/~n w*f(~` \fTf(%\ f/f(f/\fT<1M9IHL$M L\$L$蘦L$L\$1M9t\ ަ fTƦ 1f/RIHL$M@T$$/$T$$f/\ v fT^ f/_IHL$MLL$L$ͥL$LL$1M9ff.@HG(u LGPLOPM9tHG@H@H9t.fDP(uс t P(HH9uM9tI@IHH9t>fDHPHt':t"HpV(tV(f.HH9uMH1 L< H5j1HAWAVIAUAATIUHSHHtZH H]HtCDX uM<$Mt<Et DA#D$tLLHHHht,IM<$Mu1MtI.H[]A\A]A^A_fDMtHIAD$H[]A\A]A^A_fAWAVAUATUSHXH|$Hl$ HHHL$H1LD$dH%(HD$H1HD$Lp LQL-"L`I}PL1B@LLLruK<'Ht/CH<@HHLHPLHLuHD$AHD$HD$HdH+%(HXD[]A\A]A^A_ÐALe11$H5[fHD$Lx`IPH@h1HD$1>DLLLuK|%Ht.CH@HHI|Pt?HL$HL,LuHD$AHD$f.E13AWAVAUATAUHSHH(dH%(HD$1fDI߀,u SH,tI߄CHt<,uIM)M+LA@-HL$LD$LHaL%t1ҾHL͊11L濄H1AWEL LX1ZHT$dH+%(H([]A\A]A^A_@E1L%oIwMVA@M3L%L+ 1L*@IwMVA붋T$t$Lt^HE@HM@H9uUfDHH9tG;P,u;puEuP( uFM8D qu8HP()LE`EtBHvHA EHv1ɺrHH5MLLl 1<랹HLD$t$t$LD$HYL%La1ɺkLuDAVAUIATIUSHH@轍H4fH@HX@ @0Ht C(E HIL$IT$LeLm8H9tH @HH9t HxuHE(HHHMHUHiA $Il$KvyMt8L0I|$LpLHLLHH]HE8HC(AڃC(D[]A\A]A^fH9]1HXHHH9uAL- 1LL VL_11gL8(fDL_1ɺs1H5HUHEHE1I|$HBHϚ[D]A\A]A^HtC(Au߃࿉C(AMuHE(DH EtL K1ɺ1LhH5"E11OL H5X[D]A\A]A^H]DC Eu)L51ɺc1LLC Mt'HEHHx M0AHE(L߾Hx( x L5\t;HEH1ɺ;H5_L @ VLDH1ALY^HEH<1H5Lǐ @ VLDH1AHE@ XZQAPL5HE81L* 'LL]1ɺp1LL5wL]1ɺ4LɽL5RL 17LA ff.USHHHoHH}HGH9ttvE1wWE0<HE(HUHMHQH HUHtM HǂJ(Ht@ H{HAHD[]ÐLa 1H5h˼HE1D[]fDH}8tAHUHH5L B HDH1J 1ɺVH5 r^_HE(Hx8tLHx(tEHUHH5T L B HDH1J 1ɺVH5HE(ZYe0AWAVIAUMATUSHHHtpIHHHHLxLʇHHtbLLIHHHIEHH[]A\A]A^A_ÐH:HuLv kDIL h1H5' 4H1[]A\A]A^A_SHHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$IIHD$HD$ HH$D$0HD$x'HcH9ںCHT$dH+%(uH[øAWAVAUATUSHH $HH $H(Dg(dH%(H$ 1HHAHFHH,U@H@HLdLHPH<L H5.1E1H$ dH+%(H( D[]A\A]A^A_H;H5i \AąDc(Au'H;H5 3AąDc(@AHED@Dp(A@HcALl$MHAAAt AAM9LAfDHW`Ll$L LHsH;1eAą L 1H5%A`>Ll$MHQLMD1H LD$D$H;IcLۤ>L 1H5;fDE1M9LHuH;1zAąC(tE1HLDHHPuH;1L!AąL_ 1H5~P@Ll$MHLMD1Hԕ LD$D$H;IcL蝣Dc(@Lћ 1H5SfDHDD$ H4$H4$DD$ HINVL9 1H5^fDHDD$ H4$oH4$DD$ HILs fDL H5%Lٚ 1H5[fDH;H5 LE1Ll$L 1H5jfL 1H5x۴>fDH;H5 ̡fHDD$ H4$/H4$DD$ HIDLٙ 1H5[AWAVAUATUSHH(HHHnEvL?H;+HH9C){,HuIF`SAN(HRHHHPH0HDЃIiI>1L̕uLL D4$H5+H|$HH@0@8LIϋC(@JHL1L H5(L%Lp 1H5}H$HH@HBH/H;t:HH0L Wg1ɺ1LtiLL%L%G1ɺLm~H=Iv0I>1ZuLL D4$1H5DH-1ɺ1LFHLF11HͦE1L%PL 1?L|H 11LbL{XL{PYL) H5RuLD4$H;H5 BL~ H5t$L H5yܥD $$L̐ H5JD $HLkgH5 HPHH0H*HIH 1ɺH@0@81\H;H1H|$WjLL D4$H5LLA D4$1H5TL> H5WJLK 1H52 L H5mLL ;H5BLL H5HsHt H;~C(HS@HK@HCL{XL{PH9trrHH9uC(lNHD$Hj1L H5%HD$LLɈ 0H5RHCP谶AWL AVAUATUSH8T$(H $Ht$Ht-D$(HH<$D$/uCt?L 1H5gʢ1H8[]A\A]A^A_fE)uH}@nIHf@@ @0H}InE)OIFAF0IFH]@HD$IF HE@HD$ H9CHH5? L @HT$IN, MeLuM~8I_H5 L'LLExHuLHAUPzI~HD$IIF IGIF L8HM~ H;\$ &H}(xmIHfH@ @S,&Le`H|$HXHC Ld$PHthKL IIO, AMHADDm8H}ILlHL1HFIF(~DHEbCH|$H@HLdM1L H5%H $1HtAV0H}L$H{$HHtfHpHt]HT$HuLIV8AF0Ht5HBLExLHHu@H@HHPPIF8H@@)tE(@t7D$(t/H}PHEPIHEXIFHEXL0LuXE(H<$HtAF0|$/L f.LI 1H5KfDCH|$LԌ H5H@HLL1yIF(L 1H5pӞFH8H[]A\A]A^A_h#AUATAUSHHHGLoHHI9u>^fDHxHtAąHAąt`HHL9t%HHx(u@ HHL9ufEvMAH}iHD[]A\A]L=1ɺ1H5kΝ@E L%Pu"L1ɺc1LE Ls 1ɺ1Lzm \L =1ɺ1H5N:fAWAVAUIATIUSHH8H|$dH%(HD$(1薾HHD$IƽL|$8f.LֿCIHcHCIHD$Ao$HMMID$HLAIG9s|$-HD$L0CHT$(dH+%(u=H8[]A\A]A^A_L HL$LHHt+$HHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$H$HD$HD$ D$0HD$(HT$dH+%(uHff.AVAAUIATIUHSt"f-HATuA$t&LH)-HAuMt AUMcIHfIHUHt%HȀ-u-HUHHHUu-HQA $t*HЀ-u-HA $IHPA $uMt AEuKL[]A\A]A^@LH)f.-HAuA)<_tD-AEHJt}HʐH<-u-HAEIHQAEurDHHI1AUL _H5Mx ATUWLH []A\A]A^Hff.@HGuoHt]HH\u"t\u߈QHqHyu;HHH~t$\uN"t\uHԐ@LGHE1E1Ʉu,TfD<:udMɸ:LLDɈHLGt*<\uG<:t<\t<@t\LfDHHtLHtLD<@uMtLIʸ@AUIATAUHSHH(dH%(HD$1HD$HtH;pHMHHDHunEtu5fɸAUuV2w"H ٗ HcH>}t1HT$dH+%(.H([]A\A]fHt$HH9l$t1 HD$'L$HxLfH*\fTt fHl$t f8EwHU'HHfHH H*XfAufHtHH+:#H(H'H'LȹdHHHHHLȹ'IHHII$$I<#H<l(A$$H|$D$D$HHuHFHtDB uHIDBH~A+AA-"Ht$ L\$PL$@H|$0蟴H|$0L$@H$`L\$PI>:m"HH)H%HLdHHIH<IMiHHH)IEDHtH|$H HFHtDB uA>7fo$H$fo$fo$H$P)$ )$0)$@H HcH>H,$H$1LHun+IHH$ HHH$H0H$HubMt*IIG"I$IG ID$IG L Mg MH$dH+%(VHL[]A\A]A^A_MIIG!IW I$IT$IG L H$Mg HD$fDIHDŽ$HDŽ$cA]AE1LHl$H-[LS11"HMLz #H1ًA]L\$L9 H1Mٹ}H1Lː ~H$H\$E1HH$L$HLH(HH,$H$1LH=)IHtHm LH߁HHH$H$H0IL\$Lj HDŽ$H-N1HL\$fI(H8VIHXfH@@HH@@HIG IGfDHAHD$(@A]AE1LHl$H-ULQ11/HMLx 0AA~ ABp L$ME1E1#H$HD$8fDILQ H5jDD$ A4LHl$xMLx QLL 1H5`E\MHDŽ$ HDŽ$`M4AE<"}L<'rH$ H$`DDT$PA H謍DT$PHIT$HHl$Pl$@Ll$XEHD$`"9*IT$(I HA$tAtL$ L$`1L+$ LLHtIH$ L\$`EH$H$`H$D$ %D$At|$ %A EljD$D T$D$ jA]LHl$衣MLw WH-1H6L\$\@LI 1H5sDD$0AEES <"<' 11A H$L$ H$IHD$ E1E1D$DL$It$H|$HfDICItDB uH$DL$|l$xL-@LH$HD$(H$HD$ EuMn`IV@fIF@)$H9u@HH9D;J,uJ9uHIHIDHD$D$#B((ILD$@HT$0H8QIHfH@IH8vQIH fMHT$0IE.A$LD$@ILL$HLD$@H8HT$0QHT$0LD$@HLL$H fIAD$IUAEA$M\$uM[L$` t/IL$`LH0AӅ( L$`D$HT$(H+T$ %AV=Ht$Lz H-1H:_AXILH8_L#1ɺr1HwIL H5y܃L1H$AHDHD$8Hl$LO#1ɺ%H-01HL\$H18L\$Lv cL\$HDŽ$L\$L"11lH/L\$UDL$`L$ L+$ L\$IppDʹLLD$'LD$HHJH@HADA FLL$LUv H-1HnDEHl$PLl$XL$|$IUA}FI}DD$%=D$IUE1AE\LHl$.MLp :H|$ HT$(L\$0HT$(H9HrHFHD$(IH8MHLD$(Ht$ HBL読DL$L\$0IAA\#A  A@IUMAA$tACHBILH8[I(H8LIHt6H$fMd$AD$ID$ Ml$H0M$$AD$H-;1HLx L$ 11vHjA IEMLA$,ISH@HA AG M\IEIHA$ISH@HH|$8L H|$H0HDŽ$HDŽ$ KIH HfLH@H@@ H$`HL$HD$tAE<" 1<' H$ L$A LHLSHH$ H|$HLHD$H$訙L\$Hl$M1MH-ib LiH~HD$(L\$HXH|$HLL\$L$uYL\$L\$IٹL p H1g~L\$HDŽ$H$H$LDT$脘DT$HI 8%UH|$8 H$ L1DT$0H$`HL\$H|$8L\$HDT$0H:L$`A@$ D T$ ADT$L$MIH- 7LL$Lv Le}H@HEnHELHH-ԺLp 1HAHzHT$衞HT$HHHt$ HHT$HT$IH$H$DMeHI$ßIEH8LL$Lq H-1Hx|ISHAH.IH-H1Lj sH-IUMIHA$IKHBHHt$Li `LL$Lj HD$(Hl$H'L )Ld HA LEH PH-1HErHDŽ$Y^L\$HDŽ$DŽ$IEuIEItDB uDL HA/LIUL)L@HD$HDPKDL)HD$(Hl$HQL (Lc HA LEH PAD$(Hl$L1ɺ11E1HD$(Hl$Lb H-LH)Hl$H-1L HA|$(u1|$PDAD$(H$ H|$HLL\$H$RL\$( MMIL\$H-1ɺ LH1bpHD$(L\$HXAD$(HD$8L$L D$ D$}$0 $4H|$81L$L\$0LDD$(6H|$8HHGH$ HH|$8EL\$0HPHWLl$H$L\$@HT$0LH$hLЎDD$(HT$0$L\$@tH-D+$H|$8HH)H)HoHWH\$(MIHl$Ls ^ HI ]HL$ HD$ŖH|$1 IHL$ LT$HHu A<$" MeIE1 LT$LKLT$zM $Ld 6HT$ HD$2H|$1IݚHT$ A<$"LT$H|$8IMuHD$8HHdfH*YE1@LT$Y5t ID$KD$LT$H-GLd LHmWLIE1LѺLT$JLT$^MLVc $HT$ HD$ H|$1I赙HT$ A<$"LT$IMff/lf/Fs ^E1LT$Y1s ,HHI JLT$ML=c b HVH)HD$H|$0HDPHHL)A}"Hl$M PH\$01H-Lq HHSlXZLH|$HFL\$HD$HVHDPH)HGuEuDHFHtDB uE1E1H|$8H|$8IMHG?Ht HAHWHIE1HeLhb |Hl$L L] H-ǨH1%kL\$Hl$L LJ Hl$L L] T}L 1ɺiH-a1HjAuLȿdHHHVLȿHHH;*Hl$LLI M Hl$LH LI Hl$Lc | Hl$H-1L y HHD$(Hl$ LZ H-qLH_Ht$I} L\$XLL$PLD$@H|$0迏H|$0LD$@L$`HLL$PL\$XLH)H)LA}-HD$0{LL)HHFHAH AIALcШ LпdHHHA~@$0Hc$0D$,$4HփtHڭD;LAA$,SMLm t$EH-1HxhAYAZ81/$(h$(;$$:Ճ$$ $ :ك$ LпHHHA4LL$L\ FHl$L1ɺ LbH-J1HgL\$LkG L\$ULȿdHH1II"HƒfHH H*XIH~Ht$ L\$PL$@LD$0:HD$0HL)IH1Hl$L1ɺC LHt$I} L\$`LL$XHL$PH|$@݈E1H|$@L$`HHL$PLL$XHL\$`A+LLH)H)HD$0Hl$L1ɺ LHFHt$ L\$hHLT$`LL$XDD$PHD$@K1DD$PH$`HLL$XLT$`HL\$hHH+T$@H)HD$0fDAWIAVL5DAUIATUHSHHdH%(HD$11HHLH$IHH3HL(u\Mt*IIGI$IG ID$IG L Mg MHD$dH+%(HL[]A\A]A^A_Mt3IIGIW I$H,$IT$IG L Mg 4I(H8,IHu ^L1M#L8d ^L1Lc $^)L41ɺ1H5v^HHE1H8A9@H? K*IHfH=> @HpIEHL%LW 1L]HHtH;8Lo1ɺ1L]:HAHhf.Hǃq1E1LU H5X]zޅff.AWAVAUATMUDSHHLnH$H|$HT$L$HD$(H$HL$ HD$H$HD$0dH%(HD$xH>HuMHfDH Hxt}8y1E1H-LV Ht\L112HV\HD$xdH+%(XHĈL[]A\A]A^A_DYIHHD$HL$Mg0AW(I_pIO` MwxAGAW(@ tUt AW(tIO@AW(IWPIWXIWPH)7 HL$8IOHIO@=tH&MPfIW H=)#(mIHHIG`1xHPpH`HHvzuH'IGhHH$E1Ll$LLHl$P$HChLc`IN$IFL94$IH{`O$vILLL}LHLH_t$LtH}H;L`L|&HHA^AEtEAHChJIHHx rHu HrHt&L`HT$$1H53 LlAŃL%91ɺn1LLdKL + H1ULH L7KXZH$E1HHD$(dH+%(H8D[]A\A]A^A_þ LrHD$H]HLIHH@@fHI)@@ @0mLLIID$L9LHFHT$HHHT$HD$HHL`v LIG([qHD$HHcT$$H+D$H9 D$$HcLHT$7mHT$LHD$HrHHT$LT$LHL9IGvH|$IOIWIG0D$$H5=* HAG 1-jIALJA LpHHuL 1ɺL%1LHIL F |L1ɺiL%ڢ1LIL L1ɺrIG0L1ɺL%1LHL F HLLeF 1UHYL^Lp#VL'1ɺIG(L1ɺvLϾ HT$LL$\oLL$HT$HILLLL$H)HD$>kHt$LHD$ LT$LL$HtHT$LHHL9IG tI|$IWIG8L%џ1LDHD11LeL H5EUH@DfFf.Rf.Sf.Af.Uf.AWAVAUATUSHXH|$D$$HD$HxH|$HD$ HD$LXMcD$MKAM/E1IIH1LyM1MoAME1ImH1LeMtmE1I|$HtJDD$LT$Ht$DHL$8DT$@LL$0L\$(DD$LT$Ht$DHL$8DT$@LL$0L\$(Md$AMuA@HmHvMmAMOAMDM%HIHMIAMAM[DT$MD$H|$D$ HH|$HkD$ H|$D$$HH|$H%D$$HX[]A\A]A^A_AWAVAUATUSHX?H|$ D$HD$ H@HD$H8D$HD$LPMA:PD$MBM{A8&E1IHHE9E1HYH;1LcMA<$E1Mt$MA>E1InHt{}t1H}HtQD\$LDL$HHL$@T$iAEMd$MtA<$2ADH[Ht ;AHIHt 9AEM@MtA8AD\$MRMtA:eD$|$|$HD$H@HD$Ht8D$|$|$HD$ H@HD$ Ht8D$D$HX[]A\A]A^A_AAA,A;D$KD$gD$@AWIAVAUATIUSH(A:~MJM=A9FMAMA8IHH9LqMA>InH}iL}MA?1MoMtjA}I]HtM;H{Ht2LLT$HL$LD$L $LT$HL$LD$L $@H[HuMmMuMMvHmHRMvM.HIH M@MMIMMRMH([]A\A]A^A_@A$MmPA$C M rA$MPA$AE MVA$HmPA$AG H;A$MvPA$E M[(A$HIPA$AF H$A$M@PA$A MA$MIPA$A@ MA$MRPA$AA M}A$PA$AB H([]A\A]A^A_fDLU] rE1MMH9t:HD:uHIAH9tuAIAt!A uICD 1ff.fL \ HoMH9tED:uHIAH9t;uH \ o8uHHH9t4uE1Dfu1H@AADE1u̸fHL8rH9tH:uHIAH9t3uH n -8uHHH9tu1Duuff.L%[ eE1MMH9tBfH:uHIAH9t#uAI At)A MH9uDuKRAD1DAUATL%Y UHSH>wIIcL>LfI\$IfDHI9tHHu1H[]A\A]ÐHNHEHH[1]1A\A]DH^11HH UtHsffHv[H^E13Lct#DHHLwAD9+wH[]A\A]@H^ tLcE1DHHL/AD9+wfH^tLE1DHHLAD9+wx@GE1;G sHWpAwH DfATUHSLgHMtID$I+$H9}?HW[IHt9H@LI$Il$HCID$LcL[]A\f.HGIL@ 1!H5^Q `9ff.ATUHSD&HHvAtIHuPHuHtHHcCHSHKH,AuHcC HS(HK H,[]A\@HtH}t HH X XH5P H=? {Yff.ATUHSH9tCIHE\1H0fD0HHHHPI9tH HDNu[1]A\1[HU]A\ff.fHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$IIHD$HD$ $D$0HD$:ZHD$dH+%(uH `ff.fAWAVAUATIUSH(H?LD$H9LL$H|$IHIZH|$HIHfDHH9t HDB tH9toLHAADŽt?H9tIU @HH9t HDB uI$H(D[]A\A]A^A_fDHT$H|$H5N 1`fDHT$H|$1E1H5N =ff.UfSHdH%(HD$1FF F0Ht^HH5N H\[Ht'K8HT$dH+%(H[]H5]N H![Ht H\ZHtK8H5VHex.tL`H 1L$MH" L3nH5ALHĸD[]A\A]A^A_HL 11ATL- H5\B 2DA[[%KI1ɺ`PH> LPLP1CAYAZHD$8JM1PH?LPL1CXZML11H5A CBM8{JL 1LPHp}PH5qA 1JC]A\E1Mf.ATUSH_HtL IFIH}IHLHHbIAA9BGILJ(AUIATI@USHHHt2LHHlAątUH+AH[D]A\A]fD1E1L*' H5RxHD[]A\A]fHLU1L1ɺH5xSHD[]A\A]DAUIATIUSHHHtZf-HHH@ EHtImH[]A\A]fH5=6 HCHtDMfD1L& H5]wH1[]A\A]fD1HMHHH52 =qHL<1IٹL& H5v41@ff.fAWAVAUATUHSH8HHH$dH%(HD$81HfLl$,IHH@0HT$4LH56 @@ 1)=L<1ɺ:L-Bv1L{I1L% LWLH,H$E1HHD$8dH+%(HHD[]A\A]A^A_D$4D|$,vbL % >L-u1LZDLa% 15H5muE1eH4@HHID$HT$4IcH 4 E1HL$L4;uZfHcD$,AID9|$4vEID$DHt$MLHRH1HJH;tL1ɺKy1IT$MLH5i3 Ll;tL1ɺOB@HcD$,LH5 4 M<HD$0HD$HL1&;t/L=1ɺSfDL3 DHcD$,1INjD$4t-IL$T$A<H4@L4T$A9T$4wӋD$0Mt-Pu 7Lxr- LT$AT$HuL1ɺZXL H5F3 V;HT$LH53 AIG ELD1L/:AtLC1ɺbHcD$,Iǃ|$0 LDL$@IHILLL)HD$lHt1HHHHHÐH)HcH9|1HÐAUATIUHSHHLoHu H5HHs0I}HcIEHH)H9}YLC(HLHH9wqLHE1HtIC8HKHƒH#H)HHS0HIuH>HCH{0H8HLw>Hk0AHD[]A\A]HH-ff.AWAVIֺAUATUSHHdH%(HD$1Ht19H-86;IٿIHHH HDHE1jH  APH5u QLP1H HD$dH+%(HD[]A\A]A^A_Ð@HL,$AƂ@8ADžLh2H=A}DmRd>IE1HtƒHuAEt,IDxHt1@Hu9BHsA6@DAG0J8H-s8|5I1PH7a LPH5> 1XZxfD8H-,855;HIIHH  HDHuAPLQPH5 1H D/GL2RfIٹ{1L,) H5 fDK7H-t8}4;IٿIHHHDHH  pAPH5, LXQP1H Sf11D9HAUH\HhHHIHzHHDHH) 1HIEAEtIDžfAExLD&:H=56H-^8g3;HIIHH  HDHAPLNQP-5H- 83;HIIHmH  HDHAPLQPO6ff.@AWAVIAUATUSHhH8dH%(HD$(1|IH8 HxHHHǀ`H1H)hHEIE1Hl@I}I;0M|L9uIwLHD$HH IL-& DLHE1LL1H%7HcLH9t*|LzɾLHH HD$(LHT$~IHfML0HT$@@(LHHT$fHH@ @IEHD$LL|$$IU IECLL% HtEH \$$LLD$$1HHuL% H5 1 LLaLE% 1mH5w# \ @LLE1*HD$(dH+%( H8L[]A\A]A^A_@Mt$8HIMt$0I}Ht}MmMuߋUA\$ 1Hl$AՉ\$HH{HtMH[H>;uމ\$Hl$DAL$ ID$$t"I{HtLM[MtAuދD$$AC LHKID$HAt$ LH,ID$(HHLE1ET$ECHl$HH1C)I|$0D8E|$ HC0DH,HHHHH1(I|$0D8E|$ HC8DH,HrHgHH1H(D8HAD$AHK@A9IT$E|$ DI|$0HDH,HHHHC0L1ɺmH- 1HLc11HL@HC8L41ɺoHC@L1ɺq1HYD8E|$ HC0DH,Hc1HzD8E|$ HC8DH,H01HHdD8@AE;|$YHl$Lt$AD$ Ml$0LXHfH@E1At$ I|$0LhI$H*I$PHRLHl$MI1fL1H&HKL@II9A_ I0DAAAILHtfHuMLc1ɺKD@LrH- 1HLT1ɺ1H=D/HHtI\$Hl$DIEL4 (HT$k/HT$HtL1ɺj1H5 L1IDŽ$HDLl1ɺ|1H5 (Hl$Hl$E1L# AD$Lt$f.IT$DH‹LsHk IcL>fDIv0HC0HxHHG1Iv8HC8HxHH&1C$L # {AL$ I|$(Hs81A;L$ D#tLK0HHP@f.ED HufDIN0EN$H{0EkHu0 HuDE$HU8HK8EIv8fD< <@H[Hm;Etf1H[]HuH{tHuH{H[]HSBuHMf.9uHuL՜1ɺ1H5b bf1ff.fAWAVIAUIHATUHSH(dH%(HD$1Ht$(L|Mt)LIH-fH@ @%IHL9a HH@HI9CHEB uHl$I9,HfHI9t HB tH9HHL$H)MLHL$I$HI9t"HfHI9t HDB uHl$IL$MLL HνHH\$!u51M"HT$dH+%(H([]A\A]A^A_IL$ MLHLٲHtIL$MLHLP HtIL$MLHL7 H}XH.MLHIL$L HQ,IL$ MHLL H,L9|$MD1H5 L'1I<$D$cL[D$H&HL$I$HCH54 L1Hl$H5} L1hH5W L1Rj"f.AVAUATUSHH $HdH%(H$1HH1I)ʼnHT$1r<uu2!8IŃtHHQ\M1ɺPH LPH5^ 1E1_AXHt$HD$@HD$L$L;HHdmvdo001H9$ML' 1E1H5 GH$dH+%(HİD[]A\A]A^D# HL8UM1ɺPH E1PLH5T 1AYAZfH8 M1ɺPHLAPfDD$$$At4L] H5 1E1tjHA1RH5 E1L5 JY^A}H5@M1ɺPH LtPL$L$L+$I HD$IH9vSHPL 1H5 E1XZ!L$L$fD1LΉ Hx_LH'L$A)wjL$H$M9tkH"AVL ZH8M1ɺ PH2LQPL? -HA<H8M1ɺPHLPf#UHSHHDAA1A L  H5; @1DKAQv5h1L+ h%H5 AY1AZDKAQ?v1h?L- 1j.H5 _1AXDK A?v3h@H5 1h7L vY1^DKAQv3h@1L hH5) 3X1ZDKAQv1h1L jIH5 A[X1DKAdv1H1QjdL H5 AY1AZDKAQcv.jdL 1jYH5s }_1AXDK AQv0hH5G 1jbL <Y1^DK$AQcv-jdk1L jH5 X1ZDK(Adv0H1sjdL H5 A[X1DK,At\LD$?HoLD$HCELXH([]A\A]A^A_@LFH([]A\A]A^A_A$LnHHATIT$HIt ttAE@IM)D9KLF_fD9LFFfHvH(L[]HA\A]A^A_fLnEuEAUA8$.L)A9AF΅^ʻDHÉH9tA|HCA8<tDLD$HL$H)L$LD$H#A)ItHxL$DpDLD$HD$AL$ILAoeLL$HLD$A!AMLAEMM,I}D$ D$LnAEHIT$It\AMA4$HAt AULnAEwHIT$It AMA4$HAt AUtLnAE0t{HIT$ItSAUA $AT AU,LFLF111LD$LD$HIt1HxIUHIO1H[]A\A]A^A_DA$LnIT$HIttA$HATA]SAU0HLD$D$LnLIu0rEMEIUELD$HUpD$BfDLnHL)AUH9#1DHH9kA\A8tf.LvAA$1H9AA8T6uHMnIT$LUDHA|AD9hBA@LvASA$1 HH9=AA8T6uHMnIT$LDHBt2*AD9AHLD$D$@LvA$E|EA/AIIT$HHHDHB2A$IAD0IV /w A8s HH9uADH߈D$APAwBHLD$LfHGI4$HtH AoD$LEH[]A\A]A^A_f.HGHvHtH DLLEEEEuELD$D$cI~DD$2ADLAD$6LD$FED$I~DD$ADLAD$cIHH5o Hу8w(HcH>ALHHA|OLH@HI9tMu@HxIM)DOM9|E1 HL9D\E8tDHxDEtE1@HA9|D8TuHIHDL92ZfLHA9BE1fHH9$E8TuHIIDL9HxAT/HIHL9@MHL9@IIDL9rfATL$LOUHSHL9tHtLL%IHIL[HHL]A\AULOIATL$USHH/L9tHtLLIHMHLLHCA1Et 19+DH[]A\A]UH,HSHHH9tHtHiHH1H9t H[]Dt!uHGHHH[]fDHGHH[]DUHHSHHH9tHtHHHH9t9?t H[]fHWH);Zst1@ 8LuHH9uHHH[]@AU1ATUH-SHԲ#HHm HdIH ǀPHHI#$A$H=jhH ID$HID$PID$HI$I$I$I$@I$HI$@I$ I$I\$xI$(I$ H:I$I\$xH.HHt&UHHHA$M$hH5 LH=sHHt1HL`H= AHt<81u7xu1wu![UA$A$hH=אI$HH=ɚID$HH=5 I$GHLJPL*8L"XI$8L:E$A$htHLwHIL'KI$8LMI$8H<LDxLK&LQI$h"HI$HZ1L羟L@1LcbI I$LI$I$I$I$I$CeLHI|$x' I$HHPI$HHP(I$ID$pI$ID$hiL9M{LMGL)YI$G`1HxH=ywA$GHt&HPH=H*LvZLXAo$HAo$XI$GAo$hAo$xI$GAo$Ao$I$GAo$A$A$A$A$A$A$A$A$LH_H-(L; HH1Lz >fD1IHI9F I$GH11u8 E11/#L-DH5HL5YI}I$G}8HL :PH LPUH51}H /L H5NfDA$)HHe#H=]#HL[]A\A]Lq1ɺH5U1?u8 1L-H5M LE4I}I$GH;88GHL ːPH LCPU@LPHa#1H=x#>#H/#HzHHfHH9uH b߃;uHڍ#;H#H"Hۢ#HL[]A\A]H-1L HF11LoH)A$f.LXVLo1ɺ 1H5E1HL[]A\A]L 1ɺkH5*oL>o1ɺH5FL H5lLn1ɺH5HLULn1ɺ .L cH5(LE1Ln1ɺH5JL^n1ɺH5&fL:n1ɺH5BLn1ɺH5kLm1ɺH5GLm1ɺH5#H5Lm1ɺqHt$Ht$Lm1ɺ1Lbm1ɺH5*jL>m1ɺ1H5 DLm1ɺH5m Ll1ɺH5ILl1ɺ1H5#Ll1ɺ H5rLl1ɺH5NLbl1ɺH5*jH5r1L H5wH=  HxL H5;Lk1ɺH5Lk1ɺ1H5iff.AUATUSHH $HdH%(H$HG@HIHt]ftSh2HL$1HhLH`F 4HLxdLHۅAąAH$dH+%(HĨD[]A\A]fHh2L1hALdj1ɺu1H5K E1fL1H5B ?DAWfAVAUATUSHt$0HT$HL$LD$PdH%(H$1HG@)$HDŽ$HD$pHNt$@!t$$ t$88 D$Zt$<h t$DD$\Ht$D$4HHHT$H9=HXT$8D$LI T$$ T$LMt A>@ E` HD$t$@tHHLCYL$Hp D$D D$$D$hD$lHL11L|$lLt$hL H5lGLLH HH1H9t@HH9uf D|$lLLt$pAEw ZHtHHt H9L rAW= L5 AV11ɺH5_AXD$LD$8M D$L 1ɺ1H5HtHHt H9HHT$(=L HA1AWH5V1AVHT$@R"H D$L6HtHHt H9"L=_AV=1AWA1L 1H5XZLI}LxL~IHtLLHII}Ht$PLiD$8 D$ H? L H1E1vH-L 1D HIE L LL$LHLAą4LD$MfDATH1IUHH~HSH)HHdžHQLc1A?fDH|H0HD~@ADA HI9uL[]A\fDAUf1H51 ATIUH`dH%(HD$X1H)$HD$Ho L$@HBHT HD$P1DtLl$@HL0uDH|$fA$A$ AD$HD$XdH+%(ueH`L]A\A]fDH|$ t$t$t$$$$=H|$8H0foT$ fo\$0A$A\$AWIHfAVMAUA͹>ATUSHHH HxH$L $H$pHD$H$HD$H$HD$H$HD$8dH%(H$h1HT$ )$`HH$`IHD$(LR E1AHLABELONEH9$`H;$hH$tϦ裍;$p$t xHLVM2 001H9$xMt EtA1ۅE$H$1D<-tHcD4@HuL=  L 1ɺ1LD$4H$HD$ HXH L$1L%fDIHD}I>"DEtHAL4 1S@L1YA6ALG 1ɺB1L^AvLH A1LD1_AXl@L= 1ɺ1L9 L\@L=ۜA11LL f$t  fDL=A11LLk &E$HMfHH+D$ HD$(I9t$AL 11]H52E1I~L=EL$ZH|$IHIH=H=@„tHHIHAI<$Eu)I$ID$EtH|$Ht$HHfL$HA1SL# aL1AXA4$AL7 1ɺc1LAYAt$AL8 1ɺe1L躿AZA[L$TDEHD$8Mt$DEH|$(HH+D$ HDI9t!L 1ɺ1H5WHI|$Il$AL5HAHH}t}EtHEL 1SL1_uEL 1ɺ1LϾAXuEL 1ɺ1L誾AYAZqEH$hdH+%(-D$4Hx[]A\A]A^A_f.L$HLPAL 1ɺu17^_L$@1H|$@Bf\$4L=KF@HL%7E1SLh NL1ĽXA6EL 1ɺP1L蠽XAvR1EL 1L{XZ`@HD$ L=1ɺ-L LLH 1CHt$` H$H п 51ɺ.LILɿ 11Lɿ 1L$/L$HL=A1SL@ L1蜼A[A4$AL 1ɺ1LvXAt$A1ɺ1LL HkLHH+D$0HD$8ZYI9tL 1ɺ1LI1L1L EL$1L1Lv ٻEL$1LL̾ 1跻[fHL-E1SL L1脻XuELn 1ɺ1L`Zu1LELu 1H LVM2 x[H3$,H3$$H  I LLL$(H%H-HHD$ LH)HHD$訲LL$(H HT$Ht$ HHLL$0HD$([L\$( H5A%r0N*>I3C H LVM2 x[I3SH  A{LL$0f HD$ I;C HC1HHD$H  L|$(IDd$LILl$0MH\$8LHl$@fEHL9 LL ooo o0o@)$ oPo`)$0opo)$@o)$Po)$`o)$po)$o)$o)$o)$)$)$)$)$)$)$QHL|$(Ll$0H1H\$0Hl$Hp1H\$@t$ L Ld$0H58MެHD$(H|$8Ld$xH$±D$`AYAZLHAoN@MLl$@IGI?Hth LH$fDHt H{BRL WD$P;HHEHH9LHL 1 H5XL\$LG 1ɺYH51-L\$L HD$hHD$pDD$PEf/t^HL$(Ht$HAA9Ly ^Lt$`Ld$XX^HtHEHtvH9tqHpH= 1E1XzH9t9H@HIL P[ H5|~1AXAYHH5LIGH I?LާL$L 1H5 ~譢BL$L 1H5}|L 1H5(RSxL#1ɺB1H5}-L#1ɺ&H5`} LL$L wh HL$0h L\$L5 1ɺ^IL|$(Dd$LLl$0H\$8Hl$@L\$Lɭ 1ɺyML#1ɺI1H5|gTAhA~t}AWIAVAUATUSHHIHUILH1HILkE1H)L%ʐ ILJHDIcLHH1HAI9uoEoMHoU o]0oe@omPAou`o}pAOooAW A_0ooAg@oAoPoAw`oApoAAAAAAAAͤHL[]A\A]A^A_L 5 1ɺl1L6 H5z蓟ĐAWAVAUATAHUDSLHL6LnNDVK.L$L9#*H@DT$ EPH 1APL=sz1LX RLjH 11AVAL_ Lj۞_AXAUj11AL^ L贞AYAZ1ɋD$A!LLX P1j艞A[XDT$ EAD\$ oAR1L1jA$L@ KMY^D\$ vfH١ EAMt AEuCHI9FH|$PtHD$PL0H|$XtHD$XL(H|$`t HD$`\$H[]A\A]A^A_PH\ 1APLӮ 1H5xRjxH 11AVAjLȮ H5xLY^AUj11ALЮ H5yx"_AXAD$1ɺ!H5WxL P1jAYAZH5;xDT$ AARAL 1j$1蹜A[[HAL: 1AT7H5w1I胜]A\L=wD\$ HL1jAL 1ɺ+FA_XD\$ .fAR&1AjLK 1ɿXZAR11ɺ&ATAL LܛMXZD\$ [USHHdH%(HD$1H ZtH$8tkHhH,$8%t!1HT$dH+%(H[]@H56H!tH5Hu"C$H9Cc@H5CHٝqH5HZH5DH諝MH5H蔝6H5x H}H5e HfH5P HOH5QH8H5dT H!H5XCH H5QHAEI?1H-NL H1Lr1ɺ.H˙1E@AL 11H5M薙QG=.AWAVAUAATUSHH(dH%(HD$1NL#C$HHHHDA$<+<-IC E4$L cAFըkIIIDBuA.t D:uzeL|$LLI HT$:.~E>I9EH*@fA*Yf/Dž A, m f/CH,C HCHCAD1 }.xH5/D$OHt)ALLHH5U9D$!HT$D$E>I9(f.EH9HD PH5K1QL E1|PY^C@IEf.LI hH55K1E1 HD$dH+%(H(D[]A\A]A^A_D؝A>HT${H ??@D$譡D$1H= H49t6HsL{ 1H5J\Ntr @At YsXfD\H,HCH{?L 1H5Jܕ ~ f/s"L,L%u'Y} WfDf(\L,I?I)HILը PH5}I1YXZI͟H 6AWAVIAUIATUSHHDbEHHxHhHu.HS`Ht D#E AHD[]A\A]A^A_ÐL{`Mt7 {MtHk`LH?Ht HxHH@HH)xMtIF@H}f+oL @fHeb1jAfA'H58 _AXHHxHhHDcL{`EMtoMLL>HHxH  tuGe uo*LXIH5H1sfDD#EsL 1LH5cH8P;Gd 1Ly]IH5H1fHLH(Ll R"1H5G賒XZ@H{L 7H5G1E1vL1ɺ1H5zGOgf.LAąrL1ɺ-1H57G $H{ SHAI1H5F0E1L 軑Y^@HC`HCPHMALF Sff.ATUSHHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1Hl$ H$$HD$E1L%D$0Hl$ $Ht$1E1f/AHHcHS@HtH@HHfz(tƒz u@tHt$Et $HHD#ATLH1LH5\D5XAZYHHHckHD$dH+%(uHD[]A\d@AVAUATIUSHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1Ll$ H$$HD$E1H-cD$0Ll$$H|$E1E1D/AL0ID$@HtHcHIHf|(tEtH|$Et$1L]uHHB#$ULKAL8H5B葎XZOf.HAH0bHD$dH+%(uHD[]A\A]A^AWIAVLAUATMUSHHHHT$HW@dH%(HD$81ADLLǁH/f*$s *HD$L-2<LLHH H@H @EHAL1jAhH5H hhhjfjejbhhhhhhj\jUhhjRjKj=j8j4hj&j%hhhhj jhrH  CH@HA L1jAhH5 hhhhhhhhjMhhhhhhhj\jUhhjRjKj=j8j4hj&j%hhhH1LR AúIG@S$H fD\$1ALjAhH5 hhH D\$ C$ H@AOL1H5% hL 1ɺ"H@cjA LhA1hH5N hhhhhjjjkjihhjNjDjMhhjZhhhhhhj\jUhhjRjKj=j8j4hj&j%hhhH@1L .0HH@3 DE H)<Ą H; HDHPEuHH u D[EF DkEH@ H@XH1HLЅHH@ tLtJ@tL.t) 'LۯH5=1趈E1fDHAL1jAhH5 hhhhhhhjfjejbjMhhhhhhhj\jUhhjRjKj=j8j4hj&j%hhhhj jhH@1Lm 7DH5<1赇E1HD$8dH+%(HHHD[]A\A]A^A_@f8R LMB C$LH51@DžH5|$LDDHǁHǁtLHT$L-^ i D$ZLL EL7 HT$#L k#DD$L-^@L1H5r L1ɺH@-jA LhA1hH5 hhhhjMhhjZjOhhhhhhhj\jUhhjRjKj=j8j4hj&j%hhh\H1LH@HAL1jNDAhH5 jjjkjiH01ɺ2L$OjALhA1H5; RZLmY1Ʌ;DL>IO@CHVf/HL$CL HL$C f)AHp)HCPLCHHSPLLLD$0LD$ IG@1HtHft HHu2ft HHufHHS`LHS`LLD$XLD$[HHPH l H{`UL H{H,LC`LKPHH@HC Mt=LLHL$(LD$ LL$͍LL$LD$ HL$(LK`HCPLKHLLL$LL$L HADL1jAhH5šhhhhjN3H@jAA1hLhH5hH AÅ IG@H f.H.fX'IT$'z f'L4 L71LL\$߁L\$f.LLY11賁E1Mo1Lz H56聁E1fL1ɺlH5w6QE1ffDHA L1jAhH5 hhhhj*hhj!jhhjcj'hhhhjfjejbjMhhhhhhhj\jUhhjRjKj=j8j4hj&j%hhh Hp1LAúEuIG@Hf'f f.Cf,HH@~fDLT1ɺDD$L۔ H541D\$fDIG@Htf'1fX'#D\$ L IW@HfD\$LH(LH H541~D\$,fD1LH5Җ D\$( D\$JHHPD\$L1ɺH531r~D\$L1ɺCLl3LL\$9~L\$_f,tf(!pf.bfx%D$L-AVfHf-L-]3f%jA LhA1hH5 hjcj'hhhhjfjejbhhhhhhj\jUhhjRjKj=j8j4hj&j%hhhH1LpCHH@AL1ZH5$ L+1ɺ1ҾLD$ D\$D\$L fD1Ҿ>LHtCIO@C H1L1H5 mL1ɺ6fD\$H1'jALAcH5 AYAZD\$ HH@DjA LhA1hH5s hhhj!jhhhhhjMhhhhhhhj\jUhhjRjKj=j8j4hj&j%hhhH 1LWAúIG@Hf'cfD\$L D\$L DL1ɺ=D36XH)HD$1LH0P2/HHD$0HD$LD$H Lt DLL1ɺL.L޿1L\$yL\$fX']D\$1ALjAfebhH5 j*j'hhhhH@D\$y IG@H^C@Dk$EwL .1 `L޿L\$L xH5LL\$HH H@f.X=H{H LC`1HtHCIW@Hf8)). (D; IW@H1fKtHH~ f8,,C|H@ HH L$t {p[ u I<$IG@Hf8#{#PCxw PhD\$L.fLz)D\$JL ID$HH΅ALs D$rL I<'T'HAD$NHD$1LLD$ H0+/HHD$0HD$|LL$LD$ HLKXHSXLLsHS`LKXHLHLL$ HT$}HT$LL$ ?HCXHD$H{HLC`M&HIG@Htf.HD$HSXLLHHCXNsLJ1ɺVH{H HHD$LC`HQHHsxLD\$HLLIHD\$HASfX'D\$1ALjA!hH5J hhhhQH0D\$D\$LW1ɺ3D\$L?1ɺzL1HH} H{HH LI(L Lz&1LL\$EqL\$kHD$1LLD$H0t)/HHD$0HD$ zLD$HHT$0LLqL{1ɺHS`LD$0Ht'HLHT$ LD$F{LD$HT$ H{HLC`HHD$HQD\$\L D\$L1ɺL0HH&L1ɺzH{HL }HH pSpD9[D1APL6 q(AL$1LL\$oXZL\$LHlL1ɺ]A1, LL$ 7LH0L1ɺLC`LHL1ɺcHHEAxA/L/ L/HHHCHHQ6D\$L*1ɺVD;Kp%L Vq(HA(APAQLp ILg#1LL\$2nXZL\$VCxLD\$[Ls 1ɺIH5#1mD\$1ҾLD\$^D\$ǃIG@HfD\$L; L1ɺLz"L DLK`C ǃIG@HtfI_HIOHH9t]D\$LMl$IHft(LMI|$LLPUHH9uƋl$MHD$Al$ AID$L 1ɺbCC|LD\$ZD\$C|H@4IW@H0OLD\$D\$CL ,tJ L 1Lq 1ɺH5 D\$kHD\$L-1ɺL L1ɺbLlkE1LD\$ LT$Lۆ 1ɺIH5[ 1.kD\$ LT$HǃIG@Hf.L WRfSpe VcpHHt {tIW@Hsf8)tt 0 ,C|1ҾiLD\$D\$UǃIO@H>ft)1ҾjLD\$ HL$HL$D\$ f8t2HHD\$D\$7IO@Hf(HLD\$ aD\$L1ɺlLLL\$fiL\$L1ɺY=jLw D\$ H5=11DL$ iDL$D\$ HHAHOLD\$ ɉL$\L$D\$ CL 1LL̅ LL\$hHt$11L`hL\$rML* H5T.hE1tD\$LD\$mL@(HHH{HELÁ HLH(RAPLс _L LA Wq(D\$L /HHDLH(1Ll 1ɺ3H5ED\$gCpD\$HIHCHLf LLL\$fL\$LH(L AL1LL\$fL\$ LI(L  Lr oALӅ18D\$H5T+fD\$E1F Hǃst9s|AID\$A$APjMEAs|A$I$IEMHAZL A[=fH5LJ(AU[P11QeCtC|A]XD\$f 艃f ꉓ9=EfLrVD\$H511ɃdD\$LH(F1Li 1ɺH5D\$dCpD\$HLH(L (L ;1NL1ɺTLH(uZ1L?i 1ɺ;H5D\$cCpD\$H LC`&L@1ɺOL 71zǃ1f_ǃ[LӀ L /1ҾL8IH|f8)n)af&tv|&ƙ1L8D$I:LH(L I f.L L1ɺhAWLAVEAUIHATIUHSH8HL$LL$dH%(HD$(1L9HDFaA|$hD$b$AL$`HEPuUpE1LL`1ɺRHD$ 2DT$ HHU`ƀ7<$9|$HHT$DT$ H%HT$DT$ @HL$EHLLDT$ 褯DT$ HtHLDT$ MDT$ T$H+T$EA$AL$pjHLPED$tt$0H AÅLHtHM`@AD$\f1Hf?AtfD;H$@D$LLe 1H5J`L1ɺkfDH5<1_E1HD$(dH+%(H8D[]A\A]A^A_@HPUL~ IH51_E1@D<$D+|$E#A$_E\$EHMPI\$@HT$$D\$HHH $' D\$T$$H $HL xfH51LV ҹSLD1^Y^D\$D\$Lc1ɺfH51^D\$H(L} 1ɺIIH51t^AwfT$E$ED$tAL$pD EHHLAVAQEt$0!H IE@HU`Ht f"uAD$\DD;t$ULHL$EHLL6.D$L61ɺHI9HI9uLD$DDHLD1A|$hbHLG} IcLD$E1DHH 2^AÅHU`f.LY| xH51\E1@H(Lg| ID$L1ɺLi} DHD\$ۨD\$taHL$DHHD\$j/L1ɺH5 [D\$ D\$Lp1ɺHYLM} IH5 1[D\$Lɲ1H5 t[SD$L1ɺHD\$I9wHHL`Lm=D\$tzHD\$D\$t!LD\$YLHsD\$tCLD\$PWD\$t-H}PD\$9CD\$tH}Pw5D\$LD\$H-֊&L'{ HI1sZH1L2{ SZD\$WD$Lz 1H5f!ZD\$%dL1ɺ?ff.@AVAUATIUHSHFPH@HpHG@HtbfvXL1H5YL 1ɺ-1H5E1pY[D]A\A]A^@HHU|Lstu`HE`d$HE1HE`1L { 6IH5N1X1H5H[]A\ADA]A^HxHCWLHhqAŅHM`HL5&DM|1ɺNPLLz P1mXX1ZHGAŅtCH1ɺVLILz 1)XHLAŅA[]DA\A]A^@ID$@Hf$fHX1Lwy I1E1H5W[D]A\A]A^fHLL] JIH51aW[D]A\A]A^Df/ffHH=Qy H1. SH'tPH ؃tIsA@Ic1IE)LL HIcbA9~Aƃ'uAD$?H[]A\A]A^A_fDATIUHSH?Ht}H@ƒA|$ CtK1ɈSAT$H߉  S ЈCD#H][]A\fDuC[1]A\ÐAWAVAUATUSHH $Hz1H|$@H=dH%(H$1UH-+H=#HH/@HH0HH9uE11H "]D$4HD$:D$pD$\D$TD$ @H~ HHD$HD$H= HHD$8-u x-HD$Ht$H$HPWH$H)fHxHܰHH LcS\HuXL$HIUDPMuyA}O D$T" LL$Lv 1H5RD$H$dH+%( D$H[]A\A]A^A_@H5X L VD$H5X LUH5X LUH5X LUÅ AmIA}DA]:\$L$ A\$9r6AHLA)AE,,MMkFILP\yAl$9sLW M1L4H5DQE1fEGfKO:A}O&A}_:LDZHHc@"LCH0"ZHH5"HH;H:YHH|$:YHhHZHCHD$pD$\D$THL$D$4DD$4HcH{ H<(UHD$fH-Dd$E1:I0]A9>H D)DHHL$LLD)B,0ZyDuA9~Lcd$f.@D<-1HD$x"(AwIH THL$LlHD$@LH8IH HMOHǺt$L4L1H[MgA[[LLcd$:|$ KHcL$ L=DŽ$HHL$xHiIHL$ fAGD$tfA_I/fAAIcD$(AL$HD$D$DOdDJ,A<$-D$t$L6&^A<$OA|$OA|$_HH\$ LfK fD$ZF(HH WHD$HHx HD$HL$ H$ H$HxI,D$tD$ AA|$-t1M1LH5KOd"H$1LLA&D$(D$IL9t$fD$(MH-Hl$ H51LUKHL$ HcHHH  fDfH$LL)$)$y#H|$ H=fo$fo$D$HD$(QfHH4H4H=~7 H HfIQ fDH|$@LL;'D$(D$OI|$T(t$\L$H|$@DLLA(#HI@t]H4e{x{1E1L.H5nK?fHu.{n${<H$HFD%XEHD$ E1L5JHD$HD$$L=E HD$jD$$ 1ҾLD9SHILE 1U L1A>_AXDD >XEt[HIL8E 1SL1|>AZA[t$t$E1E11j1HLt$Sj肳H0>HD$fDAHD$(dH+%(9H8D[]A\A]A^A_@AH-I11ILE H=;eu{xu{uLa 1ɺ1HA=hf.HH7H$HHD$AHeu CxH5H4$u H HEH$t=.UuQAD$ ;uu{nu {ILc 1L 1;s {h{IL` 1ɺ ;s{h{ILy_ 1ɺb ;s{h{IL` 1ɺx ;sA{h7{-IL_ 1ɺm }HD$ ut3sy{ho{eILy^ 1ɺW 3{nuǀ{I6 L] L1E192=&HJHGI HEuu{nu {su'{hu!{uHILo] 1PG HIJ PL] 1LE18XZIp L|^ CIe L] *I L_ I{ L^ HI PL? eIZ L2] `BAWAVIAUATUSHHH$L$LLD$@H QL$H$dH%(H$HPHL$xH PHL$pH PPHL$hH$H$HPHT$`HPHT$XHW R$HL$0H$H$H$HL$H$H$H$HL$H$H$H$ HL$(H$(H$ H$0HL$8H$8H$0D$HL= HDH$HsHD$%DH$@HL8/I /H$?HH D$@EG L;I~L`LIHtLLHCII~Ht$L-L:HD HHD$ :HT$ I~HtHt$ wHt$ HMHD$ HI1LL1\-I~HT$ Ht$6HH9$qDŽ$@H+}@} LeL  L:I~LhLIHtLLHBII~Ht$0LrHt$LjT4D$HHt$1L 1ɺ?i4HD$@HD$PH|$@ H$HMHD$hHMHD$xHMHD$`HMHD$pHMHD$XHMH$dH+%(VD$HHĨ[]A\A]A^A_LZ :HDŽ$@L+L8I~L`LHH(LLHA}@/HfHt$L1ɺ"bFgMIELrHHD$H1!D$H?HHD$ Ht$LA11!D$H+Ht$LDAj!D$HL1ɺcH\HD$H14!D$HL@H5!D$HpCEUHHXATgL ( LDHLG HHD$ 1 []D$H+fDAT>USHHdH%(H$1HHHHD$HD$HD$HHmHD$PHD$4D$pH$HDŽ$DŽ$t )ȍTHcL%+LG HL HD1H‰$HP11RIѺIH$H;H$H$Y^H5vH$HtAHHFHtYHpH$dH+%(urH[]A\fD1ɺLL1fHL LF LX1Z{3)AUATUSHHD%38dH%(HD$81D$EbD%JE"LLHH"H|H|$jAULc1L ҼRHqH мATL%% RL1U_Hl$XH0Lt$HL$ LD$HKD$ tSAxILl$ Ht H}=L"HD$8dH+%(HHD[]A\A]P1L XH E1LE H5#)RXZ{L$ 1kH5($jLT$ gH5(<1E1LLH5(8'ATIHHT$PHL$XLD$`LL$ht=)D$p)$)$)$)$)$)$)$dH%(HD$81HH$D$ HD$(HD$@HT$ HD$,0H5:M HD$8$$$wVfoD$ foL$0H A$AL$HD$8dH+%(u HLA\*&f.AVfAUATIUHSH˹H@dH%(H$81H$xH,$)D$@HD$PH\$LD$LL$ I)D$0LEH|$`HHD$`HD$HH$pHD$HHT$(Ht/HHt#L5HLLtPMI}IMH1eYH$8dH+%(H@[]A\A]A^fDHH$HtHC`LHH uHyHH$HC`H^fDHt6HHD$(H HC`Ht H@ HD$@HC@Ht2HD$HHD$0HD$(fDH1ɺLvX o oS$$ $HIE11L$LGIwNI:LAI9tt<_uIAAI9uHHtD@H1L H5|81HE1AVAUIATUSHH>uW/EL5z@u(I]H[]A\A]A^D@ tkH@t1DHL 3tʄu>1L H572[1]A\A]A^tHH8uHIM[]A\A]A^ff.Hu'u[HxHGHOHG HHOHOHDH5OHOHDMHHOHWHG H9uHG@( tLK1ɺ 1H56@vff.ATSHHmHHƋ@vA v>{1E1Lc? H5HD[A\fDvH;11AątAHD[A\L41ɺ1H5<v@1E1L1ɺeH5KHD[A\AWAVAUATUSHH $HH $Ht$Ll$0IHHT$1ҾL$dH%(H$"HGPLH(1HHLhML$HLLHD$0ID$PHlD$(L1e<MHT$(LHHRAąD%EIHHD$DL$Hh"AH$H HD$H1;D$(IH5uFHL$L$PLHcHt0PH5SFHcHL0PD$(HcHHt0H= Lt01L5!SjLL$ L$L\$Z;Y^1LL$L1L> fH|$LIQL9#H 8.$HIHHDH APLSPLL$8L1H LHte81LPH LPLL$(1XZ*fL1ɺ1H5 oH$"dH+%("H"D[]A\A]A^A_ID$PAt$HML E1H5W 1_AX뒐H 8$HmIH?HDH APLSPLL$8DLQ; 1ɺ1H5A @HT$,LHAąxL1ɺ1L;V1L ; H5^f.AUATUHHH dH%(HD$1ILl$L,$t~H}PDAątFLH1AątAHD$dH+%(H D]A\A]L1ɺ_1H5ODALђ11[H5_$fL1ɺd1H5:auDAUL-I1ATLa LUASHHdH%(H$1@HHX11tb48t}h;ILIHHH 0HDHE1APLDQP1H H$dH+%(ueHĨD[]A\A];u+ILrL1E1HHxƋD$%=@tf.AWIAVAUATE1USHHHL0H9HPHhEl$IVHL2LE`D1HHILE`;AątILM9tqIE뫐HH-7葋L HI1Lj11HHD[]A\A]A^A_AAWHAVAUATUSH(LI9+AHHAA͉D$ IGH@@]jC@`uHlVAąEIGH H,HHPH IHLDHDIuAV L5ATIL LY1 H}PY^@AąAHH5tJHAąLEAąLLAąEDDl$ HI_s91E)AąP91H JAą?1HAąALfFHE1]La CIH51 H(D[]A\A]A^A_@HLKIH51a Hs(Hl0HLs(I͈HHD$IGHp(H0IwHL$HHF H/HH#HT$LHL$HT$H1MH= MHWLIVL0l$ HPIVHIF"f.EIHxHI$J|(AWLm 1SHt$0I1D)/^_H5*I|$ HHI$J|(I|$H5}HHI$J|(賟nI$H [H4BoJD*HD2I$Bo  JL(HL0AL$L?DM;$$tHD$8H@PHD$XHI98HHL$(HHH|H1ɺ! UHt$0IL9 1A_X DHt$ A1L: Ll 3 Ht$ 1D$@HHL$(I,$L|I9ufHmI9HuL臔tbfDHt$ Lσ11)YH1HI9uH5HHE1fDH H9uVLU 1RDL$ Ht$0_AXD$HD$xdH+%(tD$HĈ[]A\A]A^A_HL 1ɺ HD$ Hƿ1^Ht$ L11 ?댋T$ D$xL ? YH|$8D$}LHKDmIHxy}HL UHt$0I, 1[]Ht$ L?1ɺ D$D$ 7H5=1Ht$ L˵1RHt$ L1+[L H?HD$ H1HHL$ M,$HlM9ufDMmM9IuHtl$(L xHt$ L1ɺ pD$HM,$HhM9uzf.MmM9IuHWtL H{H|$8H{HL SH\$0I 1HXL Z H1D$HM,$HhM9uMmM9IuH藐t;H w$H5H=H|$8zH@8z@AWAVIAUIATIUSH8D$,H@HHHt$HDD$(H@HT$H@PHx蹫HHHD$1L=H HHD$ EfHHL$H9HH9tYL1L L\ B1L~1ɺ L%1H8[]A\A]A^A_@I$HLhH@IT$HB H!HHLHD$LSyH1Lt$I1L HD$0I!E`LZYظLL]H5m- LQHH%L==D$(I>LkL3IFHHCHI^HH;l$vT$,A;T$LHH9T$%IDŽ$H8[]A\A]A^A_fHB(HD$fI$HLhH@fD1ɺLL}m&LH1ɺLL|5L|1ɺ1LfD1ɺLL|1Lj|1ɺH5~1IDŽ$H $H5H=8AWAVAUATUHSHHT$@HL$HLD$PLL$Xt:)D$`)L$p)$)$)$)$)$)$dH%(HD$(1HD$ E13H\$HHT$0D$0IH$ HT$ LjHD$D$ Ht6HB(Lr D$0Ht!H$ HAą51HkAąH}P1LAąHL-~}uL LIo1%Ht$ HAąHtLHAąH}uL LIz1A1HAąA$L,z1ɺd1H5|HD$(dH+%(XHD[]A\A]A^A_fDHEPLH8豁AąHtLlZIH5D|1DD$ 4DLty1ɺ}1LGfDL! 1OH5{Ly1ɺ`1H5{of.Lx1ɺq1LCfDuL1LY ff.AWHAVAUATL%ULSHLH$I9ŸLd$LDE1HEIUMI DHH#BtAFLM9v9v~HEHuLEMLd$IEAHH- LHDIEHp(UHIEHP HHHLIM1L9<$LD1 @t`AILH#EtIGLH#puIEPHHHH9uCH@H9t7LH#PtA@ufHEHIVf.L1/H5XZLH(ʐAUIATUHSHHIHI$HHID$H9u>t@HSI<$HRHPIT$L HPIT$HHID$H9t8I}芠HuL_E1亚H5pHL[]A\A]L 1H5l>H U$H5cwH=twff.fHHIH9LBA@a IML9H1t>uHIHIL;Q@t'HL9tPH1uHIHIL;Q@uLHAHHH9HH@H@L9P@t͐HH9RE1LDH% ff.ATUHHLgPI$Ht Le1ɺVH1E1pfA&1E1ApK8HDL$0DT$$t$ LD$L$DL$0t$ 1DT$$LD$AċL$@4L[ACa L߉L$0DL$$DT$ t$LD$Ztt$L$0DL$$DT$ LD$fEE9EEfHHRHHH9>H5HQHRhH% fDHQADd$ AElDEd$4RAEhEA)A9WH<$)_L IH_PH1ҋHIHtu~ltHHHH)HDL$Hxj3o=lA^IA_1L, H51H;DH裃AEhH-ڏL\c1ɺHLAc1ɺ@rL.c1ɺH5M}HXAET H<$?rAEPkMA I11I9u-t 9tAuTtYωHI9HPHRutt tՋH8MEHPLA+P9AAEttI}XuL MAD$IٹBL H-1Hk(H<$mOAąLa1ɺL1H5E1EEEAmTDT$MeX4DT$ I9_HD$(I9v L1H1Aԅ\$  D9E}pED)H\$(D)9nDпED)LD QHH5k1P1WEUhE)EUh_AX,H $A]HL9HG@MHAPAuhHD$(AuhHA}H$AEHI9 H@@AEH$HH`H$@a:A]PB=Aٺ^L 11H5rcHEA]P@ EL1]8I]XAETvI}XL A}lA]htD)H$Hx`AtSHUHB"uGMLR)օ9މ1҉1؋D$ 9BD$ H4$DHHV`EUhHt H$H'&H<$6HHH4$HVXHFPHjH|$8K膩H|$(AUh틏HHHсHH9t$ 9rAuhHH|$8Hk;tHHCL H5HH`=ADž11{EUhD+\$ 1AL )Ll$HDDM)EUhAETAuTI}XHD$8HDL$@t$HxHjh=A[IA_1LD H51I]XbDDMLl$HAD)˅t1FEUhH<$H-RWjHSILn 1XZHH|fn4fo Ht$(fr f8?frf~9D1A9HD$8HDL$@t$ADHxHjAADgIHD$HDL$@t$ Ht$8Hx$HD/g=hL<$I11H5L ^_9yA HLPIAU=jHLA 1ɋD$PAiL[1ɺF1H5mYmfDH<$UgL IA*ED)L KHH51P1AmhAE)EUhAYA[L<$AuhIPH|$(1ɃIGPHD$(HD$8HLDL$\$HxjeeLIXZ9=.HL[ 1ɋD$PAH51A}Y^uAEHD$@A2DEapTHxX?lEUhD9wHt$(HHHDL$Hxj{d=,$I1ɺL H5K1:AmhAA[A\H$LM9IPBt9uHB HHHLIL9 I tHEѹ[D$L PH-1H|Y^7HEѹcD$L PA111E1H\$81ҾHDLH4HHcHx\$IuX$jb=6AXIAZ1LV 1ɺH5ʃAETsH-1ɺ1L.WHKH-LW1ɺHg$LJ(yHD11HIHAEhIHDL$Hxj!b=ZL I11H5D$$AYAEhAAZHPX=uAWAVIAUATIUHSHH^`dH%(H$1ILH HHL1۾H=L9HDHD$@HD$8HcHALLI9HD L$tC|$HHdPHLPDL$X1H5˳XZH|$81H$dH+%(HĘ[]A\A]A^A_HU1H sLHLW1LT1ɺH5<1xHD$PH|$8HI{YHxOL\IH51@LH51 f.AWAVAUATUSHH $H@H|$HHHt$0dH%(H$HGPH$H|$(HD$L 1HH7HD$hHHD$H91@HH9uHt$HHH9KHD$H9HPHLHH#BL$l .D$lD$`1D$@D$DHD$ D$<D$dLd$Ht$H[HHLhIIH9H H@H@H HD$H$LHH$HxH$2# L$I9Ll$PL|$|Dl$DLt$xH\$XLDd$`5fD=AŋD$x=tX=AHH9tOHCLLD$xD$|Hx@^tыD$|=uD$xD$<=uHD$@H9uDd$`H\$XDl$DLl$PL\$E1MMHfH$Lй>HA1L$HIEh>L$L)$IH)$)$)$)$L$`H$)$)$)$$ILHƄ$DIHDŽ$H$HIDŽ$(DŽ$4DŽ$pH$HDŽ$DŽ$Mt/1LH LHD$IHD$0DDH$HL$PH-DHH DI1H IHD$LH$HD$HLDL$L$XHxj#[M1ɺH$L6 H51H$H5|H$H$AXAYHD$H8NH$HbH|$L]IHHHH9t1@HH9udHD$(H|$LD$dL4iKj1LE1jE11f ^_C LH|$HH9\$ vHH@H-1ɺ61LbNH#H1L DD$dEtXH\$(L$L5 fHI9t7H;HtuM*HHHI9uH|$覴tH|$1/HLR 1'@1LM1ɺH51H$dH+%(H[]A\A]A^A_@1ɺHL DŽ$-DL H5{1T1xDLL1ɺH5I)LL1ɺ}1H EL 1H5f.L1 1H5ѪH-L| 1{HUL$hLd$uIHt$HLHL>6t nu7>yuxD$DrD$|LK D$<Å AHD$0Dx E|$<Il$H5qAHJHD$0H-@ Dl$hE;L$lK Hl$ L|$01H9\$l3HL$H[HHLhHD$(L4MtH5L=JHHHt$ MMH1ɺ1L+ 1LLH n *HIIIM`H9HhLIN`HD$YHD$IUhLHǀ AoAoWAo_ Aog0uƀJu ǀDEu ǀHH ж HLs )}AtAit$<AE~1H-L^ HDt$hErLH1ɺ1HVLCLU IH5I1"[H-1L 1CH/Il$H5nHmDD$`E11D$@HH5H-ʦ:Ht$HL$I$hHBLHFPLNHL1811Ht$|L D$|HL$0DI Ed|$hnA =AP=EHPHD$@Lv 1DH 1AYAZ&DIl$H5mH<D$@D$`H-EHD$0@ D$dL yH-^1H4DT$hHl$ EH\$H1H1LT LKH1HܣOHD$H1ɺHL LHH1HD$L$lHH IHPHt HHHH9_ǁ HH9uH|$جH|$oL@L IH5<1NL@WLIH-1HLLd$\@H5֣IL 1LLHBL@L IH51[H|$HLHrT$lHD$H1ɿHL LHH1H|$m1H|$諝H\$H1H1L{ LKHHL@HD$H1ɺHL LHH1DL$lEH|$H>LETIYHl$ LC1ɺH-fHl$ LC11H?H|$HwLHq1ɺHLaCQLPC1ɺ1HL.C1ɺ1HH1La #e D$h D$`D$@D$dD$DD$<Dl$@HL$0EDI EEA92APLB H-RH1Y^#Dt$DEEuHD$0A@ =EH-11Lv HNHD$0D$|@ D$dIAEt11D3>D|$A<$ AVPH L - PHoLPH1H A<$۴8ԷM{VLܜPHPH!PH1衰H L)21ɺ1H耰뚿$A<$cAUPH L _ PHLVP>HQA<$%AWPHЎL QPLSN蹹L-b8HHQL =LPHZP1AU路|$8H Z;蛶HRL LPHA P1AUjH A<$HPQIٺL]QPH PS1H%H DɰtA<$HPIL RPHPS멋|$误tk|$qH;HH5A<$蜵L H&PHfIHA9ARHDAPLSPhA<$VSL c PHLWPHP2A<$ L G L*ASPH PHhPfAWAVAUATUSH8T$LD$DL$(MHHL$HQ HD$p8HHHHHD$ HL$H9&D$D$,fDHD$\$UpHAH|$\$HGu0wAݸA)9DFDl$fDDT$HE1HjjDjjjQD$HDPjD$pPL$H|$h9HPIHHD$\$E1LpII I9II>ELKAvL$AUPA$oID$HuH-kZ1ɺ1L-HDL-11H'L-1ɺ41HE1L-11HH8D[]A\A]A^A_D$HHIEHHt$IEHL(HD$LpupåHD$HHD$H9D$ HD$HP(HEPHxHGH@H@HHtHAąaA3DHE1HjjjjjQjjD$pPL$H|$hHHPIHH-XL 1H豪@ ED$,D$xH-XL,1ɺ!HnBHH9L H5GX1E1.?HAąL 1H5XLf L+ LS+1ɺ1H5W覩H $H5.H=.2fAU1ҹATUHSHHwHLoPdH%(H$1ILHH5' LGH1LLUt LH5IL^HZLI}HXHVH W$ATfTfDD$H %LT1ɺIH51WH$dH+%(HĘ[]A\A]fH$HxLHHILHLHH) H)։HHHCuLy)1ɺH5ΧrfLL)1ɺ1H5b蟧Cf.LMH1ɺL H5+m$ۉATTOƱfDAVAUATUSHdH%(HD$1H$HHHIIL%)f.H<$ګH[HtaH 1HLLxrHsH<$LHuHJuL*(1ɺH5JnH<$u1HT$dH+%(u^H[]A\A]A^fD1L'1ɺH51L'1ɺH5ΐxAWL=AVL5SAUATIUHSH1HHT$ LD$(L LL$0dH%(H$1VLLHYL^IDHLD$LHt$©H|$@j1SHLH DSLD$(HcDL CDAPLc1SHt$0HKVH5CQLT$PH KARSATQH CAUVAVL5/ LH$Hpt$@E1HL$Ht7H@ Ht.8IL11-H5 L֨ L1E1 f.Hl$PH{bQHڨH$dH+%(HĨD[]A\A]A^A_fDL9  L芣DH ALATL1Lҧ PXZofH@Heu#xxuxuHD$ sxhxHD$(VfDAWAVAUIATIUHSHHXHdH%(HD$H1~QwMHtI@LL'u}DHD$HdH+%(HX[]A\A]A^A_DyHD$HdH+%(HXG1[L ]A\H5ȭA]A^A_fDH{(OIHnH@ fL@˦H{LxLOHHAAYEt$A[It$LyH{LpLIOHLLHbHID$EH{LhLOHLHH.HID$ HI$HID$HL LK,bf.ID$JfH$HNHHDITHTHH)AI)AAA1ƒI<H<D9rتID$fID$ $ECD>BD>ECD>fBD>bfAWAVAUIH5rATUHSHHLyT$dH%(H$1ۦHt!HHT$ HQUHHUHT$HHuL}L5MI11Lӎ LVH{mWIHHH~H6H{HPHHT$MHT$HHHLH:D$Ml$`11LAD$tHxID$hAD$pAD$xk9;IGH@H@HHtLLЅrHCH@@atHHH0HID$X0@L1ɺ1L;H{LE1ZH$dH+%(%HĸL[]A\A]A^A_ËD$IH|?L) H1 H5KHDºE1P1距ZY1ɺLL-蕝UL1ɺ1LsBfD1ɺLLM 1E1L2 H5-K@1ɺLLkff.AVAAUATIUSHHt FdeI9HKP@H= IHhpH@PH5EH8L? HH\AMpHE1E1j1LjjjjQjjj芐HPHHIIHEILHEIH(IDuTH]XLepXI$H߃ 2uHK`HEHHH`HHEx5HUxHHHHH[]A\A]A^LNH1L H5[1]A\A]A^L H-1H1Lk1ɺ$HĚ1\D1Lb H5J蔚[1]A\A]A^f1L 1ɺH5_[1]A\A]A^诎ff.@AVLAUATIUHSHBL9tHHtL9t H;PHUpE1E1jHLjjjjSjjj)HPHHM`HgHL0HPHHH]pH躓AąA[D]A\A]A^DL9HUpE1E1jHLjjjjSjjj脍HPIHHM` HL0HIEHL(L]pHAą'IH@HDHHH9HwHHH91HHHQ$H9u;ddf.LM9MI;UAuPAu$AML$(L< E1 H5 F[D]A\A]A^f.pPp$ND1LZ1ɺ H5E诗[D]A\A]A^L,1ɺ 1H5Ef.ML$(1E1L H5SED蚋f.ATIUHSHHH9uEDHH9t8HxXt1L| W H5DՖ[1]A\fDHI$HHzHH9tfDHhHH9uH1 I#D$`[H E`HI!D$`AD$pEpID$hHEh]AD$pID$hA\ff.fAWIAVAUMATEUSLHHHH$T$HL$L$HD$dH%(HD$81AHHD$0x1A6IIDILP?IL=tI9Hs A6I91LHHHP1H@H HDHHH|$0HuHD$0HHAULL$ t$LD$@$CY^AuHH{$jHDL!1LILX1Z返AHD$8dH+%(cHHD[]A\A]A^A_LHHLT$(L\$ 6rL\$ LT$(AL\$(DLLT$ H{$I9Hj+!Ht$0$$H{IDL =*L IXZL\$(11ASAWL=rL襓LT$0EDY_HpD$L1ɺ@D$L1ɺ L1GDL$DHL=-rj6 AZLA[IL;11A6_f.HH{$DjLLLH$HD$(LH(1蒒_E1AXLT$HH{LL\$$DjLRHt$ $$H{HDLA6$$H{IDLL\$Lg ILL$1UAT衑H 1L L}E1DA AEAD)AI轛ff.fAVE1IDAUH S IATUSHH8dH%(H$1Hl$0H.HIfDH[HHf11HL)D$)$HD$)D$ r*HtžDLL=fHHHE$H$dH+%(H[]A\A]A^I8E1HIH IR B-HusH[HfHf11HL)D$)$HD$)D$ )HtžB31L oH5n蔏,DUH@t/tH5mHL]1ɺH5mMu]AWAVAUIATUSHH5hHHdH%(H$1qH5HA:D;J"AEuAL$1ҹHLՙHD EEt=DI"E=I"5I"Et+Z"tY"AY"!AH$dH+%(HĘD[]A\A]A^A_fDIٹE1Ƅ$LQ H5Dl訍fDI" I"I"tD;L< 1H5kWE1>A@t G Qu9HH贐4HH޿(L1DLAŅtNDLc u k_AAE8SL11H5k_AtqEDL؋)A11L H5jEMOD蓕8̒HL hPHb{ LwPHeH5P1茋H@LA 1H5i\Lx 1H5i38"HL PHLwPHfdH5o P1H T@AWAVAUATUHSHHhH$H$Ht$L$HD$(H$LD$L$LL$ L$HD$L$dH%(HD$X1ƎAEH$AA<$nu A|$a^*BL\$H7=o}Lh}LDM#Ht$H%LT$(H|$0jL x(MLDHHDHHDMARLDHx0PH(SPH(RPH0t$XPH0VHPH(ASPH(AWPH!y ATPHcH y PH$1RH$HĐt$0MLHH~lHl$@Ht H{6HHT$XdH+%(Hh[]A\A]A^A_A|$tfDHt$HH}6HH|$0jHDHL 9'HDMLDH'SPH'RPH'VHPHx'AWPHx ATPHcH w PHT$p1GH$H`fDHI1ATLq H5ēHl$PXZHt H{^5H֌1H5HH|$0jHDMHLDH&RL H&PH&AWPHJw ATPHcH 4w PHT$P1~MLHH$t$pH@Hj%AHI1Lv PAEH5P1ATH 脑@AWIAVIAUATUSHXLfH|$Ht$HHT$@H $D$ H $H|$1LvHHH@sHHt H9 L eHD$(HA ARE)Ӻ9I,H531LR DT$HASD\$HUHL$81jHNLjH|$8PAGTPRHD$XHDL$hHt$HLH0H|$ HH-H<LHEH|$LLPI}0I/HL-8%I$HHHH9LJH' LUL s0HC(ID$P1ɂHC HS0H H-HH-H9}ID$HX[]A\A]A^A_H9^H-[L da@I$IL$HtHHt H9"L cH1QL H5%$ AOdAZA[AGd|$ tN=7Lq H5'-11ÁI$H=xpXxD$ HD$HHL ~_FL r_ATUHHH5lHdH%(HD$1Hp%tI3GH LVM2 x[H3UH tTHHKHUHHIH9@LJHLQ L1Q1ɿ{A $ AXAYDMALMHCI9A$DE1!AA$HD[]A\A]A^A_f.HHKHtHHt H9H\QDMLx 1PL1{AZA $A[HHtH Ht H9/H\P11L̆ RLzA$XYʀ-HHtHHt H9HH\sL1PL; 1wzLMHC^A $@_I9Rf.LJHHKHt HHtH9uGL [HL% 1LQyA$[E1]jf.LJf.HB/HQHBkL I[@fo}ATIUHHrSHz(HBHjBtHB(fHH8uϦCHHA$LHH聊tE 9KXt []A\¬[H]A\@Ht HHtH9u6L _Z1Lф H5x[1]A\@LHf.AUIATUHSHHH8IHt_H@ H@H@H@Ht HCID$LcI} %Ht+f@ID$ HhHL[]A\A]ID$ E1f.AWfAVIHAUATUHSHHH$Ld$0dH%(H$81)D$)D$ ft${LALyvfD?/3HHuCL=Wg D$ 9\$ HLLESMH1軝ZYHﺶ1}H$8x1HT$WH$8LxtS8}}IH OIFHH5%HEHH ! APLcbQP1:vH 9\$ !@1H$8dH+%(HH[]A\A]A^A_D1LB 7H5u18|HL HP*He PH5\1LaAQuH 1ҹH5e L谀H<Ƅ$./f. AUATUSHHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1IL%H-e @$LLHH$D$0HHD$HD$ HD$StHT$dH+%(uH[]A\A]~ff.AWIAVL5~ AUATAUSH(H|$dH%(HD$1HD$tL5 H} LDHD$IL-##Hl$IFHIt:HI!E9fu.MFMt%H AHHIDH|$1Gts1IIHuAMu*HD$dH+%(uyH(D[]A\A]A^A_L 1ɺH5DT$,sDT$DD$L11H5krDT$wl}ff.AWAVAUATUSH8HH|$dH%(HD$(1HD$H9IHE1H}wHmMdLd$I9uI|$H|$uH$HD$ HhH$Ld$H Lt$ L=pH-t!LCHI9txLCH1LLLuH<$H-vL11HqLd1ɺ1HE1qBH$H $H|$H 1H5a znAŅt;H<$AtvHD$(dH+%(H8D[]A\A]A^A_fDH<$?vL11H5q@HD$tH$HD$ H=H-L} 1HpB{fAVAUATIUSHdH%(H$1rzH(HHI fD/H{/gyHHt_}tLHuxD$%=@tH?_AƅuL1ɺ1H5p!DA<$uIL_AƅtaAHtH$dH+%(ucHĠD[]A\A]A^fDHLtxD$A%=@tL1ɺ1H54hoyMLo| 1H5E19oX@AUIATIUHHSHH.vHt]LHtHtH tCLL9s7fDHAT t0 t+L9@ƃ@H@tH1[]A\A]H[]A\A]AWAVAUATUSL$HH $L9uHfdH%(H$B1HH$H)$LMHAվL$HkHHEPLHL1Hh賔{Ht$LsL$!H 1LnLL褮ADž@ Hcrypto_LH9$!AH|$8H|$EkLHߺH k{HLHHE-H5ygH=mL5IHeLXpIHIHpwuI?/uI8/uH$0qxHD$H9$0uHAw1IL1Lz l@ IwH{wY^cHL{IH51E1.lH$BdH+%(HBD[]A\A]A^A_fAH$LHH$1H LmHL%'C=lLH1ɺPLL$1L'y kA[X1H<$1rrH$ljD$sD\$ZD1rD\$H$AlD\$Dl1H<$LULH H yA H4$E1HH$fH)$0HD$AH( AHH 1%1)$@ jA1j jP0H IHH@HHxLPHML$H5Z tL$111At=< =tADNB0D΍BHAuLo$0mH$011yw eH Lv IH51ii6@E1$!UKSMLLEi@ Ѓ ˆ@ rHqe8o$LIHW H,BHDHAPLTSPLL$ 1hD\$(H D2jL5r8no1ɺLPH) LPLL$1ChAYAZ f.HLu IH5|1h@L $LJX L1g?fDHE1-HLPLL$1Lmu sg_AX=LPmL11H5?gL1LYu gf.L $Lt L1fD\$Xfp8m1LPH LPLL$1fXZL.1ɺ1LE1fOL1ɺ{1H5"RfL1ɺ1H5,fƄ$0JpDATUHSHHdH%(HD$1HH$>tfH$Ht HHtH9utL mGHH|1ɿPL% 1LV RLXUeHT$ H HH uHu41HT$dH+%(upH[]A\fLHf.Ht HHtH9u6L FR1^Ls U1L濄eXZLHmoff.fUHSHHHvuH[]f.Ht HHtH9uFHGFH RIoPLBs 11H5mdXZH[]HRfAWAVAUATUSHdH%(H$1?/tS=leH$dH+%(TLr 1ɺH5H1[]A\A]A^A_cIH5^IpIH1HDLHhHtc$<#tIjtH5zL+jtH5LjpH5?[LjYH5XLiBH5Li+AmH5GLi H5n LiH5n LiH5X LmiH5LViH5n L?iH5n L(i1MIHHin LA2T$ t$L8@M1ҹL|$LLd$LqiHLPjA0DL|$L+jggL%?8dI1PHLPH51AXZ"fDH|$1ҹHhHsHD$E1ƀAdt(Am5Aq*A@A-gLt AQ1IAWH51>AZA[fH->8cM1ɺPHL PH51]A]?zfH>8c$MIH&H5AWHDH APQLHE1PH5G1H RfH8>8Ac1IPH]H5 PLh1Y^AƄ$fAWAVAUIATMUHSLHxDyT$4$DdH%(HD$h1D$8A VH HcH>DAED$<L58DD$(D$<A1AEhHT$A1A}4EE@1Ep1@Ip1E@ƍp1E@ƍp1E@ƍp1A @ƍpDtIArAHT$EL5iCEM0AH RAtDHH HHH$EL1Hj 8D$D$L < 1LL D$<1<uHD$HD$(H|$D$(tL ڤ LLq ;H|$_A Au 6%HcD$ ILt$MI8L謟 I@H H|$[D$Z 腟 ELL1H$LL$ZH]e L5<zL1ɺ 1L5t$<$LLL$L5<菟$L`1ɺ bIHuIIIH5 H MLr M[ IRHc WLP1VH$'zH 1ɺ LH5;15AsfD5z"D$<bIUh\"DQ"=G"D$E1Au` I}pAE1D=AƉЉUUUU%UUUUȉ%33333333%ȉ%AHA E6IuXHH|$ZL$(= L$(D\$Ic1HL$ZDD$(H$HH)LaxDD$(ADD$-L1ɺ H$1LLHqL1ɺ DE1A@Ɖt$LfDD$ZQfDEM0EDT$L/b 11 Lh,E}DT$L1ɺ @L521L1,@AELLPb HD$PD$PH+tLLe 1AXE1ZGfL52Lu1ɺ L+LY1ɺN f.L5T2L51ɺ L}+L1ɺB 1ɺ LLN+L1ɺ 1L0+L1ɺ9 DE1xL MHHoIuXHH|$ZL$({L$(HD\$1ɺ GL+1ɺ 4H$IcIHIP I<H)15dL1ɺ] AA-H$IcIHN I<H)1cL1ɺ AAH3L~1ɺP zHcD$H$HL H)I<1cWDD$ADD$ 1L^H$IcDD$HF I<H)1[\DD$ADD$<L1ɺ L1ɺ 1L0HF 1[ADž#L1ɺ H>F 1[ADžL1ɺ H$IcHE I<H)1[zAIEhuIH\$Hl$1ɺL L1Lt-HcD$H$H\E H)I<1-[D$D$ 1RM}LH H;kH HCIE1H8LT$PHAHL HEHH9H@HIٹ5PL < H5|1#A]A^1H=> *IHH{Ml$LcL2 I$H1DkID$H$(=H5ɷID$(1AD$ 0N$)IHHL1 McAD$ I$HBID$H1 H5wID$(141Ҿ'HN$Dc}Mc03)IH H0AF IHtIFH{IF((HH v0(H 1҈D I^qH5ZAL; A 1D AA\$AA=1Ҿ)HN4RLc0@(IHHDkAD$ I$HL> DID$Hk H5ID$(10N$L'IHH3M|$XMcI$HVH5[ID$HyL/ ID$(1AD$ 21Ҿ+HN$Dc{1Ҿ-HdA\$HcHHhIH HCILLILILHH0ID&IHxHMuLo/ IEHbH5IEHyIEH./ IE(1AE 61Ҿ3H-u-1Ҿ4HhH&IHmL0HXLhMtIVAvLpL(.H[0@H@H@ I$%HHHRLcL; HHH5HCHHCHRHC(1C HHT$XdH+%(pHh[]A\A]A^A_fL6 H5!1f.1>f0l L$IHHMuMcIEHQL- IEHH5IE(1AE N,Dc0$HHHdEl$McC H~HHCHvL8 HC(H5'1HCJEx@= L HLDL _LMHp1Lx[#L HI2HqAF IHIFH+QIF(IF0A A0Etl AV0A2IFMc1L + cH5N4DcMcqL4 13H5oL-UHcùLHL4 1*ILctKLd$HHHPI9uL1ɺ&1L1=i 0!IH\H1HcAE L * IEH4WIEHItH5IE(1XL,A\$(L51ɺ>1I$LLL1L 7 M4$MtIVAvLLLL6 1ɺ71H5,LAU91McLR3 H5®JLP3 L-1ILO.f.;1Lr4 IH5L-L1Ln4 JLcDAHLILAHLDHN1McL0( H5JL4 DL-Lc1 LC@L-Li1 LL2 1ɺO1H5jJJL2 1ɺI1H5rLcJB EAV0CT8BT8ECT8fBT81L3 H5QwLm2 1LcNH5'JV1L$3 H5OLL-W1ɺ 1LlLA\$Lc1tLy2 H5:IcH1L & H5kIcHHY1L0 H5"91IJA\$L-L0 LLcc1LL0 H5LL1 1INH51L1 H5ff.fAVIAUIATUSHGHOH@0HWXHHHQ`H H$HQ`HtHHAą'HLAąAMtOL9tHLAą3HCHK0H{IM`I@Hg`A[D]A\A]A^H0HHQ`'AFfJHCHh`>;DHFPHcE1L1 H5LqH1XDZ[]A\A]A^Ð1L1ɺH5[D]A\A]A^Ll1ɺ}1H5e#f.LkhAQ@L$1ɺ1H5wfSfH1HH@dH%(HD$81H)D$H|$1)$)D$ Ht5H@ Ht,8tC1IL1ɺ-H5 1HT$8dH+%(uH@[fDH@1Ҁ8HDD@SAIA AHHAAHA 1RH;hK5AXZEx [f.I1L0 1ɺH5p<1[ATUHSHdH%(H$1IL>.D$%=@tV=`t/H$dH+%(\HĠ[]A\Ht$(H%fLHUxqD$%=HH9$u yHp+iILD/ H5 1 5@8I1PHuDL3PH51 X1ZfD8I1ɺyPH8 LPH5{1 L1DILT. ;fAUf1ҾATUS1H8dH%(HD$(1I)$LdHk L-ٻ1t$FALt$Lr. 1U HT$ H H9wPHD$H9tFHD$A1ɺUHD$Lr. LPP1 HT$ L1ZYx_HD$(dH+%(H8[]A\A]HA1ɋL- BH5P10 LAك8t+L\. 1ɺ]1L rfL- 1ɺ[1L GIfATUSHH dH%(HD$1IHH-HMD$H$ExD$ HD$HtTH11H4D$I\$AD$AD$HD$I$HtC HD$dH+%(u;H L[]A\ùL{- OH5 LE1KI1L H5 AWAVAUATUSHH $HH $HhHt$HH5H=-HT$dH%(H$X!1D$LHD$hD$PD$\D$`HIH-11L? HH$HD$pL=!HD$xIhints_veHDŽ$HDŽ$D$$HD$LL HH|$1A?#HtҾ L\HtM97Hglobal_fI9PA?filtKHscan_lvsI9Hdevices_I9EHdevs_hasI9A?scanN=!:AHT$pLD$(^nH$HL$pLD$xL$HD$(Ht0HϺLD$8H5 HL$0 HL$0LD$8:Mt&LǺLD$0H5 LD$0GH|$(Hth1HL$`HT$\H5 uKT$\D$`HHH HH!H H H HH!H H$Mt6L Hv(A}-t!1IuH$ HH HD$(Ht$HǹHAUD$hL [HPD$lPH$@!P1L$%HD$8H LT$(H8HL$D$$HAI IBLLQU@=!iltef=!r:HT$h!HLl$hMtH5!L.vL) 1ɺ1HyLq HD$LET$$AdHD$U1nIHD$AϦL$@LH PIHQt&HHH9u HH9tL;xuLHtIHL9Hp1ҹLHuƄ$L DLD$AT@IGHIVH@8H9M6L9t$Ld$HD$L9E1fDM$$AL9uL 1ɺ1HAH$X!dH+%(ZHh!D[]A\A]A^A_@=!rsioUf=!n:F1HL$XHT$TH5 H=e!DL$TAH1ɿjL' HjD$pP10HD$0LH  1ɺaHDL 1f=!er=!:HT$h HLl$hMtH5!L) qL& 1ɺfD=Y!:S1HT$dH5 ;D$dH=7!u;D$dL& 1ɺ1HHD$f=!h:1HL$PHT$LH5'H=!B2L& 1ɺ0fH5Y @ID$Hth I<$LDL$LEt E9HD$L 2L9HLd$MHIMnI9t(M@I(HtL M?L9uML& 1ɺ1HAHD$f=!file=!:1ҾHTItuHtpL i!HL H1H1AU&L 8!L% ?HD$ Y^E1EDL|=!.o1L !1ɺ!L$ HHD$lHL$ 1ɺD$PAUD$hP1HAHD$0H ML$ 1ɺAU %AсAL% AQ1P % кPtHq1ҹLD$0H$K LD$0HƄ$ Y1Ip!H$(! HƄ$H!+HLg" 1HD$`PDL$d1HD$ _AXE1yƄ$'!LE1 % 1ɺaHDL 1-HAWAVAUATUSHH $HH $H8H H7LF8EA dH%(H$(!1AAHAL$ A HA1La$LHHE1L--H Hx.L@uAxtހx.uA@.9u AxtL$ 1HhLL#xH$L3uH$H;z dH⹁  _?1<$LVM-HA0 H0Hu41EH$(!dH+%(H8![]A\A]A^A_84M1PHP6Lc~PH5v^1XZHEHt7H9t2LH1L(.]H5<^1WL i 21?ff.AUfATUSH8L- dH%(HD$(1D$ )$)D$HMooWHHH) $)T$GHD`DDHL8HHH@HHtHPhHtH9uHT$(dH+%(u}H8[]A\A]ÐHHtPH9tKHHHHtOH9tJLHU1L QH5@XZfD1@H ! L  f.AWAVIιAUATUHSHH|$H|$0H$Ht$L$LD$(LL$dH%(H$1H|$ HMtIHt L9H HIL-~@PL L1AZ1A[HIH.ID$hI9(HtHHt H9H MtIHt L9UL UL @LR 1H fAƆAAo]AoeH- AAXAYH9HfDHH9L;puMtIHt L9L A 1@ LLS qME1C}9HMHUHH3H3H HH H9LJU@1VL L ID$X^_HL$H@H9H@HQHH(ID$hHr(HL I VL LQ11zM|$XZYILHP L^H|$ID$XHL` D$DH@XHMHUH3NH3VH IT$XHRH9T$HL$HRHIHq(HJ(HH+H9"LJ fIHdMt$HxHX I$ID$L L%E MAE1H$dH+%(HĸL[]A\A]A^A_fDD$HL5 !HDxDDHLHID$hHHt L;b7fF HFID$hoMoULHLPBZHD$`HD$HD$0Ht ;HT$ H|$LWD$H;H=$ HPID$hƀI|$XLE1LHHR|HHVH3MH3UH HNHVH3MH3UH !fDHHt$(Ht$(LPID$hL5g H1IHH|$IHPLIHHD$(MwLIGHD$Mt$hMt$ H@ID$`Mg M|$XMd$M$$ѽI|$ Ht*L?L9t"HGIGL8LM?L9uI|$0Mt$(Mt$ Mt$0Ht'L?L9t@HGIGL8hLM?L9uMt$8Mt$0D$&fDo+osl$8t$HI LL f.LHVL Lgt1ɺ 1LLJt1ɺ 1LE1?L%t1LE1 {IL L1 KILHP L6sLs1ɺ 1Ljf.H H!H H H H H Hx Hy Hj H Ht9~H Ht#}yHHo H@1HfAWLw @1AV< AUIATUSHt$ H58vH=$ HtH L% M1DIT$ L4MuAnfDHUhHEPƂL}XILHR LHMt/LM6HjHUH9tHMHJHHmHmA;\$rH=K H; H=D HtH/ H- L% H]L9t|HEH}HHCHHHHHHHL9uL9t$L 1T H5tH=E H^ H-7 HX HI HH9tHGHCHPHHH9uH= H H- H H HH9t%f.HGHCHHHH9uH H H D$ uH[]A\A]A^A_tiI]xImxH9tL%@@HS81IMHL$uLp1ɺc H5snHH9uH[]A\A]A^A_Lo1ɺ_ H5]s8sAVIAUATUSHI~LI1HI1E1IdžH)HfD<_tAALDH9s AD-t։ڍKAt͐[L]A\A]A^[]A\A]A^SHHH{HI1HHHǃH)HAtJ11'fD΃31t,BHAt<_uۃt#vэBHAuƃL[fȃ_[AWAVAUATUHSHdH%(H$HH9L5$ AHtLpDE@ExnEDE`ut?AEDH$dH+%(:HĨD[]A\A]A^A_HEDJAąw= E`@F DADLDD1DE@LE`EDƒH@D‰ƒU` EumH MH5 H HDL HDH H HEHVH5yLQP1 U`H AU`LO8Lh H5;LDAA % Ѓ= 9HA1P1E1AYAZQ@ E`AA@Ll1ɺN1H5KWf INjE`A?s@twAE+H1H5KMPL+ ~1Y^M`E1ML 11UH58KDL1E@fe`ML1xH5JrD}@HxHE8H9D$(M1L-JLm L HhAąE1DHMPL 1H5@JXZDAALE`D1E@ywE`RD1MGL* H5IaEDQfU`Li1ɺ1L#Mm1LcH5cIVmff.fH It  tALU1H53~ &HDL 1H5 RAWfAVAUATUSHdH%(H$1 )D$P)D$@D$P)D$`u3AH$dH+%(HĸD[]A\A]A^A_ÐD- HEIHL5Oh;cLILO1 H|u EcRHe! DEt1HT$@HL"SH5L+YHEPHH8胓HHfHT$pHHǹ)D$p)$)$y ADžH;6EdAH=x4 t6HL$HE1E1j1HLjj~H t D$HaL LI 1/-f.HHtHH9t @3 @HL$HE1E1j1HLjjH DT$Ep@LHI9HD$HD$D ! IwEuPLf1ɺ 1LAUSLe1ɺ L1E10.HE1E11jLjjHL$(H tDD$E M?I9_Ec@=r 2LVe1ɺ 1LADH(`LB1ɺ IH5e1tlEcLd1ɺ 1LCfD11Ld+H5eLd11LH;rGDEc@1HHH\$LxH9l1fDIpIGxLxH9D$u݅9H_HLL SI1 MA[Lc[1ɺ L1-+Lc1ɺ1LE1UHP^ADž9Hm^LLI 1DL1ɺ9 1L HD$hdH+%(HxD[]A\A]A^A_f.LH- HD$`i1ɺ LIL1տHHAF0AE8E0AF4E4DžtE(MIE|HD$HL9H\$(ALt$PAD$@HXIHHDLSLD$(DHHD$ _H|$ D$XZD$H\$(1ɺ LL =\ L<11 L> H6L<1ɺB 1L H|$ 莁D$XR1ɺH LL< IvHTA{EEtE(E|HkHfD LHXf.MNLL1; WHD$ Ht$`HD$`/MNL(HD$ HǀH|$ Wu"HHtH1AąOADy]I1LL Ho l$@H\$(L1L > M$$L;d$HHD$PDh4Dp08E^ELEV E?Ht$81ɺ$L #1ɺf LLo:ƚ H|$ <D$XD$XCLH- eLLI[ 1H|$ ~D$Xu1ɺ] LL9F LH-7 reL#LI 1Lt$PH\$(ADžZHuXAdžH˽IvHJD$\-MNLcL IvH AŅt5AF$u-LL%a d1ɺ LIL1AHD$`LHD$L9AdžL% MAL,dHH=XWE1LP Lt$ 1AH AdžH裼E_DDžAdžHnL81ɺ5 1H5 G E0AE8E4l1ɺh LL7 AdžL% MLLL$ cHLH=qWL WP1t$ LL$0AAH LL% bLkLI 1AAdžH|$ yL611 H5- hAdžLUbHH=$H\$(L1L ߖ ~eDSF4LHHHPDN01 =AXZA [C4HLKLAPC0H5P1sP 1H [AWAAVAUMATUHSHHt$Lt$#HLdH%(H$1$uXAL511 H5˕ H$dH+%(fHD[]A\A]A^A_HLd$0HLH41S IHt5Dx0L@8D$LD$A@4 LD$L$Ht$LG{HHt!HtHHpQHEЀH5FDHH&LHDHA LQILRH\PPHP1BH01ɺ L3xvHLHH)H|DDHAPPPPP1H0L31ɺ H51A ML1E1 H5F H HDHLLHHEȀHDIHQA LPPHP1H 1ɺ L2#fHD$L4LKM9H 1AVLH5l XZLsI@HgHxLpHVH52LD$LD$8L\Mp*ٺfAWAVAUATIUHSHHXH0D|dH%(HD$H1Lt$;D$tD$ xD$pLD$uNALg111u H5o HD$HdH+%(lHXD[]A\A]A^A_LD$.H8LLD$LD$A|HPL ;xDtH=2ADpHDLDȅLHDH5HDEHDEL)IEHAQDhWHVLRHP1E|$8|$<|$@|$DP1`pH@L 01ɺz 1H5(A\ L/1ɺx 1H5. 贸@AWAVLw AUATUSH8L dH%(HD$(1M9EIHIH˺df.HHL$HH $H $*Hc;L1HGH)Lp1M?1҉M9EIwvLD$T$ LL$L$T$ Hc;HNLH -VMOHHEH)1LyL.1ɺ H51 A@fHc;L1HdH)L6LZ.1ɺ fDAHD$(dH+%(uzH8D[]A\A]A^A_É$1ɺ L .H5] D $L-1ɺ F$1ɺ L-H5! D $v裶AWAVAUATUHSHHw40dH%(H$1kHLhL5Í IMM}MH5.L;M}L-C11LMLA1HL]eLMH$E1PAƀ@HEL41RLjP1 H EAH$H8֯H$ɯoL= fHL-ZWHLAWI1LALkXZL,1ɺ1LE1H H$dH+%(HD[]A\A]A^A_@HEL11RLjP1 H Et:H]H Gu4}0HD1kAąEH@H ,u4}0HD1kAąL+1ɺ1LT yH$E1PAfDL-ܑ1ɺ1L*L fDE11ɺLL}*Ԋ L̮^L\*1ɺ1L (AUATUS1H(dH%(HD$1D$f\$u/AHD$dH+%( H(D[]A\A]H.tHt$ &/AąDDl$ Et)11 DݯeDl$ D/AąHL%,A1AUL L Y^H\$fDK8HDxD"1Af.L(1ɺ 1H5, fHAL1U H5+ _DAX0x+hH ˭LAPL 1UE1XDZZ0,DKHt E18zELP H5D+1UAYAZưfDAWAVAUATL%؎UH-GS1HH|$Ht$dH%(H$1HGHHD$DHtYHH;\$FH LkM0EUI}EtJHuH11L='EL HuHD$H@HH;D$M HfHHt$$UfIEIUHIMHHpH9MHf.H;p6HH9uH9%1HH9u Ht$LD$41ɺNLd&H5u H$dH+%( D$4H[]A\A]A^A_D$411AD$01fDHt=HH9\$H~LcMtuAD$hD9t)D9DM9OHuHD$H@HH9D$tHH뼐EL$I|$EtYH L%1ɺ^1H5օ i1ۋD$0u  AA8Ht$$H=;ET"H'EHD$ E1I$ D|$,I@MM6L;t$MMnMt{M9tEEIuEtEHI$H謭uLILD|$,HtDD$0~fDH5}DHD$LpHL;t$sLM$D|$,H1ɺAD$pLXH5CfD$4I$HD$@AD$4AUPAD$0P1LL$@_ H IHH|$ /VH=Ht$ HPL̵LL$ LH5 LAD$4HA$LtPAD$0H5kP1LL$@ D$TH LYLA~EtI$IDŽ$ID$AD$A L$$HAT$4At$0ML$E$A$I|$PAD$pPI$HP]H 2Dt$4EA$E$ElHD$Ht$\D$\H$AEu"LC"1ɺ 1H5K HD$D$4E1HǀMt;MmL9l$t@Mt;MeMt2E$EADŽ$MuHD$LhHL9l$uT$4L!1ɺ1H5 uDHt$$9PYID$HD$ H0LJ!1ɺf1H5R L!1ɺ1H5$^ fED$I|$Et1Hu3L 1ɺ1H5 DH=@Ht$$jOI$Mt$AT$4At$0I|$MD\#AD$4ML$L[ PAD$0PH5O1 Y^D$4o /LD$@iHlM1L.H5)#( L1ɺ!1H5̆ Lfzo Ht$ LLL- KL IH5a1AD$4'LL$ LL1H5$^ ufEl$D$4EUE\$ EGHt$$L5lD$4$L1ɺH5~ |LHH3A}L1H5!~ rAD$HME$A$AT$4At$0I|$PA$PI$HPTXH AD$4ML$L(+PAD$0PD$41|$@,L$@I~XLڥIFXHHt$8AF|LAdžT$,H1&L衡M1LiH5u t} GHkLT$`DL$@ALLH5ڢLT$H/LT$H1|$@AR'H9L \LsLDH51LT$HAU| XZLl$@H5LHD$HHT$HHJH1H-AUL *HLb| ^L_1ɺH1d| 7M"1LH587| M/LH5 | 蔤@UHSH/HHHt^1ҹHHHtH[]ƅI1 L{H5{ H1[]1IH | HHt@yf.AVAUAATIU1SHutH;@u[]A\A]A^I$L3Et.讞HfL3EtHHBDp tID9u[]A\A]A^ff.AUIATIHUSHH豝HH}H蝝LHlHmFIH;HUPH9HDHHSL LLPPH1AU轤H HL[]A\A]HLH9HEIHt HDS1IAUE1LH5Xy XZff.AUIATAUSHHdH%(HD$81HtYHHH[HtAHf11LH)D$)$HD$)D$ &1HtHP tNH1MATL?1ɿH5ρx XDZHT$8dH+%(uJHH[]A\A]HD$8dH+%(u,HzHHD[]A\A]:AE9HD$(LhLvDE1HDHLH;Pu90LHuD\$ L$HT$蝊L$D\$ HT$DDDD؃D9vEGHD$(HHD$(H9i @HEL#HD$MeL9 A/t[Ml$AL踋H AD9r7DHLH;Pu0LHt$HT$HT$uDM$$L9ufHEHD$MAED$(jHD$HD$ fDHl$ H9RDt$IMMfHmH9+L}LL9uA6LHt$L/u˃D$D$;D$(vL?~H9C HH9uHH9HP:uL9u@M$$L9ID$8ux{IF8k`HD$(H@8K1M9MT+ATUSH1HPdH%(HD$H1HHĆx0Ld$HL耐HtLH+ HDu HD$HdH+%(uIHP[]A\@HT$ )HHcH<HcHiMb1H&)HҴy蟎ff.@AWAVIAUATIUSH(Ht$HItHźIFI9rDHH9t<( tHIL$E1E11HL$1Yf.x?T$ #T$ IHMAD@@t "t_ DHD$AB AGIH9s,At#AL;d$sEu uAGE1IH9rH([]A\A]A^A_fDAWIHAVIAUATIUDSHHLD$PH8I:HHL$fIWL IELpHHH@H@0@ HIUAE H9u HH9tHPL;"uAE LiH;HCH|$PI]IEL(LktHt$PL.H[]A\A]A^A_L<H5D-L܆11LZH5-趁1 vff.fATUS?/Ht0I}L<[H5Z]1A\%Tc @HIeHپL|/L "L'MDHHxLE1x []A\DIٹL{AWAVAUATUSHhLT$L$LL$dH%(HD$X1HHD$I9IELt$ IHLt$(DLt$ @ucAąuWLL\IH51HHD$XdH+%(u HhD[]A\A]A^A_f1ɉHLqOAąVIEAuLHH ub@IPD$0裲AąLD1ɺ1H5Jf1AtLHm(IUHHB HHHLIULcS\DHEH'r 5&H|$0HH 3HDH1誥Lf1ɺIP蛱Aą1LkAąIEH@@ -D$HE 'D$A;ELLIH9T$DHJAAtDJLH PDd$L<1LL?E)}HL$E1DLM$v^L_AD$AELHMHH'u  AE$1ADžAuLAAEPIGPHHHˆH9ufDH@H9@tIE@L1L{AąHM|$\H'r f.LHm(dIUHHB HHHLIULzS@AH@IED$1L1LA1Aą?L$HEtHtL蜴Aą,1LAąd1LZAąHEA@1ɺHL mApL<1ɺ1H5{Bf.LP1/AH51V{IE1LH5j1E1*{DLHm(IUHHB HHHLIULBSH51E1zAXAYrf.LȹAą L)1ɺ1H5|z/AE8LJ(kLJ(H5L!D$LHIEHP HHHLIHSL/kf.L\1ɺ1H5ybf.LHm($IUHHB HhHH\LIULS{@L z1 LLC)yLRL FAL1ɺ1LοxIGPHHHˆH9tfDHHBH@H9uLM1/AH5.}xIE1L"fHT$L1LAą#L1ɺ1H5]"xDLJ(LJ(SL1ɺ1H5wfHELL1ɺ1LֿwVfDL IUHHB HtfHHt^LIH1SLhH5}GwXZL1ɺ1H5ZwLJ(LH(L1ɺ 1H5%vLq1ɺ1H5vw:f.AWAVAUATUSHhLH$T$DD$HD$dH%(HD$X1HHD$I9ID$L|$@AL|$HH$L|$@A9H$HVHHHEH@HtA@E9L$LXt.A|$LAEDD$DHHEH}P}1HbCID$H@H'DH$@t C@xD$EuA$$EuEt$8A$D$ AD$$D$$ID$H@@u :HEPHHHˆH9u;H@H9+@tI$ID$AD$LHRJpAL$$MpAL$PADŽ$ADŽ$A9HHH9T$HrFtJLHE麢PHgA)L,Hƹ HD$81tHL$E1HE1D$l_AX[H$H@H's1LH H}PL 1L5$Ht$(1sD $+Lٯ1GH5TsE1ɐHD$XdH+%(/ HhD[]A\A]A^A_f.E1ɩAAE9L$L c$L1ɺwH51rD $fDHLk(TIT$HHB HtsHHtkLIeH$H[(H@ HHHD $LD $SWPLH51LrA\E1A]LJ(AUiLSH5R1r[]E1HLk(IT$HHB HtKHHtCLIAU_L0SD$LI1ɺsf.LJ(f.L1L9d$LDH$@@`HCL$A$@t9A|$Lt1LiH5H"HCfD eHH9D$$L$ HXDp8|$$xPx$}pH@HWIT$IHB HHHLIH1 AUL-LYLqpX1Z11LHuC@t0A|$Lt(1H._1HO@ADHLk(IT$HHB H?HH3LIAUdLSfAD$L2fDL-1 LL;o1LHOED$LETM$M$ 1IEH``IAH``=I|5I11Hg`H``A$tHO`HD9ufDH$H@(iHPx$LQ1ɺfLJ(H( ~LIHLֿPHL_P1^nAZA[1HL$HLpHI!H@H@fDH L8LI1L֞mHT$11H蝆Lj$LW1Lֺ1mD $UDLB1/AH5#vmL1ID$H51Lm4$L1ɺz;f.LJ(yHEPHLHI9ufMRL9twABtHHCHE;l$LILJ1ɺ1H5lHt$(1zlE1"fLA1/AH5"FlL1ɺ11LHXH$H@4@T$1LHL]t$Lm1ɺfD$LQ1ɺ L1kD $OH[(H#HLSIMHLT$ LIH~HHD$(19kAD$LHL$8LHT$0paLT$gLT$HH9D$7H4$|$ Dp8Hp$|$$xPx$}pH:Al$L1HHt$ \\Ll$0H5I}HqH5HLT$8IzHL$qHL$HHS(LT$Ij`"Im`!AD$LH$H LHT$I1RHt$8jAD$LLpt$Y^&ME`4$1LLIME`aLT$LtGAD$LLL$Dh[&L$1DLMB`LIMB`aL$ LHt$(LWI1QiHt$(11L2iD$L1ɺ[L1ɺ1LֿhE1$Lv1ɺE$L`1ɺ $LJ1ɺHt$(L21ɺhvH\$(11L HghL11H޿Jh2Ht$(L1ɺ(h$L1ɺVrMH^HmL \VLLH5\AH Ћ3HnHH‹7 PWH=505"H8AWfAE1AVL5'AUIATIUSHHH(HL$L$ HDD$ LdH%(H$ 1)L$8HD$HHfD$fDOIѺAPLVLSH 1ҾH pG1H$LŹlqHnLn>IL1L21]H l$0H|$P1H1H5t$Ht$Ht$HIH$D|$pL$HD$(H E L\$H1IAW6LL3G AZA[gE1L\$AE1E1^Ƅ$ ML1L(E1G :gE1AŅHD$E1E1E1L\$HNG LT$o8MlHL PHPLPH>L9QP1L\$8LT$0H MtI{LT$sH|$iLT$LiD$0Dl$@D|$DHD$@foT$0ID$A$H$dH+%(H(L[]A\A]A^A_f;nHdF D8DikA}MLIHH=H HDH#E1APLCPQP1E1H -IL f1Ll$pL1L\$ L)$)\$pH$)$L\$ L HH@ H8t5L-dNL\$11L>]-LkE L\$hH@8OFxK5ML%RFt$ P1SYD$xt$pHHDŽ$H0HT$xEt$HH虣M1ɺWLH54oYEHHD$PH@@Hfx.H5ΊHW`IHL-6!1LHAAT tt HH=u LaHtL 5!1ɺb1LH54XH5KL_HHth1LHAT tt HH=u LeaHtL 65!1ɺi1L'H535XH|$0t"D$LD`Ht$0H`Dd$LH]HD,$HH ADEDEDH;D$ f.DL$DEuQHD$0HtHfH|$0cuZH$dH+%(9H[]A\A]A^A_LV1ɺ1H52DWHD$0.L1ɺ1H5o2W1ɿ1LH5G2VH|$0VbPL)H‰ȻHL$@HH9<uLN *HD$xHHx H$H$H3$H3$H u)H$H$H3$H3$H D$DML̕11YH5V1UH11AWLH5%1UXZHD$(L1ɺ6H51M 1UmHLHLL$`cLL$`HL$0H=ubCH$H9$-1h_H$dH+%(uHIك1[LV]A\H5R0A]A^A_TAVAUATUHSHFH󀸨HuH WHHt H9*L [6 H1VQL- 1L\LTHsXZHXIHwH@PHt%LpHMtH5jLW CTAT$|HCHtHHt H9L 5 1LLiSHHCHHBHHYHH HCHHH[]A\A]A^@LJHHtH9uCL 5 LL11ZGSHsfDLJ8LHfCT wH{HHjL]Zf.HCHt_HHtWH9tRLJ11Lo_LRCT[]A\A]A^fDu cL !4 CFfDAVAUATUSIՉHIHcAH>I]IE1f.HS3LHAH9uLV[D]A\A]A^fHGHt H L[D]A\A]A^fHGIuHtH IUAuL=LD`V[D]A\A]A^DIUAuLAXV[D]A\A]A^@EeEUE11ۉLHIDHP0AA;]r&@EeEE11ۉLHIDHP0AA;]r@EeEE11ۉLHIHP0GAA;]rE1AWAVAUATUHSH6H9IH͘HcH>LuA$E|EA/@H[]A\A]A^A_@A$LmHHAttHIT$It\ A$HATuA]SAU0wHLD$ND$@LmLIuE]ESIUELD$HUXTD$3fDLmHL)EMA9AFK1DHH93A\A8tfLuAA$1H9AA8T6uHMnIT$L5DHELExAD9?A[LuAIA$1 HH93AA8T6uHMnIT$LtiDHFD2EAD9pAHLD$KD$DLA9LHGKuGH1[]A\A]A^A_fDHULD$RLD$AEnfEUESELD$`RD$;fDAIIT$HHeDHB2A$IAD0IV /w A8s HH9uADH߈D$LAPAHL KD$I~DD$JLADL7LAD$[LD$^QED$2I~DD$KADLKAD$AWIAVIAUATIUSH_HHGIAnHtHX;(rv^HXHHuM,I(HthfH@ @(HM9u;L` H[]A\A]A^A_HXH@HtpfDIHXAnfHH11[L]XA\H5FA]A^A_%, fAWEAVIAUIATUHDSHHg.DHAY.A9wfHSEHDSAHD9tH;uD9w2@HUEHDUHD9t)}u1H[]A\A]A^A_uADEu,֐EtHEHSEHDSHDEHHAtu'EuEH{HuHE{HEu-u uuIImfff.@ATUSLgHHO I9A$Il$<^&<#~*P܀:w"H53HcH>fD<|H{C1HkHHJA $Hs []A\H9L׉1H5<2* C[]A\DHkC[]A\Ho1GHHHJHCH[]A\HHHA|$^1I1LS L9z1ҿfAD!IiL9[M]\-AIAHHKuD HoGHHH>IHC`[]A\Ho1GHHHIHCH[]A\ULMrtn}AAHFLMM9|M8|ЉʉLCI,A EAD#]AEÃE8}DA A I-A A  I9HCHkID$G1HGHHHGAL$rtFtt!nt,Hs 2HCH"HCHHCH @Il$9GHC`O[Lw]H5.1A\%' ff.AUIATIUHSHH?lHtwf@Hþ1fCH}BL)HHtJ1LH(H߾kxTLeIm I]H[]A\A]L1H5hd& H1[]A\A]fDM1LʅH5-d& H1[]A\A]AUI ATLcUHSHH?\HtwHH@@ H}4L{HHtL1DHH߾ jxVLeIm I]H[]A\A]fL11H5Xc% H1[]A\A]fDE1LH5c% H1[]A\A]AUI ATAUHSHH?LHtwHH@H}(LτHHtP1DH{H߾ ixZDHEIm I]H[]A\A]L1H5Hb$ H1[]A\A]fDE1LjH5 bp$ H1[]A\A]AUI ATLcUHSHH?uP$%HCHL|I1AVL1d _AXT'BHP 8Y?$ MIHHHDHH 4pAPH5L/$QP1H 2{Bff.ATAUSHH=!dH%(HD$1H$z!JHH=I HIHDH<HL%V1It$LLC|8 XZH<$}A@H- 8">;HH HDHIPHoiLPL#1RH|$ H a:HD$dH+%(ZH[]A\L%1L{Lx H<$@H<$9@"!;!fD11>HH HH?H L%8=LihLI1A?H- L%ú8_IL\fL1B fDI1LvH5YX $L=8"IL{x1L-1  H :$HIIHX H HDH)APLQPL1H L% 9LIPLe51SAԋ|$@X1Z1uAPL/QPD<AWAVAUATUHSHH8D$pLl$xT$L$D$$$DD$D$($DL$ D$,$D$$D$6LI6LHD$ r t L=0 L%z0 M7M9DfDH|$HR4IHXLxPD$HAD$ D$AD$$D$AD$(D$ AD$,D$$AD$0D$(AD$4D$,AD$8D$AD$LDD$AD$H5HLLpL>M|$LM5LLHP>H M|$@H=/ H/ LH=#cI$H/ ID$L L%t/ H8[]A\A]A^A_ }fIwH:\IMM9IAuѐwL=/ L% / M7M9IwLa:t'DIMM9qIwLI::uLH=Nbg|AGILH ,IGHBHr4먋   L=q. L%j. M7M9uDIMM9IIwH9uLH=a{AGILH 6 ,IGHBH3H     DLH=ha{AWH L,IIGHBH3?L$1DED$L$D$"H8Ls1[!]A\H5A]A^A_% ff.HHHtIHH֋HPLQRM  > DH1i:H@SHdH%(HD$1t_,fuHD$dH+%(H[tHt$M Zu&L1ɺ H5"& @t$%uH AٹSLrH5 XZZj7f.AUATIUx5L-zA1ɿ1LLr O.u]LA\A]1fDC6H-l 8u3HLPH$_PHL _PL[1LH ]A\A]+1ff.AWIIAVIAUATUSH8dH%(HD$(1HtHMtILE1ML-TuHÃf.&4IcDL>f.ItAFdMtoHI 'u_؃HT$(dH+%(H8[]A\A]A^A_A1ft7Ht-DHH 'tLA܍MHÃ:DMif.Ht$ LHT$LD$L$ L$ LD$HT$DIHHfDqDLHT$LD$L$ L$ LD$HT$'LHT$LD$L$ L$ LD$HT$LHT$LD$L$ L$ LD$HT$LHT$LD$L$ JHT$LD$L$ LHT$LD$L$ ڃL$ LD$HT$gMIL9L1@HH9uHT$LD$L$ L9FICH5PHHx(3L$ LD$HT$fDMIL9qL1@HH9uTHT$LD$L$ L9 FICH5JHx({AFdIH IH9HxXHAFdIIH9HpL;vXHH9uIF`H!IF`H"IF`HIF`HIF`H/IF`H.IF`H'IF`H&pIF`H `IFPH@`H L@IF`H68IF`H  IF`H3IF`H2IF`HIF`HE1E@IF`HAFcMI?H,fIF`HpAFbcAFcSIF`HCA0f.AWIHAVAUIATIUSH(MtIHtHE1ME1AL5pMLHIL9IDIc4L>H@H5DLL$HT$Hx(D\$L$0L$D\$AHT$LL$E1D:MLAHI t_NfDH@H5pGLL$HT$Hx(L$D\$/L$HT$ALL$AGMuAH(D[]A\A]A^A_DH@H@H$T@IE`H?@IE`H0IE`H IE`H&IE`H%IE`H$HH@H#xH@H@HH@H@H@H@H@H@H@H@Hl@H@H@ ^HeAEd4@IE`H1 H@H@H% @IE`H-AEfIt0AEdu)AuMAH@@uvHDLHH HpFxLIlAEdaAMDD\$HuI^AEdSAb?Aff.1AT(‰1Ҩ0AƒE‰ƒ@E‰ XDZA\@GfDɺE2fDDH5HHIfATUSHn(H UCd PL ZHLDH-P1L]gH= XZCdt [1]A\fDHLL9y=HHx葜LRgHI1HL9@=HRHL3gI1[1]A\AWf~AVAUATUHSH]dH%(H$1H|$)$HHE1L%>%E1L- R> u E\t IcAAA~IHtULP"uEuAE1fDMcLB<ILm!1LHfDEu3H$dH+%(u@H[]A\A]A^A_fDE1bMcHH52Q1B<!(ff.ATAH5bZUHS(uPHAtHcH HH)HTHtQ[H5]1A\ f.H5HA(u5AuH = HH)HTfDH5SH'u5HApAt Ae>HQfH5H'u-HA(HAH5Hq'H`AHAiff.AWAVAUIATUSHXdH%(HD$H1HL|$f1L5ROIHL1L)D$ L)D$)D$0HD$(fHH@ H8H-M11L-H HHl1HPL N11L- AXAYMLN1E1H5P'HD$HdH+%(HXD[]A\A]A^A_fDH-i@H@8OuxKuDpE}I$11H3NL)D$ )D$HD$()D$0HtH@ Ht 8H1H51hLL MLD Y^M1LMH5^&HIE1VLbH5$&SAZA[f.H@HD$=xD$HtqI$H7M11fHL)D$ )D$HD$()D$0ϳHt:H@ Ht18tlIL11-H5 HM1ɋD$LMH5R%AP1}XZfDL`MtH5LLx HtMH5LL` HtMH5uLLH HtMH5cLL0 HtMH5ULL HtMH5MLL H'M I#fAUATUSHH5H2dH%(HD$81D$t Du"HD$8dH+%(HH[]A\A]LHHLHzH5H|$jLc1AUL ɶH ϶R1ATL%зVLUYHl$XH0Lt$HL$ LD$HID$ ty4PK1L VbL@H5|#XZLd$ Ht H}HD$8dH+%(uHHL[]A\A]t!ff.@UHH<tWu H]wuH]bfy,L1]qH5"]ff.USHHh0dH%(HD$81t Bu"HD$8dH+%(HH[]HHHtHtH5vH tL1ɺ 1LIH5 ":k(HHH|$jUH-ILc1RHL 1SH WH\$HHE1H t$HL$ H6Hl$ Ht H{CHD$8dH+%(uHHH[] ATUSH@ &/dH%(HD$81t Au HD$8dH+%( H@[]A\HL%H1H|$E1LcH ۳L13VHl$(E1Lt$HL$ HgtD$ y$LH1VH5 Ld$ Ht H}DL?H-o 1`Le\HHD$8dH+%(u(H@HL\1[]aA\Pf.HtHHtH9tH@fH AVf1AUL-FATLUSHH@dH%(HD$8HI1)D$L)$)D$ HD$蜭Ht?H@ Ht68H-dM11L@ -Hm H-7HH1HPL SF1L10 A^XHf11LL)D$)$HD$)D$ HtGH@ Ht>8H-1ɺ-1L EL H H-HHJH1PL E11L  A[]HH-7f11HL)D$)$HD$)D$ =HH@ H8IH-11L -H HL5\1HAVLm1L 1 _AXHf11LL)D$)$HD$)D$ 蘫HH@ H8 H-X1ɺ-1L |DL+ H] HH[1HSL OD11L, YI^H1AVH-7LJaH XZHxH5XqfWHH11HL)D$)$HD$)D$ 蘪HH@ H8H-XI11L4 -Ha HHZ1HSL 11L0 AYIAZL`~HxH5^tfHH11HL)D$)$HD$)D$ 踩HtCH@ Ht:8H-I11L\ -H H-OHHZ1HSL %11LӒH A\IA]L^{H-R1H*=s HD$8dH+%(H@HL1[]1A\A]A^LHf.H-S@H-@H-o7@LH^LHPLpfAWAVAUATUHSHD=a H|$ L$t$(dH%(H$1AHG8AAEt=ȉ$H L$Ht L$HxLLI96DEEj jAE1%jA1D 1L PUHD$XH H? D$Eu>E1H|$8YH$dH+%(HĨD[]A\A]A^A_DHD$8H@PHH0HL$XL$(ʃtD$Eb tD$E DHt$XH|$ IEHL$4DD$0`)BHD$8D$,L5qGH@HD$HfHD$HHHHhLhH@ HL$HD$MD$(L$4T$0 ЉD$D$(tH5VLLLD${tH5tELHD$ E111 11HP8jjAj A%A 1PtHD$0H HuSI M1HL$pHT$lLLL$xLD$tH5 V YIH HuHD$HhHLeL}Hm MtLLxH5}DLuM,1HL$pHT$lLH5Q ot$p|$l1HwH|$ fDLLAąuVH=LUHHHt$HT$xH臞HD$xHX蹷 H5UL 4H5LAą|$,t.H56,LstH5(L`D$,H|$(D$(t t$,A'E H@HHHP(HpDLt$ EIAL%ADžEv8cAĉD$0ÉD$4gt$p|$l t$x|$t1f.H=S_HHHt$HT$xHqHD$xHx8HtH58Hff.H=TSHHWHD$ E111 HP8jjAj A%A 1PӑH IHH@Ht*HxHt!1HL$pHT$tH5I DMH1AHD$(L5vLYLHP8A A%A кlP1xL` HA[[HD$ HHH;D$ LHt$XdLQAUL1AXAYfDD E? H$1H|$PHH=vQhHD$@HHt$H|$@HT$x7HT$x1E1L=czH\$HDLd$ DLHH1SLIEAnH$HdH+%(HXD[]A\A]A^A_1IMLH-BLx]1L1Ņ6E18M1PHLxPH51_AXTLA1ɺH51E1l(8E1VM1ɺPHLxPH591)LA>M1PH(LGxPH51XZ@1MẵPHAE1PH5‘Lw1Y^Vff.@AUATIHUHLLhLZIHtRLHHtE11LL@H HjH5d;_HtL]A\A]f.LIH1H5'yf.UHAWAVAUATSHXHLHdH%(HE1HHI9!AD$LHI%HHHH)H9tHH$H9u%H)HDHE4HvHUHID$H@ <HHHHH HH(H H0HH8H0H@ctH@PHH趔HYAŅsHHH9H@@Hr;AŅHoLFIH55w16HduHHID$H@ H9oIT$HHB HHHLIHLFSH5v1WA\A]E1HHHH;=HHp:HH5"AŅHaHHHL%uLELHCPLsH1AXLAY1LElHCPHLLsH1LE:AZL1A[LEL1LE7@HtmLIH5t1HEdH+%(HeD[A\A]A^A_]HLJDLJ(HtLq1ɺHHƿ1EA\$L[Dž1kf.t:I$HHDHH`I$HDHH`AD$L9M$H@H IHAucI$ …PLNM7MmM9tfIvL脁,M6M9uI$HM/LtM9uTMmM9DIuL7tfDA|$LHsHMt M;?HAMk= HHI1LaD 1A[[DHHxPH!`1ɺALoH5tr>|fLqCH5Ir1E1 G@LiADE;[IT$Jt ;|B DžE11M/HRHHHI$H\M9uyfMmM9tWIuH{t烽DžAL$LA A9si1D1AEpI$HM/H\M9uMmM9IuH~toDEHAŅv HH;LL#fDH{HL9IEPH{L8HLu1ɺALmH58p@I$HH\CbI$HHD@bzHHxPAŅ HH1,AŅLLLE1HHLAŅ AFcDA`HLL9A~LOH!oE1H@AE;fL8DL,@JHHILlAEctII9u@HI9tHsL|tHIHDHHH1HH9jf.HH9uLHIDžHD@ct @pH9t9DH8uH@H@tJ$HH9u؉LLCfHD PH5m1L@DLMY^L9DILMDL=LIH L~@VPH5Zm1A[A_M6I9IuH@LxAuAA+D9L^eIW@HtH Ht H9jL ] bHlHH1ɺ`1LjyH1ɺf1LiE1UDLLVHEL?TPH5=F.1E1LL=H5k{HcHLPLR=H5wkHLLcHHJ@HHHH9LJHQ PL:21H5kHXZHH@PHL"h1ɺ91H5ju1ɺALgH5jNL IHbHID$HP H.HH"LHID$@HE1SLL <H5jRP1H AD$LPM$I$HRH4 I Ha`H HHa`H9uߋL@1MtpDAD$L9[HH4Ht L4MtHRI$HLlI$H|hLL؀UAEbtIIH9eLHLIMHHbH@H1_ Lf1ɺMLHPHHHH@PHx?IH H8tAALLIMHHu/L1 Lue1ɺLLhHLH@PHx蠑IHA7AEtAAAHL[ALd11H5zg?}Ld1ɺH5Vg1Ld1ɺ1H5.g1HP(HAŅAHB_L:mIH5f1L91=H5fbH^L-MIH5gf1*hLHH@PHLLH1LAt$L+MAŅ}HLH;uHH;IFPHsH8_AŅuLc1ɺ1H5ehIIxLHIDITITLH)ALH)HIIxLHIILILLH) H)HAD$LE1yML!@IKAD9IIEAKTmDEuID EuL L;IIBH5qLHHBHD@LHK0IR1DLLLB`0LAIz赜L0L;mIIBH5xLHHBHD趼LHIMIR1DLLLB`LAIz+AGLMHHHDžTboHH {L`1ɺH58cM;?L{`1ɺ 1H5 c LU`1ɺl1H5b*L/`1ɺd L`1ɺ1H5bE1gADfAD9HZL5IH5[b1\1ɺAL_H5-b5AAADADECD/fCD(MI$HH\HM/ZIH#ZLWISH5a1lY^1ɺE1L^H5yaCHMYIHYAPIL+S1ɺE1L^H5 a(AEACD/CD(SLY^1ɺH5`VfATUHSH&(HAH(EL% (HLAH'EtmH5'HAHEtSH5'HALEt9HlHHAH'EtHHH}}HD[]A\ATUSHH-8Iu L[]A\DHHh HCPHHHx艉HHtMHH 4'HH5'1L%}<LI[]LA\ff.AUATUHSHHHGH9HHP Ln(HtYHHtQIH}WHIL2AUH5_ATP1H H[]A\A]@L`(f.H7WHUIHB HtwHHtoHATIٺPL;21H5^`XZH[]A\A]H1[Lh2]A\H5Z^A]"fHB(f.AVHGAUATIHHW(AD$ UHESH8+HPI$IT$HPL"L`HtlH8HHL5 EHL1DH)J|5HJLt'LH{8LLPtY[]A\A]A^H-J1ɺ1LZH,1ɺHLZ[1]A\A]A^L$H5ː[LkZ]1A\A]H51A^ftXHFpLFpHI9t^H9PtL HL9tMLH9PuHH@HAH HBH@h@HLHI9uHNHHHBL #L~0H5H@HQҺPHFLE11HHHH9HB`ff.AW/AVAUIATUSHLHLwPLLt$MIHXHIDI9ufDHmI9LuHIFHxHuMehMtIt$A<$LiI]pM}pL5 L9uADE$IEPHHBH@hHL9t\HSMt E$EtIEPHHS:HBuHHH96HHB`L9ufIEPHMHUH@HQH H@HHHuAHUHHH*HHHD[]A\A]A^A_HxLԌ(D$LtW1ɺH5݃1DL$ID$H1LLK.LHHHBpH1AXAYD$LW1ɺfHD$H@L@I9ugfDHmI9tXHEHH@HxHuHD$H 1L8.H5LAW1XAZHD$HH5L-LAW1YE1^ f.ATHIH@dH%(HT$81H|$HHAH=LL$HDHt$ H$HT$PHT$PAEHD$8dH+%(uFH@DA\fBT@L\U1ɺ 1H5Á(AWAVAUATU1SHHHH$Ht$T$0D$L$4LD$(LL$ u LMHtxHD$D$HHD$@EH[HtH;uLKAY<@tUEtL,1ɺH 1H5H[HuE1H$AHHD[]A\A]A^A_@AyUEuAy*MymHD$LHD$L9LH\$8LIfDHI9HsLuH\$8Ht>LuL9IvLt!DM6L9IvLuH$Pt$H$1LϠdD$f.EL@+1ɺA H5\L*1ɺ: 1H5s_3f.E L+1ɺQ 1H5:&AH$HtfHD$L|$LM9HED$H\$8HMfH9IfDMmL9IuL/uHD$H|$ H@@~HHHH9HBHL+u ATL$@QPDL$TH5E~1A)H ZM6M9DH\$8D$fHD$LL;t$DD$Et)IvH$1̞M6L9t$H$1H5D蠞uLmAƺ^ H5}wIMID H\$8.H$1H5?VLAƺ H5&}GD$HL$(HHt&HI@H)HHH9HRHtHHt H9tLIL S RL;)o AT1H5|AvXZH L4Aƺ H5R|>sHtHI@HHHtyH9ttHRHtHHt H9tHAH RML(Pr MLAƺc H5{H[ HO HD$H|$ Hx@tIHHHH9H@HL( AWL$@QPDL$T$uhHL$(HHt&HQ@HHHH9H@HtjHHtbH9t]HRPML'R A苸L HHD$(Ht Hx@nIRLC' AWH; H2 H& pATE1E11SHH1AHjSjH t HD[A\fAHC011C8LM H5zHD[A\fAVAUATIUSLA8H1LsLfIHL5 LLHLHlHlyIHtd1HH1MLHHLxi[L]A\A]A^DyIHtL[]A\A]A^L1H5 f.LfH5ߩ1E1k@ATIIUSHHH%dH%(H$1HH:HjLHXH;xHts9ud@H$dH+%(H[]A\DH$HxHHHHLHLHH) H)։Hf$tTfT@1L|H51UD$ۉTT<AWAVAUATUSHH $HXdH%(H$H1HD$0t`u/H$HdH+%(HX[]A\A]A^A_fDL- HM9mtL=A11LLH5&H=hIH1`HD$8M9mH|$8IHMMLAH1oM9m5LH=+,D  D$D$ϦEL\H1LbD$$L#PDL$1Y^Lt%e1ɺmLDL#1HmaH9 H9Da EH|$8IHMMLAHf1NL1AH]-LD$0H!LLD$L-~,Lt$0LLH6MIE1LHT$ HLt$0LLHMIE1LpL1H}1ҾHt-Hu#HtHHL1=LH=1(D$IHD$@D$ϦHD$M fLHIHAt&HHH9u HH9tL;huLHuKAEbtIEHt L9L -L1L +ffDIEHKL9BHpH|$1ҹ5HuƄ$?H|$Ht$|$D$D$AE`MLLLD$ LD$ H v|HtKH@PHtBHHHH9HϺLD$(H5IHL$ HL$ LD$(H*|HDIE8HH 0 HH IHIEAA Ht L9L QLLѾR1H_AX @H5q @H H9D ELE1ɺ`1LsfDDD$L$1HLyIFHth I>4L,+LH=-fHɤ H9IEHL9LHL1ɺ?1L@HHiLH1SDL41LgXZLPhLHL fH zSG`Ht@gC`HcCXt9 ~H {THCT[ÐHHt H9L h 1LCH5iqC`gC`HcCXuHHH9LHL1[JH5qD@HHtQH9tLLHH1L 1RH5pQXZHCT[fDLH/L L y [@AWAVAUATUSHH $H8T$DL$dH%(H$(D $x vHIAD&MHEPH843 t k w HEPL|$ LMHHϽLH0L1HhkHEP11LH8hIH@`t Ā̀AF`[ u  Ew$xCHEP1ҾOH8赋H;HHm1LIq"H޿1/fHD$;L3"IH5l1ݾDT$H$(dH+%(VH8D[]A\A]A^A_@wfD2տ ^LMHH"LkH5nl1XE1xLhD$ H:LxR"IH5#l1 DT$ +$xHkAHEhHM9MCDl$I9LGT:HIHEPLHDL$HxjJ_AXAUAWIL]1ɺ{"H޿1_Dx AYAZEu |$MI 1DLLAFaEHu`+A,@ADMM"LlHHjQ91ɺX"HIL-1衼HEPj1ɋ$xALH8RDL$LA[A_D$AFaDT$HDT$8DT$Hŋd uV DT$HL  _"H Lj LDH1UAXAYDT$fDIHL9LH1L 1ɺH5sk螻AvXH=S NLfAF`DMI IHD$1Ll$HD$Mu'HT$HD$HHT$L9HL9v LH)HD$A~T1L跼t8tW1ɺ"HPHWL=PL @1赺YL^1ɺ"H޿1薺fDE1KHEPHLHDL$HxjPGHIXZ6HŋV >H L <LI"H޿H5LDH1ATAUU߹H E1AvXH= 耳LL Y @+6Hg1L;Ik"H޿1tHLeh5HIHEPLHDL$Hxj:FA_1ɺ{"IXj1AULH޿  XZ{ME1I LN;12H5J;L%;12H5!;藸DT$]AvXH=B =LUDT$fDAWAVAUATUSHH $HE1H|$HHt$hHT$ L$`LD$xdH%(H$1H$HD$H$H$H$HD$@H$H$HH9tHAH9uL=g1LZL蕷HD$ D$dD$tD$pL DH) M,$1XL9d$ I|$G`%G`mLMIID$1҃H= pX蜢I$ID$HBHH$ HD$I$H$ID$H$L(IL$ML9t$ I~G`%G`MIe訷XID$HHHH9HJHP8QLLMA A%A кP1I$ID$HBHID$IH` AYAZL9t$ tI~G`%G`9D1ALqL譵L$I$MHD$L;d$^H$HD$0@ID$HHH~H9uLJL1L1It$D$pD$dN` HoHHtKH$HtP|$`uID$H= pX蔮I|$I$ID$HBHH$HD$@I$H$ID$H$L(L$Ll$IEML;l$;HD$ID$LD$011H= HDŽ$pX轠L$H$H|$(IpHLlIL$HA8yX % H1HH9LNHLLWRP1訳Il$DŽ$H HD$he`Ht1H|$HHH Lt$(Ll$P11HD$8HD$Ld$XMAHLABELONEI9$]EtID$H9It$ϦR}A;D$WEfDHIHuH|$Ll$PLd$XLD$8HL$(HL$Ht$M`LH|$HH HHP$HEHHH9H@HIL1P1L.ID$AZA[HHHH9LJL1LD$tD$d @H L(I9I}HLHuMmH_ I9uDHEHH9H@H8I1PL1LQXZENIEH\$8AHD$EDHUHt_H9tZLJS1LLAP'1Y^L @L @Hy N@L i HEHt7H9t2LHHLL1S#y_AXML  L11ɺ~1L6AHD$ L L9\$dLLTSD$|PD$1Y^HD$xHtHt$@L袣H$dH+%(H[]A\A]A^A_fHEHt/H9t*LHL1ɺ/1Lq@L  HH9LHHL?11RL ID$AXAYHfDL @HEHtOH9tJLHH;1SL LXZf.H Y K@L I H9 1@L ) 2@HEHtgH9tbLH= xLL(117HHH腲HHtDfC CL HEHt?H9t:LH11LLuM`@L Q HEHtH9ueL : =Ӯ LL 11cHHH豱HHtCfC CtLHH ?$H5M2H=^2路肷fAVAUIATIUH8dH%(HD$(1D$ HLt$L`HL0LpHD$HD$MtAD$auA11LD$ LLHD$(dH+%(uTH8H]A\A]A^Zf.At$XH= LHD$(dH+%(u H8]A\A]A^蔶@AUIATIUHSHdtpI]I9uCDH̀A`I9t0HKA`tqXH=| wHKHA`̀A`I9uHLLH[E1]1A\A]%DH1ɺ:[L,H5,[]A\A]WAUIATIUHSH褱t`I$I9u3DHI9t&HCHt@atpXH= 躤HI9uHLLH[E1]1A\A]uDH1ɺ)[LK,H5|Z]A\A]駪AWAVAUATUHSHH8HL$dH%(HD$(H1HD$HtHHD$uLQHxE1jH|$ HDAuEHH@HL4ЋUPA7mIFHHCAHXELH2D9 ;0LkMCAMWHEL{LpPMVxMLLT$衮H|$HL$ LH4LLYTHHPHHCLD$DHHL:D$L*11H5UDL$D1MH5L ٨HEL{LpPLLSHYMHiLDH1t$ LH5UM|XE1ZHDL)1ɺH5`VQL)11 H5T0E1HD$(dH+%(H8D[]A\A]A^A_LL$LH5sT1קE1fLL$LzD9wAsLL$LLL$LB{DLL$LR[AVAAUIATUHSHGHHxUIHt>LDHH *t[L]A\A]A^DHCLE1HxcLIX1H5H謦AMDAWIAVMAUIATUDSH1HH8HHL$HL$dH%(HD$(1D$LT$HIFHP(LX(tJH@HHtAIL$@H9t7HIL$ LM\$@H<H94))4ID$0HLH uXMOIHCL9:H@H ME1P1LH5G臥ZYIL$ H<1H9j1HL$ HCQHL$ QAKL\$QH oQHHLWLQLV1PD$pwH@L\$HIHHHHtH9tzHBM PL1AW H5FAsAQLK躤H Mt t IL$` HD$(dH+%(H8L[]A\A]A^A_fDH! Mt AMHHtHHt H9H M PL1AWH54F1AsAQLKH ZfDHHt HHtH9uSH HMPH5EL1谣^_fHB_HBf.H) ff.@ATSHH $HH}HOdH%(H$1HIHHAҦu.H$dH+%(HD[A\f苬8t迩0I1PHkL$PH5C1蒢XZfD(1E1LzH5Ca^׬AWAVAUATUSH8H|$Ht$HT$(HHyD$$11H|$E1E1zfÀu_薧IM ADA@tI"tD D$$tHD$(AAB _A]EHD$(D$$AAB EHH;D$s>HT$L,A]t,EL;d$s" jEaEE1HH;D$rH8[]A\A]A^A_fD$$fDUHH $HH lH{dH%(H$1HIHx+H諤H$dH+%(u3H]LD"1ɺ1H5藠ATUSHH $H`H r HdH%(H$X1AI@A AH\$PD$ AAHA 1H5\HHHaLd$H¾@L`H1HT$ H5OL1u.uA~.u A~tfD1MLLHL$ 1ɺHL莖$ pLH5LIMHHHD$HHL$HxJIH'HL$HLT$èLT$&H$(0dH+%(H80L[]A\A]A^A_f.ML.11H5,L1ɺH5@E1C<7 uC7_ILL9wfDH$ IzLHIITITLH)H)ƉH@$ AATfAT8TL1ɺPHlPLL$(1H5%XZLT$L1ɺ1H5E1j$ AATAT5萤8tH@H=81LPHL PL81XZjD蓞8̛1LPH$L >PL1蟔Y^ D#l$ fD;8t1LPH_?LPL 1G_AX8,1ɺLPHL PLS1AYAZBqAWAVAUATUSHH $HH $HXL=_e H?7LdH%(H$H 1Lt$@IL][ 5 L記HHHD$0.H$fDHСHPLh9uA}t@9uAE9u A}t@H $1HT$,LH51N1MLOH5讒HFHvDHH$H dH+%(HX []A\A]A^A_H= 1胇HHuPfDLؠH1.HHu@Dl$0HcD$,LL$8Ht$4H= LLL$D$AHH IcH H%H HT$AҺADT$4DT$LL$DT$taHt$8HtWL?Rf.;8tM1ɺPHLP1H56GXZH1 HL$1qLYL1ɺ1H5HHD$8dH+%("I<$HH[]A\A]A^A_2DL1ɺ1H5LߊDLЊfDHD$8dH+%(HHLL11[]A\H5?A]A^A_镄DLH5C1q@L1ɺH5IL1@L1ɺ1H5荎HH%s-%s-missing_%u_0activate/activate.cGetting target version for %sFound %s target v%u.%u.%u./usr/sbin/modprobe%smodule/dm_%sModule directory %s exists./lib/modules%s/%s/modules.builtin%s: %s failed: %skvdodm-%sfcloseInterrupted...misc/lvm-signal.cLogical volume %s in use.metadata/snapshot_manip.cactivate/dev_manager.cthin-poolChecking device id for LV %s.%*u:%*u %u (no device driver)Counted %d open LVs in VG %s.Found active component LV %s.Found active holder LV %s. [Test mode: skipping this]Not mSkipping %smonitor of %s.%s%s already monitored.Monitoring %s with %s.%s%s already not monitored.Not monitoring %s with %s%s temporary noscanmetadata/raid_manip.cSkipping: Activating %s.Activating %s%s%s%s%s.LV %s is already active.No host tag matches %slocking for suspendunlocking on resumeGetting driver versiondevice_mapper/libdm-common.cFailed to get driver versioncache/lvmcache.c#orphansbase/data-struct/list.chead->ndevice is used by LVdevice size is correctdevice name matches previousdevice has fs mounteddevice is in dm subsystemdevice is in subsystemdevice was seen firstis not used foris used forhas nohasis notis not inis inlvmcache label scan beginResolving duplicate devicesPV %s: %s %s dm. %s %s dm.PV %s: %s %s LV. %s %s LV.Adding chosen duplicate %slvmcache label scan doneno longerdevice not founddevice is a duplicatedevice cannot be used[unknown](root)How LVM uses block devices. allocationshellHost tag settings. validate_metadataabort_on_errorsprofile_dirdevice_id_sysfs_dir/sys/#S/devloopfilesobtain_device_list_from_udevexternal_device_info_sourcepreferred_namesuse_devicesfile@DEFAULT_USE_DEVICES_FILE@system.devicesdevicesfile_backup_limitsearch_for_devnamesdevice_ids_refreshdevice_ids_refresh_checks#Sproduct_uuid#Shostname#Sa|.*|global_filtercache_dircache_file_prefixwrite_cache_statesysfs_scanscan_lvsmultipath_component_detectionmultipath_wwids_file/etc/multipath/wwidsmd_component_detectionmd_component_checksfw_raid_component_detectionmd_chunk_alignmentdefault_data_alignmentdata_alignment_detectionignore_suspended_devicesignore_lvm_mirrorsdisable_after_error_countrequire_restorefile_with_uuidpv_min_sizeissue_discardsallow_mixed_block_sizescling_tag_listmaximise_clinguse_blkid_wiping@DEFAULT_USE_BLKID_WIPING@raid_stripe_all_devicescache_pool_cachemodeCache mode. cache_metadata_formatcache_modecache_policycache_settingspolicy_settingscache_pool_chunk_sizecache_pool_max_chunksthin_pool_crop_metadatathin_pool_zerothin_pool_discardsthin_pool_chunk_size_policygenericzero_metadatathin_pool_chunk_sizephysical_extent_sizevdo_use_compressionvdo_use_deduplicationvdo_use_metadata_hintsvdo_minimum_io_sizevdo_block_map_cache_size_mbvdo_block_map_periodvdo_check_point_frequencyvdo_use_sparse_indexvdo_index_memory_size_mbvdo_slab_size_mbvdo_ack_threadsvdo_bio_threadsvdo_bio_rotationvdo_cpu_threadsvdo_hash_zone_threadsvdo_logical_threadsvdo_physical_threadsvdo_write_policyvdo_max_discardreport_command_logcommand_log_sortlog_seq_numcommand_log_colscommand_log_selectionsilentsyslogjournaloverwritelevelindentcommand_namesactivate_filedebug_classesdebug_file_fieldsdebug_output_fieldsbackup_dirarchive_dirretain_minretain_dayshistory_sizeumasktestunitssi_unit_consistencysuffixfallback_to_lvm1format_librariessegment_libraries/proc@DEFAULT_PROC_DIR@Location of proc filesystem. /etc@CONFDIR@locking_typewait_for_locksfallback_to_clustered_lockingfallback_to_local_lockinglocking_dir/run/lock/lvm@DEFAULT_LOCK_DIR@prioritise_write_lockslibrary_dirlocking_libraryliblvm2clusterlock.soabort_on_internal_errorsmetadata_read_onlymirror_segtype_defaultraid1@DEFAULT_MIRROR_SEGTYPE@support_mirrored_mirror_lograid10_segtype_defaultraid10@DEFAULT_RAID10_SEGTYPE@sparse_segtype_default@DEFAULT_SPARSE_SEGTYPE@event_activation@DEFAULT_EVENT_ACTIVATION@use_lvmetadlvmetad_update_wait_timeuse_aiouse_lvmlockdlvmlockd_lock_retriessanlock_lv_extendsanlock_align_sizelvmlockctl_kill_commandthin_check_executable/usr/sbin/thin_check@THIN_CHECK_CMD@thin_dump_executable/usr/sbin/thin_dump@THIN_DUMP_CMD@thin_repair_executable/usr/sbin/thin_repair@THIN_REPAIR_CMD@thin_restore_executable/usr/sbin/thin_restore@THIN_RESTORE_CMD@thin_check_optionsthin_repair_options#Sthin_restore_optionsthin_disabled_featurescache_disabled_featurescache_check_executable/usr/sbin/cache_check@CACHE_CHECK_CMD@cache_dump_executable/usr/sbin/cache_dump@CACHE_DUMP_CMD@cache_repair_executable/usr/sbin/cache_repair@CACHE_REPAIR_CMD@cache_restore_executable/usr/sbin/cache_restore@CACHE_RESTORE_CMD@cache_check_optionscache_repair_optionscache_restore_optionsvdo_format_executable/usr/bin/vdoformat@VDO_FORMAT_CMD@vdo_format_optionsvdo_disabled_featuresfsadm_executable/usr/sbin/fsadm@FSADM_PATH@system_id_sourcesystem_id_fileuse_lvmpolld@DEFAULT_USE_LVMPOLLD@notify_dbusio_memory_sizeudev_syncudev_rulesverify_udev_operationsretry_deactivationmissing_stripe_filleruse_linear_targetreserved_stackreserved_memoryprocess_priorityauto_activation_volume_listread_only_volume_listmirror_region_sizeraid_region_sizeerror_when_fullreadaheadraid_fault_policywarnmirror_image_fault_policymirror_log_fault_policyallocatemirror_device_fault_policysnapshot_autoextend_thresholdsnapshot_autoextend_percentthin_pool_autoextend_percentvdo_pool_autoextend_thresholdvdo_pool_autoextend_percentmlock_filteruse_mlockallmonitoringpolling_intervalauto_set_activation_skipactivation_modedegradedauto_lock_start_listcheck_pv_device_sizesrecord_lvs_historylvs_history_retention_timepvmetadatacopiesvgmetadatacopiespvmetadatasizepvmetadataignoredirsdisk_areasdisk_areastart_sectoroutput_formatbasiccompact_outputcompact_output_colsalignedbufferedheadingslist_item_separatorprefixesquotedcolumns_as_rowsbinary_values_as_numerictime_format%Y-%m-%d %T %zdevtypes_sortdevtype_namedevtypes_colsdevtypes_cols_verboselvs_sortvg_name,lv_namelvs_colslvs_cols_verbosevgs_sortvg_namevgs_colsvgs_cols_verbosepvs_sortpv_namepvs_colspvs_cols_verbosevg_name,lv_name,seg_startpvsegs_sortpv_name,pvseg_startpvsegs_colspvsegs_cols_verbosevgs_cols_fullvg_allpvs_cols_fullpv_alllvs_cols_fulllv_allpvsegs_cols_fullpvseg_all,pv_uuid,lv_uuidseg_all,lv_uuidvgs_sort_fullpvs_sort_fulllvs_sort_fullpvsegs_sort_fullpv_uuid,pvseg_startlv_uuid,seg_startmark_hidden_devicestwo_word_unknown_devicemirror_libraryraid_librarysnapshot_librarythin_librarylvm lvextend --use-policiesvdo_librarylibdevmapper-event-lvm2vdo.so/usr/sbin/dmeventd@DMEVENTD_PATH@hosttagshost_listsystem_idextra_system_idshost_idmodule string allocation failedsnap_seg module string allocation failed%s configuration setting defined: Checking the list to match %s.No item supplied in %s configuration setting matches %s.Ignoring invalid string in config file %s.Ignoring empty string in config file %s.Ignoring empty tag in config file %sactivation/auto_activation_volume_list configuration setting not defined: All logical volumes will be auto-activated.Activation enabled. Device-mapper kernel driver will be used.WARNING: Activation disabled. No device-mapper interaction will be attempted.Activation disabled. No device-mapper interaction will be attempted.Failed to get %s target versionModules path %s/%s/modules.builtin is too long.Found %s as built-in kernel module.module_present module name too long: %sInternal error: Target present version called when activation is disabled.Found suspended LV %s in critical section().Found suspended layered LV %s in critical section().Snapshot merge is in progress, querying status of %s instead.Logical volume %s is used by another device.Logical volume %s contains a filesystem in use.Retrying open_count check for %s.Checking snapshot percent for LV %s.Internal error: Cannot get origin from snapshot %s.Checking mirror percent for LV %s.Getting device %s status percentage for %s.Checking raid status for volume %s.Expected %s segment type but got %s instead.Checking raid data offset and dev sectors for LV %s/%sChecking raid device health for LV %s.Checking raid mismatch count for LV %s.Checking raid sync_action for LV %s.Unable to send message to an inactive logical volume.Internal error: %s is not a writecache logical volume.Internal error: Cannot check status for unused cache pool %s.Cannot check status for deleted cache volume %s.Checking status for cache volume %s.Checking thin pool status for LV %s.More than one table line found for %s.Unexpected target type %s found for thin %s.Cannot parse table like parameters %s for %s.Preloading detached hidden volume %s as visible volume %s.Cannot determine activation status of %s%s.Counted %d active LVs in VG %sRAID module does not support RAID4. Cache pool activation for clearing only.Skipping unmonitor of opened %s (open:%d)Skipping monitor of snapshot larger then origin %s.WARNING: Failed to %smonitor %s.WARNING: %s: segment unmonitoring failed.WARNING: %s: %s segment monitoring function failed.%s %smonitoring still pending: waiting...WARNING: %sonitoring %s failed.Activation of logical volume %s is prohibited while logical volume %s is active.activation/volume_list configuration setting not defined: Checking only host tags for %s.Not activating %s since it does not pass activation filter.No degraded or partial activation for raid with integrity.Integrity must be removed before degraded or partial activation of raid.Refusing activation of partial LV %s. Use '--activationmode partial' to override.Refusing activation of partial LV %s. Try '--activationmode degraded'.Cannot use partial or degraded activation with writecache.Refusing activation of RAID LV %s with visible SubLVs.Refusing activation of LV %s containing an unrecognised segment.WARNING: lookup found duplicate VGID %s for VGs %s and %s.Internal error: vginfo_lookup %s has_duplicate_local_vgname.vginfo_lookup %s has_duplicate_local_vgname return none.vgnameid_list allocation failed.vgnameid_list member allocation failed.Skip multipath component checks with single device for PVID %sDifferent wwids for duplicate PVs %s %s %s noneDifferent wwids for duplicate PVs %s %s %s %sFound multiple multipath devices for PVID %s WWID %s: %s %s.Same wwids for duplicate PVs %s %sFound multipath device %s for PVID %s WWID %s.Using multipath device %s for PVID %s.Ignoring multipath component %s with PVID %s (dropping info)Ignoring multipath component %s with PVID %s (dropping duplicate)Found multiple md devices for PVID %s: %s %sFound md device %s for PVID %s.Using md device %s for PVID %s.Ignoring md component %s with PVID %s (dropping info)Ignoring md component %s with PVID %s (dropping duplicate)PV %s with duplicates unselected using %s.PV %s with duplicates unselected comparing alternativesPV %s with duplicates comparing alternatives for %sPV %s compare duplicates: %s %u:%u. %s %u:%u. device_hint %s.PV %s: size %llu. %s is %llu. %s is %llu.PV %s: %s %s subsystem. %s %s subsystem.PV %s: %s %s mounted fs. %s %s mounted fs.PV %s with duplicates will use %s.Internal error: PV %s with duplicates no alternate list entry for %sPV %s with duplicates will change from %s to %s.PV %s with duplicates will continue using %s.Dropping unchosen duplicate %sWARNING: Not using device %s for PV %s.WARNING: PV %s prefers device %s because %s.PV %s: device_id %s. %s is %s. %s is %s.Checking for multipath components for duplicate PVID %s_lvmcache_update: vgid hash insertion failed: %slvmcache %s: VG %s: set VGID to %.32s.Internal error: NULL vgname handed to cachelvmcache change %s to orphan from previous VG %s.Failed to update VG %s info in lvmcache.lvmcache %s mda%d VG %s set seqno %u checksum %x mda_size %zulvmcache %s mda%d VG %s older seqno %u checksum %x mda_size %zulvmcache %s mda%d VG %s newer seqno %u checksum %x mda_size %zuWARNING: scan of VG %s from %s mda%d found mda_checksum %x mda_size %zu vs %x %zulvmcache %s: VG %s %s exported.cache creation host alloc failed for %s.lvmcache %s: VG %s: set creation host to %s.cache lock_type alloc failed for %slvmcache %s: VG %s: set lock_type to %s.cache system_id alloc failed for %slvmcache %s: VG %s: set system_id to %s.How LVM configuration settings are handled. How LVM selects space and applies properties to LVs. How LVM log information is reported. How LVM metadata is backed up and archived. In LVM, a 'backup' is a copy of the metadata for the current system, and an 'archive' contains old metadata configurations. They are stored in a human readable text format. Settings for running LVM in shell (readline) mode. Miscellaneous global LVM settings. LVM report command output formatting. Settings for the LVM event daemon. LVM settings that are specific to the local host. If enabled, any LVM configuration mismatch is reported. This implies checking that the configuration key is understood by LVM and that the value of the key is the proper type. If disabled, any configuration mismatch is ignored and the default value is used without any warning (a message about the configuration key not being found is issued in verbose mode only). Allows to select the level of validation after metadata transformation. Validation takes extra CPU time to verify internal consistency. Accepted values: full Do a full metadata validation before disk write. none Skip any checks (unrecommended, slightly faster). # Abort the LVM process if a configuration mismatch is found. Directory where LVM looks for configuration profiles. Directory in which to create volume group device nodes. Commands also accept this as a prefix on volume group names. Location of sysfs for finding device ids (for testing.) Directories containing device nodes to use with LVM. Obtain the list of available devices from udev. This avoids opening or using any inapplicable non-block devices or subdirectories found in the udev directory. Any device node or symlink not managed by udev in the udev directory is ignored. This setting applies only to the udev-managed device directory; other directories will be scanned fully. LVM needs to be compiled with udev support for this setting to apply. Enable device information from udev. If set to "udev", lvm will supplement its own native device information with information from libudev. This can potentially improve the detection of MD component devices and multipath component devices. Use a local file to remember which devices have PVs on them. Some commands will use this as an optimization to reduce device scanning, and will only scan the listed PVs. Removing the hint file will cause lvm to generate a new one. Disable hints if PVs will be copied onto devices using non-lvm commands, like dd. # Accepted values: all Use all hints. none Use no hints. # Select which path name to display for a block device. If multiple path names exist for a block device, and LVM needs to display a name for the device, the path names are matched against each item in this list of regular expressions. The first match is used. Try to avoid using undescriptive /dev/dm-N names, if present. If no preferred name matches, or if preferred_names are not defined, the following built-in preferences are applied in order until one produces a preferred name: Prefer names with path prefixes in the order of: /dev/mapper, /dev/disk, /dev/dm-*, /dev/block. Prefer the name with the least number of slashes. Prefer a name that is a symlink. Prefer the path with least value in lexicographical order. # Example preferred_names = [ "^/dev/mpath/", "^/dev/mapper/mpath", "^/dev/[hs]d" ] # Enable or disable the use of a devices file. When enabled, lvm will only use devices that are listed in the devices file. A devices file will be used, regardless of this setting, when the --devicesfile option is set to a specific file name. The name of the system devices file, listing devices that LVM should use. This should not be used to select a non-system devices file. The --devicesfile option is intended for alternative devices files. The max number of backup files to keep in /etc/lvm/devices/backup. LVM creates a backup of the devices file each time a new version is created, or each time a modification is detected. When the max number of backups is reached, the oldest are removed to remain at the limit. Set to 0 to disable backups. Only the system devices file is backed up. Look outside of the devices file for missing devname entries. A devname entry is used for a device that does not have a stable device id, e.g. wwid, so the unstable device name is used as the device id. After reboot, or if the device is reattached, the device name may change, in which case lvm will not find the expected PV on the device listed in the devices file. This setting controls whether lvm will search other devices, outside the devices file, to look for the missing PV on a renamed device. If "none", lvm will not look at other devices, and the PV may appear to be missing. If "auto", lvm will look at other devices, but only those that are likely to have the PV. If "all", lvm will look at all devices on the system. Find PVs on new devices and update the device IDs in the devices file. If PVs are restored or moved to a new system with new devices, but an old system.devices remains with old device IDs, then search for the PVIDs on new devices and update the device IDs in system.devices. The original device IDs must also not be found on the new system. See device_ids_refresh_check for conditions that trigger the refresh. Conditions that trigger device_ids_refresh to locate PVIDs on new devices. product_uuid: refresh if /sys/devices/virtual/dmi/id/product_uuid does not match the value saved in system.devices. hostname: refresh if hostname does not match the value saved in system.devices. (hostname is used if product_uuid is not available.) Remove values from this list to prevent lvm from using them. Limit the block devices that are used by LVM commands. This is a list of regular expressions used to accept or reject block device path names. Each regex is delimited by a vertical bar '|' (or any character) and is preceded by 'a' to accept the path, or by 'r' to reject the path. The first regex in the list to match the path is used, producing the 'a' or 'r' result for the device. When multiple path names exist for a block device, if any path name matches an 'a' pattern before an 'r' pattern, then the device is accepted. If all the path names match an 'r' pattern first, then the device is rejected. Unmatching path names do not affect the accept or reject decision. If no path names for a device match a pattern, then the device is accepted. Be careful mixing 'a' and 'r' patterns, as the combination might produce unexpected results (test changes.) Run vgscan after changing the filter to regenerate the cache. # Example Accept every block device: filter = [ "a|.*|" ] Reject the cdrom drive: filter = [ "r|/dev/cdrom|" ] Work with just loopback devices, e.g. for testing: filter = [ "a|loop|", "r|.*|" ] Accept all loop devices and ide drives except hdc: filter = [ "a|loop|", "r|/dev/hdc|", "a|/dev/ide|", "r|.*|" ] Use anchors to be very specific: filter = [ "a|^/dev/hda8$|", "r|.*|" ] # Limit the block devices that are used by LVM system components. Because devices/filter may be overridden from the command line, it is not suitable for system-wide device filtering, e.g. udev. Use global_filter to hide devices from these LVM system components. The syntax is the same as devices/filter. Devices rejected by global_filter are not opened by LVM. List of additional acceptable block device types. These are of device type names from /proc/devices, followed by the maximum number of partitions. # Example types = [ "fd", 16 ] # Restrict device scanning to block devices appearing in sysfs. This is a quick way of filtering out block devices that are not present on the system. sysfs must be part of the kernel and mounted.) Allow LVM LVs to be used as PVs. When enabled, LVM commands will scan active LVs to look for other PVs. Caution is required to avoid using PVs that belong to guest images stored on LVs. When enabled, the LVs scanned should be restricted using the devices file or the filter. This option does not enable autoactivation of layered VGs, which requires editing LVM udev rules (see LVM_PVSCAN_ON_LVS.) Ignore devices that are components of DM multipath devices. The path to the multipath wwids file used for multipath component detection. Set this to an empty string to disable the use of the multipath wwids file. Enable detection and exclusion of MD component devices. An MD component device is a block device that MD uses as part of a software RAID virtual device. When an LVM PV is created on an MD device, LVM must only use the top level MD device as the PV, and should ignore the underlying component devices. In cases where the MD superblock is located at the end of the component devices, it is more difficult for LVM to consistently identify an MD component, see the md_component_checks setting. The checks LVM should use to detect MD component devices. MD component devices are block devices used by MD software RAID. # Accepted values: auto LVM will skip scanning the end of devices when it has other indications that the device is not an MD component. start LVM will only scan the start of devices for MD superblocks. This does not incur extra I/O by LVM. full LVM will scan the start and end of devices for MD superblocks. This requires an extra read at the end of devices. # Ignore devices that are components of firmware RAID devices. LVM must use an external_device_info_source other than none for this detection to execute. Align the start of a PV data area with md device's stripe-width. This applies if a PV is placed directly on an md device. default_data_alignment will be overridden if it is not aligned with the value detected for this setting. This setting is overridden by data_alignment_detection, data_alignment, and the --dataalignment option. Align the start of a PV data area with this number of MiB. Set to 1 for 1MiB, 2 for 2MiB, etc. Set to 0 to disable. This setting is overridden by data_alignment and the --dataalignment option. Align the start of a PV data area with sysfs io properties. The start of a PV data area will be a multiple of minimum_io_size or optimal_io_size exposed in sysfs. minimum_io_size is the smallest request the device can perform without incurring a read-modify-write penalty, e.g. MD chunk size. optimal_io_size is the device's preferred unit of receiving I/O, e.g. MD stripe width. minimum_io_size is used if optimal_io_size is undefined (0). If md_chunk_alignment is enabled, that detects the optimal_io_size. default_data_alignment and md_chunk_alignment will be overridden if they are not aligned with the value detected for this setting. This setting is overridden by data_alignment and the --dataalignment option. Align the start of a PV data area with this number of KiB. When non-zero, this setting overrides default_data_alignment. Set to 0 to disable, in which case default_data_alignment is used to align the first PE in units of MiB. This setting is overridden by the --dataalignment option. data_alignment_offset_detectionShift the start of an aligned PV data area based on sysfs information. After a PV data area is aligned, it will be shifted by the alignment_offset exposed in sysfs. This offset is often 0, but may be non-zero. Certain 4KiB sector drives that compensate for windows partitioning will have an alignment_offset of 3584 bytes (sector 7 is the lowest aligned logical block, the 4KiB sectors start at LBA -1, and consequently sector 63 is aligned on a 4KiB boundary). This setting is overridden by the --dataalignmentoffset option. Ignore DM devices that have I/O suspended while scanning devices. Otherwise, LVM waits for a suspended device to become accessible. This should only be needed in recovery situations. Do not scan 'mirror' LVs to avoid possible deadlocks. This avoids possible deadlocks when using the 'mirror' segment type. This setting determines whether LVs using the 'mirror' segment type are scanned for LVM labels. This affects the ability of mirrors to be used as physical volumes. If this setting is enabled, it is impossible to create VGs on top of mirror LVs, i.e. to stack VGs on mirror LVs. If this setting is disabled, allowing mirror LVs to be scanned, it may cause LVM processes and I/O to the mirror to become blocked. This is due to the way that the mirror segment type handles failures. In order for the hang to occur, an LVM command must be run just after a failure and before the automatic LVM repair process takes place, or there must be failures in multiple mirrors in the same VG at the same time with write failures occurring moments before a scan of the mirror's labels. The 'mirror' scanning problems do not apply to LVM RAID types like 'raid1' which handle failures in a different way, making them a better choice for VG stacking. Allow use of pvcreate --uuid without requiring --restorefile. Minimum size in KiB of block devices which can be used as PVs. In a clustered environment all nodes must use the same value. Any value smaller than 512KiB is ignored. The previous built-in value was 512. Issue discards to PVs that are no longer used by an LV. Discards are sent to an LV's underlying physical volumes when the LV is no longer using the physical volumes' space, e.g. lvremove, lvreduce. Discards inform the storage that a region is no longer used. Storage that supports discards advertise the protocol-specific way discards should be issued by the kernel (TRIM, UNMAP, or WRITE SAME with UNMAP bit set). Not all storage will support or benefit from discards, but SSDs and thinly provisioned LUNs generally do. If enabled, discards will only be issued if both the storage and kernel provide support. allow_changes_with_duplicate_pvsAllow VG modification while a PV appears on multiple devices. When a PV appears on multiple devices, LVM attempts to choose the best device to use for the PV. If the devices represent the same underlying storage, the choice has minimal consequence. If the devices represent different underlying storage, the wrong choice can result in data loss if the VG is modified. Disabling this setting is the safest option because it prevents modifying a VG or activating LVs in it while a PV appears on multiple devices. Enabling this setting allows the VG to be used as usual even with uncertain devices. Allow PVs in the same VG with different logical block sizes. When allowed, the user is responsible to ensure that an LV is using PVs with matching block sizes when necessary. Advise LVM which PVs to use when searching for new space. When searching for free space to extend an LV, the 'cling' allocation policy will choose space on the same PVs as the last segment of the existing LV. If there is insufficient space and a list of tags is defined here, it will check whether any of them are attached to the PVs concerned and then seek to match those PV tags between existing extents and new extents. # Example Use the special tag "@*" as a wildcard to match any PV tag: cling_tag_list = [ "@*" ] LVs are mirrored between two sites within a single VG, and PVs are tagged with either @site1 or @site2 to indicate where they are situated: cling_tag_list = [ "@site1", "@site2" ] # Use a previous allocation algorithm. Changes made in version 2.02.85 extended the reach of the 'cling' policies to detect more situations where data can be grouped onto the same disks. This setting can be used to disable the changes and revert to the previous algorithm. Use blkid to detect and erase existing signatures on new PVs and LVs. The blkid library can detect more signatures than the native LVM detection code, but may take longer. LVM needs to be compiled with blkid wiping support for this setting to apply. LVM native detection code is currently able to recognize: MD device signatures, swap signature, and LUKS signatures. To see the list of signatures recognized by blkid, check the output of the 'blkid -k' command. wipe_signatures_when_zeroing_new_lvsLook for and erase any signatures while zeroing a new LV. The --wipesignatures option overrides this setting. Zeroing is controlled by the -Z/--zero option, and if not specified, zeroing is used by default if possible. Zeroing simply overwrites the first 4KiB of a new LV with zeroes and does no signature detection or wiping. Signature wiping goes beyond zeroing and detects exact types and positions of signatures within the whole LV. It provides a cleaner LV after creation as all known signatures are wiped. The LV is not claimed incorrectly by other tools because of old signatures from previous use. The number of signatures that LVM can detect depends on the detection code that is selected (see use_blkid_wiping.) Wiping each detected signature must be confirmed. When this setting is disabled, signatures on new LVs are not detected or erased unless the --wipesignatures option is used directly. mirror_logs_require_separate_pvsMirror logs and images will always use different PVs. The default setting changed in version 2.02.85. Stripe across all PVs when RAID stripes are not specified. If enabled, all PVs in the VG or on the command line are used for raid0/4/5/6/10 when the command does not specify the number of stripes to use. This was the default behaviour until release 2.02.162. cache_pool_metadata_require_separate_pvsCache pool metadata and data will always use different PVs. This has been replaced by the allocation/cache_mode setting. Sets default metadata format for new cache. # Accepted values: 0 Automatically detected best available format 1 Original format 2 Improved 2nd. generation format # The default cache mode used for new cache. # Accepted values: writethrough Data blocks are immediately written from the cache to disk. writeback Data blocks are written from the cache back to disk after some delay to improve performance. # This setting replaces allocation/cache_pool_cachemode. The default cache policy used for new cache volume. Since kernel 4.2 the default policy is smq (Stochastic multiqueue), otherwise the older mq (Multiqueue) policy is selected. Settings for the cache policy. See documentation for individual cache policies for more info. Replace this subsection name with a policy name. Multiple subsections for different policies can be created. The minimal chunk size in KiB for cache pool volumes. Using a chunk_size that is too large can result in wasteful use of the cache, where small reads and writes can cause large sections of an LV to be mapped into the cache. However, choosing a chunk_size that is too small can result in more overhead trying to manage the numerous chunks that become mapped into the cache. The former is more of a problem than the latter in most cases, so the default is on the smaller end of the spectrum. Supported values range from 32KiB to 1GiB in multiples of 32. The maximum number of chunks in a cache pool. For cache target v1.9 the recommended maximum is 1000000 chunks. Using cache pool with more chunks may degrade cache performance. thin_pool_metadata_require_separate_pvsThin pool metadata and data will always use different PVs. Older version of lvm2 cropped pool's metadata size to 15.81 GiB. This is slightly less than the actual maximum 15.88 GiB. For compatibility with older version and use of cropped size set to 1. Thin pool data chunks are zeroed before they are first used. Zeroing with a larger thin pool chunk size reduces performance. The discards behaviour of thin pool volumes. # Accepted values: ignore nopassdown passdown # The chunk size calculation policy for thin pool volumes. # Accepted values: generic If thin_pool_chunk_size is defined, use it. Otherwise, calculate the chunk size based on estimation and device hints exposed in sysfs - the minimum_io_size. The chunk size is always at least 64KiB. performance If thin_pool_chunk_size is defined, use it. Otherwise, calculate the chunk size for performance based on device hints exposed in sysfs - the optimal_io_size. The chunk size is always at least 512KiB. # Zero whole metadata area before use with thin or cache pool. The minimal chunk size in KiB for thin pool volumes. Larger chunk sizes may improve performance for plain thin volumes, however using them for snapshot volumes is less efficient, as it consumes more space and takes extra time for copying. When unset, lvm tries to estimate chunk size starting from 64KiB. Supported values are in the range 64KiB to 1GiB. Default physical extent size in KiB to use for new VGs. Enables or disables compression when creating a VDO volume. Compression may be disabled if necessary to maximize performance or to speed processing of data that is unlikely to compress. Enables or disables deduplication when creating a VDO volume. Deduplication may be disabled in instances where data is not expected to have good deduplication rates but compression is still desired. Deprecated enablement whether VDO volume should tag its latency-critical writes with the REQ_SYNC flag. Some device mapper targets such as dm-raid5 process writes with this flag at a higher priority. The minimum IO size for VDO volume to accept, in bytes. Valid values are 512 or 4096. The recommended value is 4096. Specifies the amount of memory in MiB allocated for caching block map pages for VDO volume. The value must be a multiple of 4096 and must be at least 128MiB and less than 16TiB. The cache must be at least 16MiB per logical thread. Note that there is a memory overhead of 15%. The speed with which the block map cache writes out modified block map pages. A smaller era length is likely to reduce the amount time spent rebuilding, at the cost of increased block map writes during normal operation. The maximum and recommended value is 16380; the minimum value is 1. Deprecated option to set default check point frequency for VDO volume. Enables sparse indexing for VDO volume. Specifies the amount of index memory in MiB for VDO volume. The value must be at least 256MiB and at most 1TiB. Specifies the size in MiB of the increment by which a VDO is grown. Using a smaller size constrains the total maximum physical size that can be accommodated. Must be a power of two between 128MiB and 32GiB. Specifies the number of threads to use for acknowledging completion of requested VDO I/O operations. The value must be at in range [0..100]. Specifies the number of threads to use for submitting I/O operations to the storage device of VDO volume. The value must be in range [1..100]. Each additional thread after the first will use an additional 18MiB of RAM, plus 1.12 MiB of RAM per megabyte of configured read cache size. Specifies the number of I/O operations to enqueue for each bio-submission thread before directing work to the next. The value must be in range [1..1024]. Specifies the number of threads to use for CPU-intensive work such as hashing or compression for VDO volume. The value must be in range [1..100]. Specifies the number of threads across which to subdivide parts of the VDO processing based on the hash value computed from the block data. The value must be at in range [0..100]. vdo_hash_zone_threads, vdo_logical_threads and vdo_physical_threads must be either all zero or all non-zero. Specifies the number of threads across which to subdivide parts of the VDO processing based on the hash value computed from the block data. A logical thread count of 9 or more will require explicitly specifying a sufficiently large block map cache size, as well. The value must be in range [0..60]. vdo_hash_zone_threads, vdo_logical_threads and vdo_physical_threads must be either all zero or all non-zero. Specifies the number of threads across which to subdivide parts of the VDO processing based on physical block addresses. Each additional thread after the first will use an additional 10MiB of RAM. The value must be in range [0..16]. vdo_hash_zone_threads, vdo_logical_threads and vdo_physical_threads must be either all zero or all non-zero. Deprecated option to specify the write policy with these accepted values: auto - VDO will check the storage device and determine whether it supports flushes. If it does, VDO will run in async mode, otherwise it will run in sync mode. sync - Writes are acknowledged only after data is stably written. This policy is not supported if the underlying storage is not also synchronous. async - Writes are acknowledged after data has been cached for writing to stable storage. Data which has not been flushed is not guaranteed to persist in this mode. async-unsafe - Writes are handled like 'async' but there is no guarantee of the atomicity async provides. This mode should only be used for better performance when atomicity is not required. Specified the maximum size of discard bio accepted, in 4096 byte blocks. I/O requests to a VDO volume are normally split into 4096-byte blocks, and processed up to 2048 at a time. However, discard requests to a VDO volume can be automatically split to a larger size, up to 4096-byte blocks in a single bio, and are limited to 1500 at a time. Increasing this value may provide better overall performance, at the cost of increased latency for the individual discard requests. The default and minimum is 1. The maximum is UINT_MAX / 4096. Specified the empty header size in KiB at the front and end of vdo pool device. Enable or disable LVM log reporting. If enabled, LVM will collect a log of operations, messages, per-object return codes with object identification and associated error numbers (errnos) during LVM command processing. Then the log is either reported solely or in addition to any existing reports, depending on LVM command used. If it is a reporting command (e.g. pvs, vgs, lvs, lvm fullreport), then the log is reported in addition to any existing reports. Otherwise, there's only log report on output. For all applicable LVM commands, you can request that the output has only log report by using --logonly command line option. Use log/command_log_cols and log/command_log_sort settings to define fields to display and sort fields for the log report. You can also use log/command_log_selection to define selection criteria used each time the log is reported. Note that if report/output_format (or --reportformat command line option) is set to json or json_std, then log/report_command_log=1 is default. List of columns to sort by when reporting command log. See --logonly --configreport log -o help for the list of possible fields. log_seq_num,log_type,log_context,log_object_type,log_object_name,log_object_id,log_object_group,log_object_group_id,log_message,log_errno,log_ret_codeList of columns to report when reporting command log. See --logonly --configreport log -o help for the list of possible fields. !(log_type=status && message=success)Selection criteria used when reporting command log. You can define selection criteria that are applied each time log is reported. This way, it is possible to control the amount of log that is displayed on output and you can select only parts of the log that are important for you. To define selection criteria, use fields from log report. See also --logonly --configreport log -S help for the list of possible fields and selection operators. You can also define selection criteria for log report on command line directly using --configreport log -S which has precedence over log/command_log_selection setting. To make all the command log lines visible, use "all" value for the command log selection. For more information about selection criteria in general, see lvmreport(7) man page. Controls the messages sent to stdout or stderr. Suppress all non-essential messages from stdout. This has the same effect as -qq. When enabled, the following commands still produce output: dumpconfig, lvdisplay, lvmdiskscan, lvs, pvck, pvdisplay, pvs, version, vgcfgrestore -l, vgdisplay, vgs. Non-essential messages are shifted from log level 4 to log level 5 for syslog and lvm2_log_fn purposes. Any 'yes' or 'no' questions not overridden by other arguments are suppressed and default to 'no'. Send log messages through syslog. Write error and debug log messages to a file specified here. Record lvm information in the systemd journal. command: record commands that are run. output: record default output from commands. debug: record debug messages from commands. Overwrite the log file each time the program is run. The level of log messages that are sent to the log file or syslog. There are 6 syslog-like log levels currently in use: 2 to 7 inclusive. 7 is the most verbose (LOG_DEBUG). Indent messages according to their severity. Display the command name on each line of output. A prefix to use before the log message text. (After the command name, if selected). Two spaces allows you to see/grep the severity of each message. To make the messages look similar to the original LVM tools use: indent = 0, command_names = 1, prefix = " -- " Log messages during activation. Don't use this in low memory situations (can deadlock). #Smemory#Sdevices#Sio#Sactivation#Sallocation#Smetadata#Scache#Slocking#Slvmpolld#SdbusSelect log messages by class. Some debugging messages are assigned to a class and only appear in debug output if the class is listed here. Classes currently available: memory, devices, io, activation, allocation, metadata, cache, locking, lvmpolld. Use "all" to see everything. #Stime#Scommand#Sfileline#SmessageThe fields included in debug output written to log file. Use "all" to include everything (the default). The fields included in debug output written to stderr. Use "all" to include everything (the default). Maintain a backup of the current metadata configuration. Think very hard before turning this off! Location of the metadata backup files. Remember to back up this directory regularly! Maintain an archive of old metadata configurations. Think very hard before turning this off. Location of the metadata archive files. Remember to back up this directory regularly! Minimum number of archives to keep. Minimum number of days to keep archive files. Number of lines of history to store in ~/.lvm_history. The file creation mask for any files and directories created. Interpreted as octal if the first digit is zero. No on-disk metadata changes will be made in test mode. Equivalent to having the -t option on every command. Default value for --units argument. Distinguish between powers of 1024 and 1000 bytes. The LVM commands distinguish between powers of 1024 bytes, e.g. KiB, MiB, GiB, and powers of 1000 bytes, e.g. KB, MB, GB. If scripts depend on the old behaviour, disable this setting temporarily until they are updated. Display unit suffix for sizes. This setting has no effect if the units are in human-readable form (global/units = "h") in which case the suffix is always displayed. Enable/disable communication with the kernel device-mapper. Disable to use the tools to manipulate LVM metadata without activating any logical volumes. If the device-mapper driver is not present in the kernel, disabling this should suppress the error messages. Location of /etc system configuration directory. When disabled, fail if a lock request would block. Directory to use for LVM command file locks. Local non-LV directory that holds file-based locks while commands are in progress. A directory like /tmp that may get wiped on reboot is OK. Allow quicker VG write access during high volume read access. When there are competing read-only and read-write access requests for a volume group's metadata, instead of always granting the read-only requests immediately, delay them to allow the read-write requests to be serviced. Without this setting, write access may be stalled by a high volume of read-only requests. This option only affects file locks. Search this directory first for shared libraries. Abort a command that encounters an internal error. Treat any internal errors as fatal errors, aborting the process that encountered the internal error. Please only enable for debugging. detect_internal_vg_cache_corruptionNo operations that change on-disk metadata are permitted. Additionally, read-only commands that encounter metadata in need of repair will still be allowed to proceed exactly as if the repair had been performed (except for the unchanged vg_seqno). Inappropriate use could mess up your system, so seek advice first! The segment type used by the short mirroring option -m. The --type mirror|raid1 option overrides this setting. # Accepted values: mirror The original RAID1 implementation from LVM/DM. It is characterized by a flexible log solution (core, disk, mirrored), and by the necessity to block I/O while handling a failure. There is an inherent race in the dmeventd failure handling logic with snapshots of devices using this type of RAID1 that in the worst case could cause a deadlock. (Also see devices/ignore_lvm_mirrors.) raid1 This is a newer RAID1 implementation using the MD RAID1 personality through device-mapper. It is characterized by a lack of log options. (A log is always allocated for every device and they are placed on the same device as the image, so no separate devices are required.) This mirror implementation does not require I/O to be blocked while handling a failure. This mirror implementation is not cluster-aware and cannot be used in a shared (active/active) fashion in a cluster. # Enable mirrored 'mirror' log type for testing. # This type is deprecated to create or convert to but can be enabled to test that activation of existing mirrored logs and conversion to disk/core works. # Not supported for regular operation! The segment type used by the -i -m combination. The --type raid10|mirror option overrides this setting. The --stripes/-i and --mirrors/-m options can both be specified during the creation of a logical volume to use both striping and mirroring for the LV. There are two different implementations. # Accepted values: raid10 LVM uses MD's RAID10 personality through DM. This is the preferred option. mirror LVM layers the 'mirror' and 'stripe' segment types. The layering is done by creating a mirror LV on top of striped sub-LVs, effectively creating a RAID 0+1 array. The layering is suboptimal in terms of providing redundancy and performance. # The segment type used by the -V -L combination. The --type snapshot|thin option overrides this setting. The combination of -V and -L options creates a sparse LV. There are two different implementations. # Accepted values: snapshot The original snapshot implementation from LVM/DM. It uses an old snapshot that mixes data and metadata within a single COW storage volume and performs poorly when the size of stored data passes hundreds of MB. thin A newer implementation that uses thin provisioning. It has a bigger minimal chunk size (64KiB) and uses a separate volume for metadata. It has better performance, especially when more data is used. It also supports full snapshots. # lvdisplay_shows_full_device_pathEnable this to reinstate the previous lvdisplay name format. The default format for displaying LV names in lvdisplay was changed in version 2.02.89 to show the LV name and path separately. Previously this was always shown as /dev/vgname/lvname even when that was never a valid path in the /dev filesystem. Disable event based autoactivation commands. WARNING: setting this to zero may cause machine startup to fail. Previously, setting this to zero would enable static autoactivation services (via the lvm2-activation-generator), but the autoactivation services and generator have been removed. Use async I/O when reading and writing devices. Use lvmlockd for locking among hosts using LVM on shared storage. Applicable only if LVM is compiled with lockd support in which case there is also lvmlockd(8) man page available for more information. Retry lvmlockd lock requests this many times. Applicable only if LVM is compiled with lockd support Size in MiB to extend the internal LV holding sanlock locks. The internal LV holds locks for each LV in the VG, and after enough LVs have been created, the internal LV needs to be extended. lvcreate will automatically extend the internal LV when needed by the amount specified here. Setting this to 0 disables the automatic extension and can cause lvcreate to fail. Applicable only if LVM is compiled with lockd support The sanlock lease size in MiB to use on disks with a 4K sector size. Possible values are 1,2,4,8. The default is 8, which supports up to 2000 hosts (and max host_id 2000.) Smaller values support smaller numbers of max hosts (and max host_ids): 250, 500, 1000, 2000 for lease sizes 1,2,4,8. Disks with 512 byte sectors always use 1MiB leases and support 2000 hosts, and are not affected by this setting. The command that lvmlockctl --kill should use to force LVs offline. The lvmlockctl --kill command is run when a shared VG has lost access to locks (e.g. when sanlock has lost access to storage.) An empty string means that there will be no automatic attempt by lvmlockctl --kill to forcibly shut down LVs in the VG, and the user can manually intervene as described in lvmlockd(8). The VG name will be appended to the command specified here. The full path to the thin_check command. LVM uses this command to check that a thin pool metadata device is in a usable state. When a thin pool is activated and after it is deactivated, this command is run. Activation will only proceed if the command has an exit status of 0. Set to "" to skip this check. (Not recommended.) Also see thin_check_options. (See package device-mapper-persistent-data or thin-provisioning-tools) The full path to the thin_dump command. LVM uses this command to dump thin pool metadata. (See package device-mapper-persistent-data or thin-provisioning-tools) The full path to the thin_repair command. LVM uses this command to repair a thin metadata device if it is in an unusable state. Also see thin_repair_options. (See package device-mapper-persistent-data or thin-provisioning-tools) The full path to the thin_restore command. LVM uses this command to restore generated data for a thin pool metadata device. Also see thin_restore_options. (See package device-mapper-persistent-data or thin-provisioning-tools) #S-q#S--clear-needs-check-flagList of options passed to the thin_check command. With thin_check version 2.1 or newer you can add the option --ignore-non-fatal-errors to let it pass through ignorable errors and fix them later. With thin_check version 3.2 or newer you should include the option --clear-needs-check-flag. List of options passed to the thin_repair command. List of options passed to the thin_restore command. Features to not use in the thin driver. This can be helpful for testing, or to avoid using a feature that is causing problems. Features include: block_size, discards, discards_non_power_2, external_origin, metadata_resize, external_origin_extend, error_if_no_space. # Example thin_disabled_features = [ "discards", "block_size" ] # Features to not use in the cache driver. This can be helpful for testing, or to avoid using a feature that is causing problems. Features include: policy_mq, policy_smq, metadata2. # Example cache_disabled_features = [ "policy_smq" ] # The full path to the cache_check command. LVM uses this command to check that a cache metadata device is in a usable state. When a cached LV is activated and after it is deactivated, this command is run. Activation will only proceed if the command has an exit status of 0. Set to "" to skip this check. (Not recommended.) Also see cache_check_options. (See package device-mapper-persistent-data or thin-provisioning-tools) The full path to the cache_dump command. LVM uses this command to dump cache pool metadata. (See package device-mapper-persistent-data or thin-provisioning-tools) The full path to the cache_repair command. LVM uses this command to repair a cache metadata device if it is in an unusable state. Also see cache_repair_options. (See package device-mapper-persistent-data or thin-provisioning-tools) The full path to the cache_restore command. LVM uses this command to restore generated data for a cache metadata device. Also see cache_restore_options. (See package device-mapper-persistent-data or thin-provisioning-tools) List of options passed to the cache_check command. With cache_check version 5.0 or newer you should include the option --clear-needs-check-flag. List of options passed to the cache_repair command. List of options passed to the cache_restore command. The full path to the vdoformat command. LVM uses this command to initial data volume for VDO type logical volume List of options passed added to standard vdoformat command. Features to not use in the vdo driver. This can be helpful for testing, or to avoid using a feature that is causing problems. Features include: online_rename, version4 # Example vdo_disabled_features = [ "online_rename", "version4" ] # The full path to the fsadm command. LVM uses this command to help with lvresize -r operations. The method LVM uses to set the local system ID. Volume Groups can also be given a system ID (by vgcreate, vgchange, or vgimport.) A VG on shared storage devices is accessible only to the host with a matching system ID. See 'man lvmsystemid' for information on limitations and correct usage. # Accepted values: none The host has no system ID. lvmlocal Obtain the system ID from the system_id setting in the 'local' section of an lvm configuration file, e.g. lvmlocal.conf. uname Set the system ID from the hostname (uname) of the system. System IDs beginning localhost are not permitted. appmachineid Use an LVM-specific derivation of the local machine-id as the system ID. See 'man machine-id'. machineid Use the contents of the machine-id file to set the system ID. (appmachineid is recommended to avoid exposing the confidential machine-id.) file Use the contents of another file (system_id_file) to set the system ID. # The full path to the file containing a system ID. This is used when system_id_source is set to 'file'. Comments starting with the character # are ignored. Perform internal checks of libdevmapper operations. Useful for debugging problems with activation. Some of the checks may be expensive, so it's best to use this only when there seems to be a problem. Use lvmpolld to supervise long running LVM commands. When enabled, control of long running LVM commands is transferred from the original LVM command to the lvmpolld daemon. This allows the operation to continue independent of the original LVM command. After lvmpolld takes over, the LVM command displays the progress of the ongoing operation. lvmpolld itself runs LVM commands to manage the progress of ongoing operations. lvmpolld can be used as a native systemd service, which allows it to be started on demand, and to use its own control group. When this option is disabled, LVM commands will supervise long running operations by forking themselves. Applicable only if LVM is compiled with lvmpolld support. Enable D-Bus notification from LVM commands. When enabled, an LVM command that changes PVs, changes VG metadata, or changes the activation state of an LV will send a notification. The amount of memory in KiB that LVM allocates to perform disk io. LVM performance may benefit from more io memory when there are many disks or VG metadata is large. Increasing this size may be necessary when a single copy of VG metadata is larger than the current setting. This value should usually not be decreased from the default; setting it too low can result in lvm failing to read VGs. Use udev notifications to synchronize udev and LVM. The --noudevsync option overrides this setting. When disabled, LVM commands will not wait for notifications from udev, but continue irrespective of any possible udev processing in the background. Only use this if udev is not running or has rules that ignore the devices LVM creates. If enabled when udev is not running, and LVM processes are waiting for udev, run the command 'dmsetup udevcomplete_all' to wake them up. Use udev rules to manage LV device nodes and symlinks. When disabled, LVM will manage the device nodes and symlinks for active LVs itself. Manual intervention may be required if this setting is changed while LVs are active. Use extra checks in LVM to verify udev operations. This enables additional checks (and if necessary, repairs) on entries in the device directory after udev has completed processing its events. Useful for diagnosing problems with LVM/udev interactions. Retry failed LV deactivation. If LV deactivation fails, LVM will retry for a few seconds before failing. This may happen because a process run from a quick udev rule temporarily opened the device. Method to fill missing stripes when activating an incomplete LV. Using 'error' will make inaccessible parts of the device return I/O errors on access. Using 'zero' will return success (and zero) on I/O You can instead use a device path, in which case, that device will be used in place of missing stripes. Using anything other than 'error' with mirrored or snapshotted volumes is likely to result in data corruption. Use the linear target to optimize single stripe LVs. When disabled, the striped target is used. The linear target is an optimised version of the striped target that only handles a single stripe. Stack size in KiB to reserve for use while devices are suspended. Insufficient reserve risks I/O deadlock during device suspension. Value 0 disables memory locking. Memory size in KiB to reserve for use while devices are suspended. Insufficient reserve risks I/O deadlock during device suspension. Value 0 disables memory locking. Nice value used while devices are suspended. Use a high priority so that LVs are suspended for the shortest possible time. Only LVs selected by this list are activated. If this list is defined, an LV is only activated if it matches an entry in this list. If this list is undefined, it imposes no limits on LV activation (all are allowed). # Accepted values: vgname The VG name is matched exactly and selects all LVs in the VG. vgname/lvname The VG name and LV name are matched exactly and selects the LV. @tag Selects an LV if the specified tag matches a tag set on the LV or VG. @* Selects an LV if a tag defined on the host is also set on the LV or VG. See tags/hosttags. If any host tags exist but volume_list is not defined, a default single-entry list containing '@*' is assumed. # Example volume_list = [ "vg1", "vg2/lvol1", "@tag1", "@*" ] # A list of VGs or LVs that should be autoactivated. Autoactivation is an activation command run with -aay, i.e. vgchange -aay, lvchange -aay, or pvscan --cache -aay. When this list is defined, an autoactivation command will only activate LVs included in the list. If this list is undefined, it has no effect. If this list is defined but empty, then no LVs will be autoactivated. LVs can be included in the list by LV name, VG name (applies to all LVs in the VG), or tag name. VGs and LVs can also have an autoactivation property set in metadata, see --setautoactivation. LVs included in this list will not be autoactivated if the VG or LV autoactivation property is disabled (see vgs or lvs "-o autoactivation"). The volume_list setting and the "activation skip" property also apply to autoactivation. The -aay option is meant to be used by activation commands that are run automatically by the system, e.g. from systemd services. # Accepted values: vgname The VG name is matched exactly and selects all LVs in the VG. vgname/lvname The VG name and LV name are matched exactly and selects the LV. @tag Selects an LV if the specified tag matches a tag set on the LV or VG. @* Selects an LV if a tag defined on the host is also set on the LV or VG. See tags/hosttags. If any host tags exist but volume_list is not defined, a default single-entry list containing '@*' is assumed. # Example auto_activation_volume_list = [ "vg1", "vg2/lvol1", "@tag1", "@*" ] # LVs in this list are activated in read-only mode. If this list is defined, each LV that is to be activated is checked against this list, and if it matches, it is activated in read-only mode. This overrides the permission setting stored in the metadata, e.g. from --permission rw. # Accepted values: vgname The VG name is matched exactly and selects all LVs in the VG. vgname/lvname The VG name and LV name are matched exactly and selects the LV. @tag Selects an LV if the specified tag matches a tag set on the LV or VG. @* Selects an LV if a tag defined on the host is also set on the LV or VG. See tags/hosttags. If any host tags exist but volume_list is not defined, a default single-entry list containing '@*' is assumed. # Example read_only_volume_list = [ "vg1", "vg2/lvol1", "@tag1", "@*" ] # This has been replaced by the activation/raid_region_size setting. Size in KiB of each raid or mirror synchronization region. Size in KiB of each raid or mirror synchronization region. The clean/dirty state of data is tracked for each region. The value is rounded down to a power of two if necessary, and is ignored if it is not a multiple of the machine memory page size. Return errors if a thin pool runs out of space. The --errorwhenfull option overrides this setting. When enabled, writes to thin LVs immediately return an error if the thin pool is out of data space. When disabled, writes to thin LVs are queued if the thin pool is out of space, and processed when the thin pool data space is extended. New thin pools are assigned the behavior defined here. Setting to use when there is no readahead setting in metadata. # Accepted values: none Disable readahead. auto Use default value chosen by kernel. # Defines how a device failure in a RAID LV is handled. This includes LVs that have the following segment types: raid1, raid4, raid5*, and raid6*. If a device in the LV fails, the policy determines the steps performed by dmeventd automatically, and the steps performed by the manual command lvconvert --repair --use-policies. Automatic handling requires dmeventd to be monitoring the LV. # Accepted values: warn Use the system log to warn the user that a device in the RAID LV has failed. It is left to the user to run lvconvert --repair manually to remove or replace the failed device. As long as the number of failed devices does not exceed the redundancy of the LV (1 device for raid4/5, 2 for raid6), the LV will remain usable. allocate Attempt to use any extra physical volumes in the VG as spares and replace faulty devices. # Defines how a device failure in a 'mirror' LV is handled. An LV with the 'mirror' segment type is composed of mirror images (copies) and a mirror log. A disk log ensures that a mirror LV does not need to be re-synced (all copies made the same) every time a machine reboots or crashes. If a device in the LV fails, this policy determines the steps performed by dmeventd automatically, and the steps performed by the manual command lvconvert --repair --use-policies. Automatic handling requires dmeventd to be monitoring the LV. # Accepted values: remove Simply remove the faulty device and run without it. If the log device fails, the mirror would convert to using an in-memory log. This means the mirror will not remember its sync status across crashes/reboots and the entire mirror will be re-synced. If a mirror image fails, the mirror will convert to a non-mirrored device if there is only one remaining good copy. allocate Remove the faulty device and try to allocate space on a new device to be a replacement for the failed device. Using this policy for the log is fast and maintains the ability to remember sync state through crashes/reboots. Using this policy for a mirror device is slow, as it requires the mirror to resynchronize the devices, but it will preserve the mirror characteristic of the device. This policy acts like 'remove' if no suitable device and space can be allocated for the replacement. allocate_anywhere Not yet implemented. Useful to place the log device temporarily on the same physical volume as one of the mirror images. This policy is not recommended for mirror devices since it would break the redundant nature of the mirror. This policy acts like 'remove' if no suitable device and space can be allocated for the replacement. # Defines how a device failure in a 'mirror' log LV is handled. The mirror_image_fault_policy description for mirrored LVs also applies to mirrored log LVs. This has been replaced by the activation/mirror_image_fault_policy setting. Define how a device failure affecting a mirror is handled. Auto-extend a snapshot when its usage exceeds this percent. Setting this to 100 disables automatic extension. The minimum value is 50 (a smaller value is treated as 50.) Also see snapshot_autoextend_percent. Automatic extension requires dmeventd to be monitoring the LV. # Example Using 70% autoextend threshold and 20% autoextend size, when a 1G snapshot exceeds 700M, it is extended to 1.2G, and when it exceeds 840M, it is extended to 1.44G: snapshot_autoextend_threshold = 70 # Auto-extending a snapshot adds this percent extra space. The amount of additional space added to a snapshot is this percent of its current size. # Example Using 70% autoextend threshold and 20% autoextend size, when a 1G snapshot exceeds 700M, it is extended to 1.2G, and when it exceeds 840M, it is extended to 1.44G: snapshot_autoextend_percent = 20 # thin_pool_autoextend_thresholdAuto-extend a thin pool when its usage exceeds this percent. Setting this to 100 disables automatic extension. The minimum value is 50 (a smaller value is treated as 50.) Also see thin_pool_autoextend_percent. Automatic extension requires dmeventd to be monitoring the LV. # Example Using 70% autoextend threshold and 20% autoextend size, when a 1G thin pool exceeds 700M, it is extended to 1.2G, and when it exceeds 840M, it is extended to 1.44G: thin_pool_autoextend_threshold = 70 # Auto-extending a thin pool adds this percent extra space. The amount of additional space added to a thin pool is this percent of its current size. # Example Using 70% autoextend threshold and 20% autoextend size, when a 1G thin pool exceeds 700M, it is extended to 1.2G, and when it exceeds 840M, it is extended to 1.44G: thin_pool_autoextend_percent = 20 # Auto-extend a VDO pool when its usage exceeds this percent. Setting this to 100 disables automatic extension. The minimum value is 50 (a smaller value is treated as 50.) Also see vdo_pool_autoextend_percent. Automatic extension requires dmeventd to be monitoring the LV. # Example Using 70% autoextend threshold and 20% autoextend size, when a 10G VDO pool exceeds 7G, it is extended to 12G, and when it exceeds 8.4G, it is extended to 14.4G: vdo_pool_autoextend_threshold = 70 # Auto-extending a VDO pool adds this percent extra space. The amount of additional space added to a VDO pool is this percent of its current size. # Example Using 70% autoextend threshold and 20% autoextend size, when a 10G VDO pool exceeds 7G, it is extended to 12G, and when it exceeds 8.4G, it is extended to 14.4G: Do not mlock these memory areas. While activating devices, I/O to devices being (re)configured is suspended. As a precaution against deadlocks, LVM pins memory it is using so it is not paged out, and will not require I/O to reread. Groups of pages that are known not to be accessed during activation do not need to be pinned into memory. Each string listed in this setting is compared against each line in /proc/self/maps, and the pages corresponding to lines that match are not pinned. On some systems, locale-archive was found to make up over 80% of the memory used by the process. # Example mlock_filter = [ "locale/locale-archive", "gconv/gconv-modules.cache" ] # Use the old behavior of mlockall to pin all memory. Prior to version 2.02.62, LVM used mlockall() to pin the whole process's memory while activating devices. Monitor LVs that are activated. The --ignoremonitoring option overrides this setting. When enabled, LVM will ask dmeventd to monitor activated LVs. Check pvmove or lvconvert progress at this interval (seconds). When pvmove or lvconvert must wait for the kernel to finish synchronizing or merging data, they check and report progress at intervals of this number of seconds. If this is set to 0 and there is only one thing to wait for, there are no progress reports, but the process is awoken immediately once the operation is complete. Set the activation skip flag on new thin snapshot LVs. The --setactivationskip option overrides this setting. An LV can have a persistent 'activation skip' flag. The flag causes the LV to be skipped during normal activation. The lvchange/vgchange -K option is required to activate LVs that have the activation skip flag set. When this setting is enabled, the activation skip flag is set on new thin snapshot LVs. How LVs with missing devices are activated. The --activationmode option overrides this setting. # Accepted values: complete Only allow activation of an LV if all of the Physical Volumes it uses are present. Other PVs in the Volume Group may be missing. degraded Like complete, but additionally RAID LVs of segment type raid1, raid4, raid5, raid6 and raid10 will be activated if there is no data loss, i.e. they have sufficient redundancy to present the entire addressable range of the Logical Volume. partial Allows the activation of any LV even if a missing or failed PV could cause data loss with a portion of the LV inaccessible. This setting should not normally be used, but may sometimes assist with data recovery. # Locking is started only for VGs selected by this list. The rules are the same as those for volume_list. Locking is auto-started only for VGs selected by this list. The rules are the same as those for auto_activation_volume_list. Check device sizes are not smaller than corresponding PV sizes. If device size is less than corresponding PV size found in metadata, there is always a risk of data loss. If this option is set, then LVM issues a warning message each time it finds that the device size is less than corresponding PV size. You should not disable this unless you are absolutely sure about what you are doing! When enabled, LVM keeps history records about removed LVs in metadata. The information that is recorded in metadata for historical LVs is reduced when compared to original information kept in metadata for live LVs. Currently, this feature is supported for thin and thin snapshot LVs only. Retention time in seconds after which a record about individual historical logical volume is automatically destroyed. A value of 0 disables this feature. Number of copies of metadata to store on each PV. The --pvmetadatacopies option overrides this setting. # Accepted values: 2 Two copies of the VG metadata are stored on the PV, one at the front of the PV, and one at the end. 1 One copy of VG metadata is stored at the front of the PV. 0 No copies of VG metadata are stored on the PV. This may be useful for VGs containing large numbers of PVs. # Number of copies of metadata to maintain for each VG. The --vgmetadatacopies option overrides this setting. If set to a non-zero value, LVM automatically chooses which of the available metadata areas to use to achieve the requested number of copies of the VG metadata. If you set a value larger than the the total number of metadata areas available, then metadata is stored in them all. The value 0 (unmanaged) disables this automatic management and allows you to control which metadata areas are used at the individual PV level using pvchange --metadataignore y|n. The default size of the metadata area in units of 512 byte sectors. The metadata area begins at an offset of the page size from the start of the device. The first PE is by default at 1 MiB from the start of the device. The space between these is the default metadata area size. The actual size of the metadata area may be larger than what is set here due to default_data_alignment making the first PE a MiB multiple. The metadata area begins with a 512 byte header and is followed by a circular buffer used for VG metadata text. The maximum size of the VG metadata is about half the size of the metadata buffer. VGs with large numbers of PVs or LVs, or VGs containing complex LV structures, may need additional space for VG metadata. The --metadatasize option overrides this setting. Ignore metadata areas on a new PV. The --metadataignore option overrides this setting. If metadata areas on a PV are ignored, LVM will not store metadata in them. Format of LVM command's report output. If there is more than one report per command, then the format is applied for all reports. You can also change output format directly on command line using --reportformat option which has precedence over report/output_format setting. Accepted values: basic Original format with columns and rows. If there is more than one report per command, each report is prefixed with report's name for identification. json JSON format. json_std JSON format that is more compliant with JSON standard. Compared to original "json" format: - it does not use double quotes around numeric values, - it uses 'null' for undefined numeric values, - it prints string list as proper JSON array of strings instead of a single string. Note that if json or json_std output format is used, then log/command_log_report=1 is default. Do not print empty values for all report fields. If enabled, all fields that don't have a value set for any of the rows reported are skipped and not printed. Compact output is applicable only if report/buffered is enabled. If you need to compact only specified fields, use compact_output=0 and define report/compact_output_cols configuration setting instead. Do not print empty values for specified report fields. If defined, specified fields that don't have a value set for any of the rows reported are skipped and not printed. Compact output is applicable only if report/buffered is enabled. If you need to compact all fields, use compact_output=1 instead in which case the compact_output_cols setting is then ignored. Align columns in report output. Buffer report output. When buffered reporting is used, the report's content is appended incrementally to include each object being reported until the report is flushed to output which normally happens at the end of command execution. Otherwise, if buffering is not used, each object is reported as soon as its processing is finished. Format of LVM command's report output headings. Accepted values: 0 no headings, 1 headings with column abbreviations, 2 headings with full column names. A separator to use on report after each field. A separator to use for list items when reported. Use a field name prefix for each field reported. Quote field values when using field name prefixes. Output each column as a row. If set, this also implies report/prefixes=1. Use binary values 0 or 1 instead of descriptive literal values. For columns that have exactly two valid values to report (not counting the 'unknown' value which denotes that the value could not be determined). Set time format for fields reporting time values. Format specification is a string which may contain special character sequences and ordinary character sequences. Ordinary character sequences are copied verbatim. Each special character sequence is introduced by the '%' character and such sequence is then substituted with a value as described below. # Accepted values: %a The abbreviated name of the day of the week according to the current locale. %A The full name of the day of the week according to the current locale. %b The abbreviated month name according to the current locale. %B The full month name according to the current locale. %c The preferred date and time representation for the current locale (alt E) %C The century number (year/100) as a 2-digit integer. (alt E) %d The day of the month as a decimal number (range 01 to 31). (alt O) %D Equivalent to %m/%d/%y. (For Americans only. Americans should note that in other countries%d/%m/%y is rather common. This means that in international context this format is ambiguous and should not be used. %e Like %d, the day of the month as a decimal number, but a leading zero is replaced by a space. (alt O) %E Modifier: use alternative local-dependent representation if available. %F Equivalent to %Y-%m-%d (the ISO 8601 date format). %G The ISO 8601 week-based year with century as a decimal number. The 4-digit year corresponding to the ISO week number (see %V). This has the same format and value as %Y, except that if the ISO week number belongs to the previous or next year, that year is used instead. %g Like %G, but without century, that is, with a 2-digit year (00-99). %h Equivalent to %b. %H The hour as a decimal number using a 24-hour clock (range 00 to 23). (alt O) %I The hour as a decimal number using a 12-hour clock (range 01 to 12). (alt O) %j The day of the year as a decimal number (range 001 to 366). %k The hour (24-hour clock) as a decimal number (range 0 to 23); single digits are preceded by a blank. (See also %H.) %l The hour (12-hour clock) as a decimal number (range 1 to 12); single digits are preceded by a blank. (See also %I.) %m The month as a decimal number (range 01 to 12). (alt O) %M The minute as a decimal number (range 00 to 59). (alt O) %O Modifier: use alternative numeric symbols. %p Either "AM" or "PM" according to the given time value, or the corresponding strings for the current locale. Noon is treated as "PM" and midnight as "AM". %P Like %p but in lowercase: "am" or "pm" or a corresponding string for the current locale. %r The time in a.m. or p.m. notation. In the POSIX locale this is equivalent to %I:%M:%S %p. %R The time in 24-hour notation (%H:%M). For a version including the seconds, see %T below. %s The number of seconds since the Epoch, 1970-01-01 00:00:00 +0000 (UTC) %S The second as a decimal number (range 00 to 60). (The range is up to 60 to allow for occasional leap seconds.) (alt O) %t A tab character. %T The time in 24-hour notation (%H:%M:%S). %u The day of the week as a decimal, range 1 to 7, Monday being 1. See also %w. (alt O) %U The week number of the current year as a decimal number, range 00 to 53, starting with the first Sunday as the first day of week 01. See also %V and %W. (alt O) %V The ISO 8601 week number of the current year as a decimal number, range 01 to 53, where week 1 is the first week that has at least 4 days in the new year. See also %U and %W. (alt O) %w The day of the week as a decimal, range 0 to 6, Sunday being 0. See also %u. (alt O) %W The week number of the current year as a decimal number, range 00 to 53, starting with the first Monday as the first day of week 01. (alt O) %x The preferred date representation for the current locale without the time. (alt E) %X The preferred time representation for the current locale without the date. (alt E) %y The year as a decimal number without a century (range 00 to 99). (alt E, alt O) %Y The year as a decimal number including the century. (alt E) %z The +hhmm or -hhmm numeric timezone (that is, the hour and minute offset from UTC). %Z The timezone name or abbreviation. %% A literal '%' character. # List of columns to sort by when reporting 'lvm devtypes' command. See 'lvm devtypes -o help' for the list of possible fields. devtype_name,devtype_max_partitions,devtype_descriptionList of columns to report for 'lvm devtypes' command. See 'lvm devtypes -o help' for the list of possible fields. List of columns to report for 'lvm devtypes' command in verbose mode. See 'lvm devtypes -o help' for the list of possible fields. List of columns to sort by when reporting 'lvs' command. See 'lvs -o help' for the list of possible fields. lv_name,vg_name,lv_attr,lv_size,pool_lv,origin,data_percent,metadata_percent,move_pv,mirror_log,copy_percent,convert_lvList of columns to report for 'lvs' command. See 'lvs -o help' for the list of possible fields. lv_name,vg_name,seg_count,lv_attr,lv_size,lv_major,lv_minor,lv_kernel_major,lv_kernel_minor,pool_lv,origin,data_percent,metadata_percent,move_pv,copy_percent,mirror_log,convert_lv,lv_uuid,lv_profileList of columns to report for 'lvs' command in verbose mode. See 'lvs -o help' for the list of possible fields. List of columns to sort by when reporting 'vgs' command. See 'vgs -o help' for the list of possible fields. vg_name,pv_count,lv_count,snap_count,vg_attr,vg_size,vg_freeList of columns to report for 'vgs' command. See 'vgs -o help' for the list of possible fields. vg_name,vg_attr,vg_extent_size,pv_count,lv_count,snap_count,vg_size,vg_free,vg_uuid,vg_profileList of columns to report for 'vgs' command in verbose mode. See 'vgs -o help' for the list of possible fields. List of columns to sort by when reporting 'pvs' command. See 'pvs -o help' for the list of possible fields. pv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_freeList of columns to report for 'pvs' command. See 'pvs -o help' for the list of possible fields. pv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_free,dev_size,pv_uuidList of columns to report for 'pvs' command in verbose mode. See 'pvs -o help' for the list of possible fields. List of columns to sort by when reporting 'lvs --segments' command. See 'lvs --segments -o help' for the list of possible fields. lv_name,vg_name,lv_attr,stripes,segtype,seg_sizeList of columns to report for 'lvs --segments' command. See 'lvs --segments -o help' for the list of possible fields. lv_name,vg_name,lv_attr,seg_start,seg_size,stripes,segtype,stripesize,chunksizeList of columns to report for 'lvs --segments' command in verbose mode. See 'lvs --segments -o help' for the list of possible fields. List of columns to sort by when reporting 'pvs --segments' command. See 'pvs --segments -o help' for the list of possible fields. pv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_free,pvseg_start,pvseg_sizepv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_free,pvseg_start,pvseg_size,lv_name,seg_start_pe,segtype,seg_pe_rangesList of columns to sort by when reporting 'pvs --segments' command in verbose mode. See 'pvs --segments -o help' for the list of possible fields. List of columns to report for lvm fullreport's 'vgs' subreport. See 'vgs -o help' for the list of possible fields. List of columns to report for lvm fullreport's 'vgs' subreport. See 'pvs -o help' for the list of possible fields. List of columns to report for lvm fullreport's 'lvs' subreport. See 'lvs -o help' for the list of possible fields. List of columns to report for lvm fullreport's 'pvseg' subreport. See 'pvs --segments -o help' for the list of possible fields. List of columns to report for lvm fullreport's 'seg' subreport. See 'lvs --segments -o help' for the list of possible fields. List of columns to sort by when reporting lvm fullreport's 'vgs' subreport. See 'vgs -o help' for the list of possible fields. List of columns to sort by when reporting lvm fullreport's 'vgs' subreport. See 'pvs -o help' for the list of possible fields. List of columns to sort by when reporting lvm fullreport's 'lvs' subreport. See 'lvs -o help' for the list of possible fields. List of columns to sort by when reporting for lvm fullreport's 'pvseg' subreport. See 'pvs --segments -o help' for the list of possible fields. List of columns to sort by when reporting lvm fullreport's 'seg' subreport. See 'lvs --segments -o help' for the list of possible fields. Use brackets [] to mark hidden devices. Use the two words 'unknown device' in place of '[unknown]'. This is displayed when the device for a PV is not known. libdevmapper-event-lvm2mirror.soThe library dmeventd uses when monitoring a mirror device. libdevmapper-event-lvm2mirror.so attempts to recover from failures. It removes failed devices from a volume group and reconfigures a mirror as necessary. If no mirror library is provided, mirrors are not monitored through dmeventd. libdevmapper-event-lvm2raid.solibdevmapper-event-lvm2snapshot.soThe library dmeventd uses when monitoring a snapshot device. libdevmapper-event-lvm2snapshot.so monitors the filling of snapshots and emits a warning through syslog when the usage exceeds 80%. The warning is repeated when 85%, 90% and 95% of the snapshot is filled. libdevmapper-event-lvm2thin.soThe library dmeventd uses when monitoring a thin device. libdevmapper-event-lvm2thin.so monitors the filling of a pool and emits a warning through syslog when the usage exceeds 80%. The warning is repeated when 85%, 90% and 95% of the pool is filled. The plugin runs command with each 5% increment when thin-pool data volume or metadata volume gets above 50%. Command which starts with 'lvm ' prefix is internal lvm command. You can write your own handler to customise behaviour in more details. User handler is specified with the full path starting with '/'. The library dmeventd uses when monitoring a VDO pool device. libdevmapper-event-lvm2vdo.so monitors the filling of a pool and emits a warning through syslog when the usage exceeds 80%. The warning is repeated when 85%, 90% and 95% of the pool is filled. The plugin runs command with each 5% increment when VDO pool volume gets above 50%. Command which starts with 'lvm ' prefix is internal lvm command. You can write your own handler to customise behaviour in more details. User handler is specified with the full path starting with '/'. The full path to the dmeventd binary. Create a host tag using the machine name. The machine name is nodename returned by uname(2). Replace this subsection name with a custom tag name. Multiple subsections like this can be created. The '@' prefix for tags is optional. This subsection can contain host_list, which is a list of machine names. If the name of the local machine is found in host_list, then the name of this subsection is used as a tag and is applied to the local machine as a 'host tag'. If this subsection is empty (has no host_list), then the subsection name is always applied as a 'host tag'. # Example The host tag foo is given to all hosts, and the host tag bar is given to the hosts named machine1 and machine2. tags { foo { } bar { host_list = [ "machine1", "machine2" ] } } # A list of machine names. These machine names are compared to the nodename returned by uname(2). If the local machine name matches an entry in this list, the name of the subsection is applied to the machine as a 'host tag'. Defines the local system ID for lvmlocal mode. This is used when global/system_id_source is set to 'lvmlocal' in the main configuration file, e.g. lvm.conf. When used, it must be set to a unique value among all hosts sharing access to the storage, e.g. a host name. # Example Set no system ID: system_id = "" Set the system_id to a specific name: system_id = "host1" # A list of extra VG system IDs the local host can access. VGs with the system IDs listed here (in addition to the host's own system ID) can be fully accessed by the local host. (These are system IDs that the host sees in VGs, not system IDs that identify the local host, which is determined by system_id_source.) Use this only after consulting 'man lvmsystemid' to be certain of correct usage and possible dangers. The sanlock host_id used by lvmlockd. This must be unique among all the hosts using shared VGs with sanlock. Accepted values are 1-2000, except when sanlock_align_size is configured to 1, 2 or 4, which correspond to max host_id values of 250, 500, or 1000. Applicable only if LVM is compiled with support for lvmlockd+sanlock. dm_list_addunknownsys_wwidsys_serialmpath_uuidmd_uuidloop_filecrypt_uuidlvmlv_uuiddevnamewwid_naawwid_euiwwid_t10nvme_eui64nvme_nguidnvme_uuidחA Setting %scache_segtype/cache.ccommands/toolcontext.cSetting host tag: %swritecache/writecache.cwritecachewritecache_block_sizehigh_watermarklow_watermarkwriteback_jobsautocommit_blocksautocommit_timemax_agepause_writebackwritecache_setting_keywritecache_setting_valwritecache = "%s"writecache_block_size = %uhigh_watermark = %llulow_watermark = %lluwriteback_jobs = %lluautocommit_blocks = %lluautocommit_time = %llunofua = %ucleaner = %umax_age = %umetadata_only = %upause_writeback = %uwritecache_setting_key = "%s"writecache_setting_val = "%s"integrity/integrity.cdata_sectors = %llutag_size = %uinternal_hash = "%s"meta_dev = "%s"recalculate = %ujournal_sectors = %uinterleave_sectors = %ubuffer_sectors = %ujournal_watermark = %ucommit_time = %ubitmap_flush_interval = %usectors_per_bit = %lluallow_discards = %udevice_mapper/libdm-deptree.cNo integrity meta uuid.queue/daxLV %s dev %s is pmem.metadata/metadata.cLV %s dev %s not pmem.LV %s on pmemrealmisc/lvm-string.cdata_sectorstag_sizeinternal_hashmeta_devjournal_sectorsinterleave_sectorsbuffer_sectorsjournal_watermarkbitmap_flush_intervalsectors_per_bitchunk_size = %ucache_mode = "%s"metadata = "%s"metadata_format = %ucache_pool = "%s"cleaner = 1metadata_start = %lumetadata_len = %lumetadata_id = "%s" Chunk size %s Metadata format %u Mode %s Policy %sdevice_mapper/libdm-config.ccache_pool_corigmetadata_startmetadata_lenmetadata_idCache supports %s.SMQMissing cache's data uuid %s.migration_thresholdfilelinemessagelvmcache %s: now in VG %s %slocalhostWARNING: %s: fopen failed: %sLVM_SUPPRESS_SYSLOGmisc/lvm-globals.cLVM_LOG_FILE_EPOCH%s_%s_%d_%lluLVM_LOG_FILE_MAX_LINES%s%s%s failed: %sLogging initialised at %sLVM_ configuration invalid.host_filterhost_filter not supported yet%s/lvm%s%s.confFailed to create config treeprofile_params alloc failedraid/raid.cthin/thin.cInitialised segtype: %scache-poolvdo/vdo.cvdo-poolInitialised segtypes: %s, %s._init_hostnameunamearchive_init failed.backup_init failed./run/lvm/lvmpolld.socketLVM_LVMPOLLD_SOCKETdevice_mapper/mm/pool.c [%p] %s/dev/Ignoring %s: %s.device/dev-cache.cIgnoring %s: Not a directory.dir_list allocation failedReloading config filessequential_thresholdrandom_thresholdread_promote_adjustmentwrite_promote_adjustmentdiscard_promote_adjustmentDuplicate segment type %s: unloading shared library %s_set_tag: str_list_add %s failedorigin not specified in segment %s of logical volume %s.origin must be a string in segment %s of logical volume %s.Unknown LV specified for writecache origin %s in segment %s of logical volume %s.writecache not specified in segment %s of logical volume %s.writecache must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for writecache in segment %s of logical volume %s.writecache block_size must be set in segment %s of logical volume %s.Unknown writecache_setting in segment %s of logical volume %s.dm-writecache module version older than minimum 1.0.0Integrity target version older than minimum 1.6.0String list allocation failed for writecache module.String list allocation failed for integrity module.String list allocation failed for cache module.Internal error: Passed segment is not integrity._integrity_add_target_line zero sizeMissing integrity's meta uuid %s.Missing integrity's origin uuid %s.Internal error: Passed segment is not writecache.Internal error: Passed segment has no writecache.WARNING: ignoring writecache setting "cleaner" which is not supported by kernel for LV %s.WARNING: ignoring writecache setting "max_age" which is not supported by kernel for LV %s.Invalid mix of cache device types in %s.Failed to build LVM dlid for %s.Missing writecache's cache uuid %s.Missing writecache's origin uuid %s.Unknown LV specified for integrity origin %s in segment %s of logical volume %s.integrity data_sectors must be set in segment %s of logical volume %s.integrity mode must be set in segment %s of logical volume %s.integrity mode invalid in segment %s of logical volume %s.integrity tag_size must be set in segment %s of logical volume %s.integrity block_size invalid in segment %s of logical volume %s.integrity internal_hash must be set in segment %s of logical volume %s.integrity internal_hash failed to be set in segment %s of logical volume %s.meta_dev must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for integrity in segment %s of logical volume %s.integrity recalculate error in segment %s of logical volume %s.Unknown integrity_setting in segment %s of logical volume %s.Cache pool %s is missing cache policy, using %s.Cache pool %s uses implicit metadata format %u.Cache pool %s is missing cache mode, using %s.Internal error: Incorrect policy_settings tree, %s.Internal error: LV %s is using unknown cache metadata format %u.Couldn't read cache chunk_size in segment %s of logical volume %s.WARNING: Ignoring unsupported value for %s.cache_mode must be a string in segment %s of logical volume %s.Unknown cache_mode in segment %s of logical volume %s.policy must be a string in segment %s of logical volume %s.Failed to duplicate policy in segment %s of logical volume %s.policy_settings must have a policy_name in segment %s of logical volume %s.policy_settings must be a section in segment %s of logical volume %s.Cache data not specified in segment %s of logical volume %s.Cache data must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for cache data in segment %s of logical volume %s.Cache metadata not specified in segment %s of logical volume %s.Cache metadata must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for cache metadata in segment %s of logical volume %s.Unknown cache metadata format %u number in segment %s of logical volume %s.cache_pool not specified in segment %s of logical volume %s.cache_pool must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for cache_pool in segment %s of logical volume %s.Cache origin not specified in segment %s of logical volume %s.Cache origin must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for cache origin in segment %s of logical volume %s.Could not read cache cleaner in segment %s of logical volume %s.Couldn't read cache metadata_format in segment %s of logical volume %s.Couldn't read metadata_start in segment %s of logical volume %s.Couldn't read metadata_len in segment %s of logical volume %s.Couldn't read data_start in segment %s of logical volume %s.Couldn't read data_len in segment %s of logical volume %s.Couldn't allocate metadata_id in segment %s of logical volume %s.Couldn't read metadata_id in segment %s of logical volume %s.Couldn't format metadata_id in segment %s of logical volume %s.Couldn't allocate data_id in segment %s of logical volume %s.Couldn't read data_id in segment %s of logical volume %s.Couldn't format data_id in segment %s of logical volume %s.WARNING: The cache kernel module is version %u.%u.%u. Version 1.3.0+ is required.Cache policy %s is available%s.Target %s does not support %s.Target %s %s support disabled by %sInternal error: Passed segment is not cache.cache_add_target_line lv %s pool %sInternal error: LV %s has unknown cache mode %d.LV %s has metadata format %u unsupported by kernel.Using metadata2 format for %s.Internal error: LV %s has unknown metadata format %u.Internal error: LV %s using unsupported ranges with cache pool.Internal error: LV %s has invalid ranges metadata %llu %llu data %llu %llu.Unsupported cache's feature flags set %lu.Invalid cache's feature flag %lu.Data block size %u is lower then %u sectors.Data block size %u is higher then %u sectors.Missing cache's metadata uuid %s.Missing cache's origin uuid %s.Cache policy parameter %s is without integer value.WARNING: %s cache policy does not support "%s=%lu" setting, remove with 'lvchange --cachesettings "%s=default" ...'.Internal error: Unable to find configuration for log/%s.log/%s contains a value which is not a string. Ignoring.Unrecognised value for log/%s: %sInternal error: _destroy_config: cmd config tree not destroyed fullylvmcache adding vg list alloc failed %slvmcache adding vg name alloc failed %sWARNING: fix duplicate VGID %s for VGs %s and %s (see vgchange -u).Ignoring %s with conflicting VG info %s %s.lvmcache adding vginfo for %s %slvmcache adding vginfo found duplicate VG name %sInternal error: lvmcache_update_vgname %s %s %s %sWARNING: VG name %s is used by VGs %s and %s.WARNING: fix duplicate VG names with vgrename uuid, or vgrename --deviceslvmcache adding vginfo to name hash failed %slvmcache adding vg to name hash failed %sWARNING: Empty system ID supplied.WARNING: Invalid system ID format: %sWARNING: system ID may not begin with the string "localhost".WARNING: Failed to allocate system ID.WARNING: Ignoring extra line(s) in system ID file %s.TEST MODE: Metadata will NOT be updated and volumes will not be (de)activated.WARNING: Ignoring invalid LVM_LOG_FILE_EPOCH envvar "%s".Failed to obtain pid and starttime.WARNING: Debug log file path is too long for epoch.WARNING: Ignoring invalid LVM_LOG_MAX_LINES envvar "%s".Internal error: Unable to find configuration for log/debug_classes.log/debug_classes contains a value which is not a string. Ignoring.Unrecognised value for log/debug_classes: %sSetting log debug classes to %dUnrecognised configuration setting for global/units: %sConfigured time format is empty string.Configured time format contains non-printable characters.Invalid time format "%s" supplied.Invalid tag in config file: %sInvalid hostname string for tag %sLVM_SYSTEM_DIR or tag was too longconfig_tree_list allocation failed_init_profiles: dm_strncpy failedFailed to allocate memory for %s segtypeFailed to allocate memory for cache_pool segtypeFailed to allocate memory for cache segtypeFailed to allocate memory for VDO segtypes.Failed to allocate memory for writecache segtypeFailed to allocate memory for integrity segtype_init_hostname: dm_pool_strdup kernel_vsn failed_init_hostname: dm_pool_strdup failedWARNING: Metadata changes will NOT be backed upReleasing activation in critical section.libdevmapper exiting with %d device(s) still suspended.device_mapper/ioctl/libdm-iface.cYou have a memory leak (not released memory pool):Internal error: Unreleased memory pool(s) found.Internal error: Unable to find configuration for devices/scan.Invalid string in config file: devices/scanNon standard udev dir %s, resetting devices/obtain_device_list_from_udev.Failed to add %s to internal device cacheInternal error: Unprocessed pending delete for %d devices.raid0raid0_metaraid1raid10 raid10_near raid4@raid5raid5_nraid5_laraid5_lsraid5_raraid5_rsraid6@raid6_n_6raid6_ncraid6_nr raid6_zr@raid6_ls_6raid6_rs_6raid6_la_6raid6_ra_6aAbBcCdDeFGghHIjklmMpPrRsStTuUVwWxXyYzZ%deHImMSuUVwWycCxXyYglobal/cache_disabled_featurescache metadata2 policy_smqcache-smq and aliases cache-mqpolicy_smqcache-smqpolicy_mqcache-mq@DEFAULT_SYS_DIR@/@DEFAULT_CACHE_SUBDIR@@DEFAULT_SYS_DIR@/@DEFAULT_BACKUP_SUBDIR@@DEFAULT_SYS_DIR@/@DEFAULT_ARCHIVE_SUBDIR@@DEFAULT_SYS_DIR@/@DEFAULT_PROFILE_SUBDIR@_get_config_node_version: couldn't create version stringInternal error: Profile %s already added as %s type, but requested type is %s._config_array_line: dm_pool_strdup failedPersistent cache directory name too long.Couldn't create default backup path '%s/%s'.Couldn't create default archive path '%s/%s'.Couldn't create default profile path '%s/%s'.struct device allocation failedWARNING: bcache_invalidate: block (%d, %llu) still dirty.WARNING: bcache_invalidate: block (%d, %llu) still held.bcache_abort: block (%d, %llu) still heldUsing metadata size 960 KiB for non-standard page size %d.WARNING: async io still in flight.Limit write at %llu len %llu beyond last byte %lluSkip extending write at %llu len %llu limit %llu extra %llu sector_size %lluLimit write at %llu len %llu to len %llu rounded to %lluLimit write at %llu len %llu to len %lluInvalid adjusted write at %llu len %llu adjusted %llu limit %llu extra %llu sector_size %llucouldn't allocate control blockDevice seek error %d for offset %lluDevice seek failed for offset %lluDevice read error %d offset %llu len %lluDevice write error %d offset %llu len %lluDevice read short %u bytes remainingDevice write short %u bytes remainingFailed to add alias to dev cache.Couldn't add name to hash in dev cache.Failed to allocate configuration check handle.Internal error: config_file_check: expected file, special file or profile config source, found %s config source.Failed to open config file %s.Internal error: _cfg_def_make_path: supplied buffer too small for %s/%s%s# This configuration %s is deprecated. %s# This configuration %s is advanced. %s# This configuration %s is not officially supported. %s# This configuration %s has variable name. %s# This configuration %s does not have a default value defined. %s# This configuration %s has an automatic default value. %s# Value defined in existing configuration has been used for this setting. %s# Available since version %s. %s# Deprecated since version %s. _get_def_array_values: strdup failedInternal error: Default array value malformed for "%s", value: "%s", token: "%s".Failed to create default empty array for %s.Failed to duplicate token for default array value of %s.Failed to create default config array value for %s.Internal error: Inconsistent state reached in _check_value_differs_from_default.Failed to create default config setting node.Internal error: _add_def_node: unknown typeFailed to create default config setting node value.Failed to construct path for configuration node %s.Configuration setting "%s" unknown.Configuration section "%s" unknown.WARNING: Configuration setting "%s" has invalid type. Found%s but expected%s.Configuration setting "%s" invalid. Empty value not allowed.Configuration setting "%s" invalid. Found string value "%s", expected boolean value: 0/1, "y/n", "yes/no", "on/off", "true/false".Configuration setting "%s" invalid. It cannot be set to an empty value.Configuration %s "%s" is not customizable by a profile.Configuration %s "%s" is customizable by metadata profile only, not command profile.Configuration %s "%s" is customizable by command profile only, not metadata profile.Configuration %s "%s" is not allowed here.Internal error: %s cfg tree element not declared as boolean._log_array_value_used: failed to write node value%s not found in config: defaulting to %sInternal error: couldn't determine missing config nodes - unknown status of last config check.Failed to create default config section node.%s: bad profile name, it contains '/'.Internal error: add_profile: loaded profile has incorrect type, expected %s but %s foundInternal error: Trying to load profile %s in critical section.LVM_SYSTEM_DIR or profile name too longInternal error: _override_config_tree_from_command_profile: config cascade already contains a command profile config.Internal error: _override_config_tree_from_metadata_profile: config cascade already contains a metadata profile config.Internal error: override_config_tree_from_profile: incorrect profile source typeFailed to create configuration definition hash.Failed to insert configuration to hash.Configuration setting "%s" invalid. It's not part of any section._check_profile: profile check handle allocation failedInternal error: override_config_tree_from_string: config cascade already contains a string config.Failed to set overridden configuration entries.Ignoring invalid configuration string.Failed to allocate config source.Internal error: %s cfg tree element not declared as string.Internal error: %s cfg tree element not declared to allow empty values.Persistent cache filename too long.Internal error: %s cfg tree element not declared as integer.%s not found in config: defaulting to %ldWARNING: Configured cache_pool_max_chunks value %lu is higher then recommended %lu.str_to_str_list: string list allocation failed.str_to_str_list: string list item allocation failed.bcache no new blocks for di %d index %u with >%d errors.bcache no new blocks for di %d index %ubcache unable to insert block in radix tree (OOM?)concurrent write lock attemptedbcache failed to get block %u di %dref count on bcache block already zero_get_sysfs_value: %s: no valueDevice directory given in config file too longWARNING: unknown external device info source, using none.WARNING: failed to init udev for external device info, using none.WARNING: proc dir %s not found - some checks will be bypassedNo proc filesystem found: skipping sysfs detectionFailed to create /proc/mounts string for sysfs detectionFailed to find sysfs mount pointInvalid readahead specificationWARNING: Ignoring unknown validate_metadata setting: %s.DM_DISABLE_UDEV environment variable set.Overriding configuration to use udev_rules=0, udev_sync=0, verify_udev_operations=1.manage logical volume symlinks in device directoryLVM activation checks disabledWARNING: activation/missing_stripe_filler = "%s" is invalid,Falling back to "error" missing_stripe_filler.WARNING: activation/missing_stripe_filler = "%s" is not a block device.Ignoring invalid activation/mlock_filter entry in config fileIgnoring too small pv_min_size %ldKB, using default %dKB.WARNING: local/system_id is set, so should global/system_id_source be "lvmlocal" not "%s"?WARNING: sd_id128_get_machine_app_specific() failed %s (%d).%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02xWARNING: Unrecognised system_id_source "%s".WARNING: No system ID found from system_id_source %s.%sdevices/virtual/dmi/id/product_uuid_insert_sysfs_dev: %s: dm_snprintf failedCouldn't add device to binary tree of sysfs-only devices in dev cache.%s: dm_snprintf failed for path to holders directory.%s: path does not exist, skipping%s: dm_snprintf failed for holder %s device path._get_device_for_sysfs_dev_name_using_devno: %s: dm_snprintf failed_get_device_for_sysfs_dev_name_using_devno: %s: failed to get major and minor number%s: failed to find associated device structure for holder %s.%s: failed to allocate dev list item.Found dev %u:%u %s - exists. %.8sCouldn't insert device into binary tree.Found dev %u:%u %s - new alias.Found dev %u:%u %s - new device, path was previously %u:%u.Found dev %u:%u %s - failed to use.Found dev %u:%u %s - existing device, path was previously %u:%u.Skipping "%s" (no block devices).Creating list of system devices.WARNING: Cannot use dir %s, %s.Failed to udev_enumerate_add_match_subsystem.Failed to udev_enumerate_scan_devices.udev failed to return a device for entry %s.udev failed to return a device node for entry %s.udev failed to return a symlink name for entry %s.%s: Failed to insert devices from udev-managed directory to device cache fully%s: Failed to insert devices to device cache fullyconfig/config.cdevice/bcache.cio_destroyWARNING: %s failed: %s.misaligned data bufferio_geteventsunable to allocate sync_iodisk/lstat/dev/nvme%s is not a regular file%s is empty<#option%s# Configuration %s %s. %s# %s%s#%s%s - %s%s%s%s%s%s%s # %.*s%s%s section integer float stringSetting %s to %sUndefined profile name.profile allocation failed%s/%s.profileIgnoring invalid %s %s.%s%s%s/%s.cache%s/%s/%s.cachedatastruct/str_list.cstr_list allocation failedfgetsSet umask from %04o to %04o%s/%s/mounts_get_sysfs_dir fopensysfsDM_DISABLE_UDEVLVM will %s.LVM activation checks enabled/dev/ioerror stat failed: %sunknown devicelvmlocalappmachineid%s/machine-idproduct_uuid%s: Not available device node%sdev/block/%u:%u/holders/opendir%sblock/%s/devclosedirFound dev %u:%u %s - new.Dir path %s is too longPath %s/%s is too long.Drop alias for %u:%u %s.Failed to udev_enumerate_new.wxwwxwwwSxwwwwwww-xwwwwwwwwwwwwwwwwbsg/bus/char/cpu/dma_heap/dri/input/snd/usb/dm_list_add_hundefinedfilemerged filesstringcommand profilemetadata profilespecial purposeD,!@T"4Device '%s' has been left open (%d remaining references).%sdev/block/%d:%d/device/blockFound %s for %d:%d from sys dm.Failed to create sysfs path for %sWARNING: cannot open devices file to read.check devices file version %s prev %sMismatching UUID or devno found %s %u:%u %s %u:%u.Creating DM cache for devno and uuid.Internal error: %d device(s) were left open and have been closed.devices/preferred_names %s: using built-in preferencespreferred_names patterns must be enclosed in quotesFailed to allocate preferred device name pattern list.Preferred device name pattern matcher creation failed.Failed to allocate a preferred device name pattern.Couldn't create binary tree for sysfs-only devices in dev cache.Couldn't create binary tree for dev-cache.Drop alias for %u:%u invalid path %s %u:%u.Ignoring dev with no valid paths for %s.Device path %s is invalid for %u:%u %s.Dropping aliases for device entry %u:%u %s for new device %u:%u %s.Dropping aliases for %u:%u before adding new path %s.dev_cache_get filter excludes %sInvalid devices file name from config setting "%s".Failed to copy devices dir pathFailed to copy devices file pathCannot access device %s for %u:%u.No device name found from %u:%u.Cannot access device %s from %u:%u.Found %s devno %u:%u expected %u:%u.Device lookup failed for %u:%u %s%s: failed to insert device list to device cache index.%s: failed to allocate device list for device cache index.device_id_system_read reduced underscores %s to %sMatch dm names %s %s for %u:%u (from cache).Match dm names %s %s for %u:%u (from stat)Match %s %s to %s: using extra %s %sdevice_ids_write create %d edit %d pending %d exists %d version %s devicesfile %sNot creating system devices file due to existing VGs.WARNING: not updating devices file with unparsed version.WARNING: not updating devices file with larger major version.Failed to allocate buffer size %d for devices file.Failed to write buffer for devices file content.IDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s PART=%d IDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s # LVM uses devices listed in this file. # Created by LVM command %s%s pid %d at %s# HASH=%u Failed to write devices file header.Failed to replace devices file.Wrote devices file %s hash %u hashed size %u total size %u%s/devices/backup/system.devices-%s.%04u%s/devices/backup/system.devices-%s.%uWARNING: Failed to create backup file %sWARNING: Failed to write backup file %sWARNING: Failed to sync backup file %sWARNING: Failed to sort backup devices files.Limit backup %u found %u sorted %d removing %u.WARNING: devices to use does not include %sdevice_id update %s pvid %s vgid %s to %sCannot create devices file, missing devices directory %s.WARNING: devices file already locked %dWARNING: devices file lock file already open %dlock_devices_file open errno %dlock_devices_file flock errno %dSkip devices file update (busy).Skip devices file update (changed).Validating devices file entriesValidating %s %s PVID %s: initial match %sValidate %s %s PVID %s on %s: replace old wwid with %sDevice %s PVID %s is using only old wwid %s.Validate %s %s PVID %s on %s: not scannedValidate %s %s PVID %s on %s: not readValidate %s %s PVID %s on %s: filtered (%s)suspect device id serial %s for %sValidate %s %s PVID %s on %s: wrong PVID %sDevice %s has PVID %s (devices file %s)Device %s has no PVID (devices file %s)Validate %s %s PVID %s on %s: correctValidate %s %s PVID %s on %s: outdated DEVNAME %sWARNING: fixing devices file IDNAME %s for PVID %s device %sValidate %s %s PVID %s: found on %sValidate %s %s PVID %s: no device foundValidate %s %s PVID %s: no device found, remove incorrect PVIDValidate %s %s PVID none: remove entry with repeated devnameValidate %s %s PVID %s: no idname, set invalid.Validate %s %s PVID %s: no device for idtype devname, set invalid.Validated device ids: invalid=%d, update disabled.Validated device ids: invalid=%d, trying to update devices file.Validated device ids: hash mismatch, update disabled.Validated device ids: hash mismatch, trying to update devices file.Validated device ids: invalid=%d, no update needed.Override device_ids_invalid for complete hints.Validate %s %s PVID %s on %s: wrong PVID %s.Finding all devs with suspect serial numbers.Reading and filtering %d devs with suspect serial numbers.Checking %d PVs with suspect serial numbers.Matching suspect serial device id %s PVID %s prev %sMatch suspect serial device id %s PVID %s to %sMatch PVID failed in %d devs checked.Matching suspect serial device id %s unmatched PVID %s prev %sNo device matches devices file PVID %s with duplicate serial number %s previously %s.Device %s with serial number %s has PVID %s (devices file %s)Drop incorrectly matched serial %sDevices file %s %s PVID %s not found.Search for PVIDs %d trigger %d all_ids %d search all %d auto %d none %dSearch for PVIDs skipped for matching %sSearch for PVIDs reading labels.Search for PVIDs skip %s (stable id)WARNING: found PVID %s on multiple devices %s %s.WARNING: duplicate PVIDs should be changed to be unique.WARNING: use lvmdevices to select a device for PVID %s.Search for PVID %s found on %s.Devices file PVID %s has new device ID %s %s from %s.Found new device name %s for PVID %s.WARNING: new device %s for PVID %s is excluded: %s.Search for PVIDs update disabledSearch for PVIDs updating devices fileSearch for PVIDs found no updatessearched_devnames_create error fopen %dsearched_devnames_create error open dir %d# Created by LVM command %s pid %d system.devices %s at %ssearched_devnames_create error fflush %d fclose %dsearched_devnames_create error rename %dsearched_devnames created pvids %d %u devs %d %uCannot open devices file to read.Devices file invalid hash value errno %dDevices file hostname %s vs local %s.read devices file product_uuid %sDevices file product_uuid %s vs local %s.WARNING: failed to process devices file entry.Devices file comment hash %u calc hash %uDevices file refresh: missing product_uuidDevices file refresh: missing product_uuid and hostnameDevices file not found, ignoring.Failed to lock the devices file to read.Failed to read the devices file.Matching devices file entries to devicesMatch %s %s PVID %s: done previously %sMatch %s %s PVID %s: done %s (immediate)Match %s %s PVID %s: wrong devname %sMatch %s %s PVID %s: no device matchesMatch %s %s PVID %s: no idnameMatch %s %s PVID %s: idname not foundMatch %s %s PVID %s: dev %s already matched to an entryDevice %s not matched to device_idDevices file PVID %s last seen on %s not found.Devices file PVID %s not found.Devices file %s %s PVID %s last seen on %s not found.Failed to lock the devices file to create.Failed to lock the devices file.system.devices-/dev/%sFound %s for %d:%d from sys%sdev/block/%d:%d/dm/name%u %u %llu %128sFound %s for %d:%d from %s%sdev/block/%u:%u/%sdevice/device_id.cVERSIONDestroying DM devno cache.Destroying DM uuid cache.Preserving DM cache.not found in configdev_cachepreferred device name matcherstrdup dev_dir failed.Not a block device %s.Failed to get device %smetadata_versionDevice %s %s is %s.device/dev-md.c1.00.90%s/devices/dmeventd.devices%s/devices/%s%Y%m%d.%H%M%S%s/devices/%s-unused.%sDevices file moved to %s%s/devicesCreating %s.Failed to create %s %dInvalid device type %s.parteui.naa.t10.device/vpd_pg83t10.%seui.%snaa.%sdevice/serialdevice/vpd_pg80/dev/vd%s/class/block/%s/serialmd/uuidloop/backing_file(deleted)__QEMUmpath-CRYPT-LVM-/dev/dm-/dev/mapper/Match %s %s to %s (auto)pvcreatevgcreateCreating devices file %s%s_newunlinkw+Cannot open to write %s.PRODUCT_UUID=%s HOSTNAME=%s VERSION=%u.%u.%uFailed to write devices file.%s/devices/backup/Wrote backup %sdirfdRemove backup %sunlinkatDevice not found for %s.%s/D_%sDevices file update skipped.not setDrop incorrectly matched %susablempathserial missing for %sserial %s pvid %s %sserial %s nolabel %sserial %s no pvid %sfwraidserial %s pvid %s filtered %sSearch for PVID %s.Search for PVIDs filtering.Search for PVIDs on %slvmdeviceswxpvids: %d %u devs: %d %u device_ids_read already donedevice_ids_read %s# HASH=0# HASHSYSTEMIDHOSTNAMEread devices file hostname %sPRODUCT_UUIDread devices file version %sIDTYPEIDNAMEDEVNAMEPVIDPARTCannot access device %s.Match %s %s PVID %s: done %sDevices file not found: %s?P   (? 2021 2 22  /run/lvm/run/lvm/searched_devnames_new/run/lvm/searched_devnames/proc/partitionsdevice/dev-ext.cdevice/dev-io.cClosed %sdevice/dev-luks.cLUKSblacklist_exceptionsblacklistdevice/dev-mpath.cmultipath wwid %s in %s %snot %sdev/block/%u:%ureadlinkDevice name is not valid.%sblock/%s/holdersPath %s is not a directory.Device %s has no holders dirdevice/dev-type.cAborted wiping of %s.Wiping %s on %s.Failed to wipe %s on %s.device/nvme.cNOT display/display.cPV Name %s PV UUID %sTotal PE / Free PE %u / %u (test mode - suppressed)%s: size is %lu sectorsIntel Raid ISM Cfg Sig. ID_FS_TYPElinux_raid_memberdevice/dev-swap.cSWAP-SPACESWAPSPACE2S1SUSPENDS2SUSPENDULSUSPEND/etc/multipath.confloopdevice-mapperblkextdrbddasdemcpowerVxDMPpower2%sdev/block/%u:%u/partitionsysfs file %s does not exist.%s/dev/block/%u:%u/md/%sdm_snprintf md %s failed%s/block/md%u/md/%sdm_snprintf old md %s failedmpath_memberDM_MULTIPATH_DEVICE_PATHunusedFailed libblkid probe for %sNo file system found on %s.No file system type on %s.BLOCK_SIZEFSLASTBLOCKFSBLOCKSIZEFSSIZEswapLVM2_memberLVM1_memberSBMAGIC_OFFSETSBMAGICPTTYPEPTMAGIC_OFFSETPTMAGICpartition tableUSAGELABELDM_snapshot_cowsoftware RAID md superblockswap signatureLUKS signaturedevice/dev-dasd.cioctl BIODASDINFO2%sdev/block/%u:%u/holdersdevice/filesystem.cMissing %s for %s.Cannot open %s.Unrecognized holder %s of %sFound holder %s of %s.No holder in %sWARNING: Failed to open %s.device/online.cWARNING: No info in %s.vg:No vgname in %sdev:No devname in %s/run/lvm/pvs_onlineFound PVs online %d for %s/run/lvm/vgs_onlineUnlink vg online: %sCreate vg online: %sFailed to create %s: %d%u:%u vg:%s dev:%s Check pv online: %sCheck pv online %s: yesCheck pv online %s: no/run/lvm/pvs_lookupUnlink pvs_lookup: %snext freeclvmFailed to get LV path %s/etc/mtab%s mtab mntpath %s/proc/mounts%4096s %4096s %16sLVRESIZE_FS_HELPER_PATH--fsreduce--fstype--lvpath--newsizebytes--mountdir--unmount--mount--fsck/dev/dm-%u--cryptresize--cryptpathmanage--remountReduced file system %s on %s.--fsextend%.2fPercentage %d does not fit.SCSI diskIDE diskMultiple Disk (MD/SoftRAID)Loop deviceRAM diskMapped devicePartitionable MDDAC960Network Block DeviceCompaq SMART2Compaq CCISS arrayATA RaidEMC Powerpathi2o Block DiskiSeries disksNetwork block deviceATA over EthernetXen virtual block devicePlayStation 3 internal diskVirtIO diskMMC block deviceExtended device partitionsFusion IOMicron PCIe SSDViolin MemorySTECbcache block device cacheNVM ExpressZFS ZvolsVeritas Dynamic Multipathingzram block deviceUdev database has incomplete information about device %s.Found md ddf magic at %llu wrong crc %x disk %x %sSysfs path string is too long.Cannot find device name in sysfs path.Cannot find '/' in device name.Failed to get primary device for %u:%u.Sysfs path to check mpath is too long.dm device path to check mpath is too long.dev_is_mpath_component %s holder %s stat result %ddev_is_mpath_component %s holder %s %d:%d does not have dm majordev_is_mpath_component %s holder %s %u:%u already checked as %sbeing mpath.dev_is_mpath_component %s holder %s %u:%u ignore mpath componentFatal error while trying to detect %s on %s.WARNING: %s detected on %s. Wipe it? [y/n]: dev_read_nvme_wwids ignore invalid nguid %s for %sdev_read_nvme_wwids ignore invalid eui64 %s for %sPV Status %sallocatableWARNING: devices file unlock no fdWARNING: devices file unlock not lockedWARNING: devices file unlock errno %d%s: Failed to get external handle [%s].%s: External handle [%s:%p] attached%s: Failed to release external handle [%s:%p]%s: External handle [%s:%p] detachedAttempt to close device '%s' which is not open.%s: Immediate close attempt while still referencedDiscarding %lu bytes offset %lu bytes on %s. %sWARNING: %s: ioctl BLKDISCARD at offset %lu size %lu failed: %s.%s: using cached size %lu sectorsWARNING: %s: ioctl BLKGETSIZE64 %sFound md magic number at offset 0 of %s.Found md magic number at offset 4096 of %s.Found md magic number at offset %llu of %s.Found md imsm magic number at offset %llu of %s.Found md ddf magic number at offset %llu of %s.multipath config ignored %d wwidsFailed to allocate device type register.No proc filesystem found: using all block device typesFailed to create /proc/devices stringWARNING: /proc/devices line: %s, replacing major with %d.Expecting string in devices/types in config fileMax partition count missing for %s in devices/types in config fileZero partition count invalid for %s in devices/types in config fileFailed to read sysfs path for %sFailed to read sysfs partition value for %sWARNING: %s: partition path is too long.WARNING: %s: major:minor sysfs path is too long.WARNING: Readlink of %s failed.WARNING: sysfs path for %s is too long.WARNING: sysfs file %s not in expected MAJ:MIN format: %s_md_sysfs_attribute_scanf fopen failed %s_md_sysfs_attribute_scanf fgets failed %s%s sysfs attr %s not in expected format: %sdev_is_mpath_component %s no primary devdev_is_mpath_component %s %s in wwids fileFailed libblkid probe setup for %sFound blkid fstype %s fsblocksize %s on %slibblkid TYPE %s BLOCK_SIZE %d FSLASTBLOCK %llu FSBLOCKSIZE %u fs_last_byte %lluFailed to create a new blkid probe for device %s.Failed to get offset of the %s signature on %s.WARNING: Failed to get offset of the %s signature on %s. Wiping skipped.Failed to get length of the %s signature on %s.WARNING: Failed to get length of the %s signature on %s. Wiping skipped.Found existing signature on %s at offset %s: LABEL="%s" UUID="%s" TYPE="%s" USAGE="%s"WARNING: %s signature detected on %s at offset %s. Wipe it? [y/n]: Failed to wipe %s signature on %s.Failed to step back blkid probe to check just wiped signature.%d existing signature%s left on the device.WARNING: sysfs file %s not in expected format: %sCouldn't create holder path for %s.WARNING: No device numbers in %s.WARNING: Ignoring invalid vg field in %s.WARNING: Ignoring invalid vgname in %s (%s).WARNING: Ignoring invalid devname field in %s.WARNING: Ignoring invalid devname in %s (%s).Found PV online %s for VG %s %spvscan[%d] Path %s/%s is too long.Cannot create online file path for %s %u:%u.pvscan[%d] Cannot create online file path for %s %u:%u.Incomplete online file for %s %d:%d vg %s.Incomplete devname in online file for %s.Create pv online: %s %u:%u %s.Failed to create online file for %s path %s error %dpvscan[%d] Failed to create online file for %s path %s error %dCannot write online file for %s to %s error %dExisting online file for %d:%dPV %s %d:%d is duplicate for PVID %s on %d:%d %s.pvscan[%d] PV %s %d:%d is duplicate for PVID %s on %d:%d %s.PV %s has unexpected VG %s vs %s.pvscan[%d] PV %s has unexpected VG %s vs %s.Internal error: Path %s/%s is too long.Incorrect VG lookup file %s PVID %s %s.Found PV online lookup %s for VG %s on %s.Found PVs online lookup %d for %s.dev_read_nvme_wwids cannot open %sdev_read_nvme_wwids nvme_get_nsid error %d %sdev_read_nvme_wwids nvme_identify_ns error %d %sdev_read_nvme_wwids nvme_identify_ns_descs error %d %sdev_read_nvme_wwids ignore invalid uuid %s for %sUnrecognised allocation policy %sFull LV name "%s/%s" is too long.LV %s mounted at %s also mounted at %s.LV %s mounted at %s may have been renamed (from %s).File system resizing not supported: fs utilities do not support renamed devices./usr/libexec/lvresize_fs_helperReducing file system %s to %s (%llu bytes) on %s...Failed to reduce file system with lvresize_fs_helper.Extending file system %s to %s (%llu bytes) on %s...Failed to extend file system with lvresize_fs_helper.Extended file system %s on %s.DASD disk (IBM S/390, zSeries)User-mode virtual block deviceDistributed Replicated Block Device (DRBD)Ceph rados object as a Linux block deviceSUN's LDOM virtual block deviceStorage Class Memory (IBM S/390)contiguouscclinglcling_by_tagstnormalnanywhereainheritiWiping %s signature on %s./etc/multipath/conf.d%s: Skipping: Unrecognised LVM device type %luInternal error: Destroying regex filter while in use %u times.read/write (activated read only)--- Historical Logical volume ---LV Name %s%s/%sLV Path %s%s/%sLV snapshot status source of %s%s/%s [%s] %s [%s]LV snapshot status %s destination for %s%s/%sLV snapshot status %s destination for %sChecking thin status for LV %s.WARNING: LV %s maps %s while the size is only %s.Internal error: Unrecognized operating mode: %u.Internal error: Unrecognized compression state: %u.LV Status suspendedLV Status %savailable%sCache read hits/misses %lu / %luCache wrt hits/misses %lu / %luLV type Mirror undergoing conversiondtree node segment allocation failederror module string list allocation failedInternal error: Destroying composite filter while in use %u times.Internal error: Destroying sysfs filter while in use %u times.Internal error: Destroying md filter while in use %u times.Internal error: Destroying firmware RAID filter while in use %u times.Internal error: Destroying mpath filter while in use %u times.Internal error: Destroying partitioned filter while in use %u times.Internal error: Destroying lvm_type filter while in use %u times.Internal error: Destroying usable device filter while in use %u times.Internal error: Destroying signature filter while in use %u times.Internal error: Destroying deviceid filter while in use %u times.%s: Failed to enable external handle [%s].%s: Failed to disable external handle [%s].Internal error: Destroying persistent filter while in use %u times.%u:%u: filter cache skipping (no name).%s: filter cache skipping (cached bad).%s: filter cache using (cached good).Ignore invalid filter result %d %s.Failed to hash alias to filter.Internal error: PV name for %s missing in metadata export radix tree.Please remove the lvm.conf filter, it is ignored with the devices file.Please remove the lvm.conf global_filter, it is ignored with the devices file.md filter full %d excluding md component %s%s: Skipping md component device%s: Skipping md component device [%s:%p]%s: Skipping: error in md component detection%s: Firmware RAID detection is not supported by LVM natively. Skipping firmware raid detection. Internal error: Missing hook for firmware RAID recognition using external device info source %s%s: Skipping firmware RAID component device%s: Skipping firmware RAID component device [%s:%p]%s: Skipping mpath component deviceWARNING: devices file is missing %s (%u:%u) using multipath component %s.See lvmdevices --update for devices file update.%s: Skipping: Partition table signature found%s: Skipping: Partition table signature found [%s:%p]%s: Skipping: dev_get_size failed%s: Skipping: error in signature detectionDoubling metadata output buffer to %uRandom lvid creation failed for %s/%s.WARNING: reading %s mda%d failed to read metadata.WARNING: repair VG metadata on %s with vgck --updatemetadata.Filter patterns must be enclosed in quotes.Pattern must begin with 'a' or 'r'.Invalid separator at end of regex.filter-sysfs disabled: /sys/dev/block not foundCouldn't scan the archive directory (%s).Couldn't create new archive file.Created path %s/%s is too long.Couldn't create text instance object.Internal error: Passed file path name %s is too long.Couldn't copy archive directory name.Couldn't copy backup directory name.Couldn't create text format object.Consider using option --force to restore Volume Group %s with thin volumes.WARNING: Forced restore of Volume Group %s with thin volumes.Failed to allocate format instance.Failed to find cached info for PV %s.Failed to allocate structure for scheduled writing of PV '%s'.Format-specific setup for %s failed.Cannot restore Volume Group %s with %i PVs marked as missing.Failed to duplicate empty name.Failed to generate backup filename (for restore).Creating volume group backup "%s" (seqno %u).Couldn't create backup object.Internal error: No in use metadata areas to write.Failed to generate volume group metadata backup filename.WARNING: This metadata update is NOT backed up.Test mode: Skipping backup of volume group.Skipping backup of volume group on read-only filesystem.Backup of volume group %s metadata failed.# Generated by LVM2 version %s: %scontents = "Text Format Volume Group"creation_host = "%s" # %s %s %s %s %screation_host_system_id = "%s"pv device name size is out of bounds.Internal error: problem tracking indentationCould not allocate memory for ancestor list buffer.Couldn't create temporary archive name.Couldn't create FILE object for archive.Consider pruning %s VG archive with more than %u MiB in %u files (see archiving settings in lvm.conf).Test mode: Skipping archiving of volume group.Cannot archive volume group metadata for %s to read-only filesystem.Archiving volume group "%s" metadata (seqno %u).Skipping check for current backup, since backup is disabled.WARNING: Failed to generate backup pathname %s/%s.Internal error: Missing PV for area %u of %s segment of LV %s.RAID segment has non-RAID areasInternal error: Invalid type for area %u of %s segment of LV %s.filters/filter-type.c%s: Skipping (deviceid)filters/filter-deviceid.cfilters/filter-regex.cread/writeread onlyINACTIVErecoveringnormaloffline (partial)LV Name %s%sVG Name %sLV UUID %sLV Creation time %sLV Removal time %s--- Logical volume ---LV Name %sInternal LV Name %sLV Write Access %sLV Creation host, time %s, %sLV Pool name %sLV Thin origin name %sLV External origin name %sLV merging to %sLV merged with %sLV Pool metadata %sLV Pool data %sLV origin of Cache LV %sLV Cache pool name %sLV Cache origin name %sLV VDO Pool data %sLV VDO Pool usage %s%%LV VDO Pool saving %s%%metadata/vdo_manip.cLV VDO Operating mode %sLV VDO Index state %sLV VDO Compression st %sLV VDO Used size %sLV VDO Pool name %s# open %uLV Size %sCache used blocks %s%%Cache metadata blocks %s%%Cache dirty blocks %s%%Cache demotions %luCache promotions %luAllocated pool data %s%%Allocated metadata %s%%Mapped size %s%%Current LE %uCOW-table size %sCOW-table LE %uAllocated to snapshot %s%%Snapshot chunk size %sMirrored volumes %uSegments %uAllocation %sRead ahead sectors autoRead ahead sectors 0Read ahead sectors %u- currently set to %uBlock device %d:%dPersistent minor %dPersistent major %derroerror/errseg.cfilters/filter-composite.cfilters/filter-sysfs.cfilters/filter-md.cfilters/filter-fwraid.cfilters/filter-mpath.cfilters/filter-partitioned.cfilters/filter-usable.cfilters/filter-signature.cimporting unknown segmentunknown/unknown.cstart_extentextent_countfilters/filter-persistent.cgoodbadfilter caching %s %s.format_text/export.c%s: New preferred name%s: Skipping (regex)failed to create sysfs path%s: Skipping (sysfs)*before**after*Failed to allocate desc.format_text/archiver.cCreated %s executing '%s'Failed to build desc.ID_PART_TABLE_TYPEDEVTYPE%s: Skipping unusable device.%s: Skipping: %s%s: Skipping lvm1 device%s: Skipping gfs-pool deviceBuffer reallocation failed.format_text/format-text.cWARNING: No cache info for %sMissing%sPhysical volume %s%sPhysical extents %d to %d%sLogical volume %s%sLogical extents %d to %d%sUnassigned areaWARNING: Invalid input '%s'.[n] Accepted input: [%c]filter regexfilter dm_regexFailed to allocate regex.Failed to create bitset.Invalid filter pattern "%s".Regex filter initialised.%sdev/blockformat_text/archive.cFile: %sUnable to read archive file.VG name: %sDescription: %sBackup Time: %sArchive file %s not found.archive_params alloc failedbackup_params alloc failedFailed to find device for PV.# %g %s2.03.32(2)-RHEL9 (2025-05-05)version = %ddescription = "%s"creation_time = %lu # %sstatus = [%s]flags = [%s]seqno = %uformat = "%s"# informationalsystem_id = "%s"lock_type = "%s"lock_args = "%s"extent_size = %umax_lv = %umax_pv = %uallocation_policy = "%s"profile = "%s"metadata_copies = %uphysical_volumes {pv%d {device = "%s"device_id_type = "%s"device_id = "%s"dev_size = %lupe_start = %luba_start = %luba_size = %lu%s {creation_timecreation_host = "%s"read_ahead = -1# Noneread_ahead = %umajor = %dminor = %dsegment_count = %u+%sstart_extent = %uextent_count = %ureshape_count = %utype = "%s%s"segment%u {historical_logical_volumes {%s"%s"removal_timeorigin = "%s%s"descendants = [%s]uname failed: %s%s/%s_%05u-%d.vgArchive file name too long.%s: rename to %s failed: %smisc/lvm-file.c%s: rename to %s failedExpiring archive %sArchive rename failed for %s%ss = ["pv%d", %u%s"%s", %u%s"%s", "%s"%sStatus value is not a string.format_text/flags.cCACHE_VOLUnknown status flag '%s'.PARTIALALLOCATABLEEXPORTEDMISSINGRESIZEABLEPVMOVEREADWRITEWRITE_LOCKEDNOAUTOACTIVATECLUSTEREDSHAREDFIXED_MINORVISIBLENOTSYNCEDREBUILDRESHAPE_DATA_OFFSETRESHAPE_DELTA_DISKS_PLUSRESHAPE_DELTA_DISKS_MINUSREMOVE_AFTER_RESHAPEWRITEMOSTLYACTIVATION_SKIPERROR_WHEN_FULLMETADATA_FORMATCROP_METADATACACHE_USES_CACHEVOLKilobytesMegabytesGigabytesTerabytesPetabytesExabytesToo small to hold a PVnoyes?@P?(ignored)(used)empty prefdopenWriting %s metadata to %sfsyncRenaming %s to %sUnlinking %smda_context allocation failedTest mode: Skipping renameformat_text/text_label.cDevice %s %s is %lu bytes.raid%draid_disksDevice %s %s is %d.queue/minimum_io_sizequeue/optimal_io_sizealignment_offsetPV %s missing from cachepe_startMDA1 startba_startdisk sizelabel scan sizeMDA0 endpe_endba_endformat_instance%s.tmpcontentsmissing contents fieldformat_text/import_vsn1.cText Format Volume Groupunrecognised contents fieldmissing version numberunrecognised version numberCouldn't find section '%s'.Could not find status flags.Could not read status flags.Could not read flags.descriptionEmpty pv section.dev_sizedevice_id_typecreation_hostlock_typeseqnophysical_volumesCouldn't read pv summariesdescendantsmetadata/lv_manip.cba_sizeImporting logical volume %s.allocation_policyread_aheadEmpty logical volume section.Empty segment section.reshape_countstripedSegment allocation failed_mimagetmpsegment_countmajormax_lvmax_pvmetadata_copieshistorical_logical_volumesmirrormetadata/mirror.cread_vgs, mda2 ( mda1 ( da1 ( ba1 (Scanning %s found no mdas.Scanning %s mda1 summary.Scanning %s mda2 summary.Failed to allocate dir_listlabel/label.ctext_orphanInitialised format: %sformat_text/import.cFailed to read VG %s from %sRead volume group %s from %sWrite from %s.Write[%u] from %s.VG %s metadata writing failedclose and reopen excl %sFailed to open device %sVG %s metadata %scommit %sseq %u on %s mda header at %llu %s.VG %s metadata %scommit %sslot0 offset %llu size %llu slot1 offset %llu size %llu.Failed to write metadata area headerstruct mda_header allocation failedWARNING: Removing metadata location on %s with bad mda header.Text format failed to determine directory.Couldn't create temporary text file name.Failed to write metadata to %s.Test mode: Skipping committing %s metadata (%u)Committing file %s metadata (%u)Renaming path %s is too long for VG %s.Creating metadata area on %s at sector %lu size %lu sectorsstruct data_area_list allocation failedPV %s header needs rewrite for new ext versionPV %s header needs rewrite to set ext usedPV init requested data_alignment_sectors %llu data_alignment_offset_sectors %lluPV init config data_alignment_sectors %lluRequested PE alignment is %llu sectorsStandard PE alignment is %llu sectorsIncreasing PE alignment to page size %u sectorsDevice %s has an unknown md raid level: %dDevice %s stripe-width is %lu bytes.Adjusting PE alignment from %llu sectors to md stripe width %llu sectors for %sAdjusting PE alignment from %llu sectors to minimum io size %llu sectors for %sAdjusting PE alignment from %llu sectors to optimal io size %llu sectors for %sSetting PE alignment to %llu sectors for %s.Setting PE alignment offset to %llu sectors for %s.%s: pe_align (%llu sectors) must not be less than pe_align_offset (%llu sectors)PV init final alignment %llu sectors from align %llu align_offset %llu%s: Data alignment must not exceed device size.%s: Bootloader area with data-aligned start must not exceed device size.Setting pe start to %llu sectors after ba start %llu size %llu for %sSetting PE start to %llu sectors for %sSetting pe start to requested %llu sectors for %s%s: Bootloader area would overlap data area.Physical extents (%s) end beyond end of device (%s) %s.PV %s is a different format (seqno %s)PV %s too large for extent size %s.Internal error: invalid index of value %u used while trying to add metadata area on PV %s. Metadata layout not supported by %s format.Internal error: Metadata area with index %u already exists on PV %s and removal failed.Using limited metadata area size on %s with value %lu (limited by %s of %lu).Metadata area size too small: %lu bytes. It must be at least %u bytes.Failed to wipe new metadata area on %s at %llu len %lluNot enough space available for metadata area with index %u on PV %s.struct mda_context allocation failedstruct metadata_area allocation failedInternal error: can't remove metadata area with index %u from PV %s. Metadata layout not supported by %s format.Failed to move metadata area with index 1 while resizing PV %s.%s: Volume group filename may not end in .tmpCouldn't allocate text format context object.Couldn't create metadata index for format instance of VG %s.No cached vginfo for VG %s and ID %s.Couldn't allocate text_fid_context.Couldn't allocate format_instance object.Can't process text format file - %s.Couldn't read uuid for physical volume.Couldn't read dev size for physical volume.Failed to allocate memory for device_id_type in read_pv_sum.Failed to allocate memory for device_id in read_pv_sum.Failed to allocate memory for device hint in read_pv_sum.Empty removed logical volume section.Couldn't read uuid for removed logical volume %s in vg %s.Invalid creation_time for removed logical volume %s.Invalid removal_time for removed logical volume %s.Removed logical volume structure allocation failedCouldn't read uuid for volume group %s.Couldn't find status flags for volume group %s.Couldn't read seqno for volume group %s.Couldn't find volume group in file.Couldn't read origin for historical logical volume %s/%s%sCouldn't get descendants list for historical logical volume %s/%s%sFound empty descendants list for historical logical volume %s/%s%sUnknown origin %s for historical logical volume %s/%s%sDescendant value for historical logical volume %s/%s%s is not a string.Failed to find descendant %s for historical LV %s.Failed to allocate generic logical volume structure.Failed to allocate list item for historical logical volume %s/%s%sUnknown historical logical volume %s/%s%sFound an item that is not a stringCouldn't read status flags for physical volume.Couldn't read extent start value (pe_start) for physical volume.Couldn't find extent count (pe_count) for physical volume.Found bootloader area specification for PV %s in metadata: ba_start=%lu, ba_size=%lu.Found incomplete bootloader area specification for PV %s in metadata.Couldn't read tags for physical volume %s in %s.Failed to allocate memory for device_id_type in read_pv.Failed to allocate memory for device_id in read_pv.Failed to allocate memory for device hint in read_pv.Empty logical volume section for %s.Couldn't read status flags for logical volume %s.Invalid creation_time for logical volume %s.Couldn't read creation_host for logical volume %s.Missing creation_time for logical volume %s.WARNING: Ignoring unrecognised allocation policy %s for LV %s.Adding profile configuration %s for LV %s.Failed to add configuration profile %s for LV %s.Couldn't read tags for logical volume %s.Couldn't use another pool metadata spare logical volume %s.Logical volume %s is pool metadata spare.Logical volume %s is sanlock lv.Lost logical volume reference %sCouldn't read uuid for logical volume %s.Couldn't read 'start_extent' for segment '%s' of logical volume %s.Couldn't read 'extent_count' for segment '%s' of logical volume %s.Segment type must be a string.Couldn't read segtype %s for logical volume %s.Couldn't read tags for a segment of %s/%s.Only one segment permitted for snapshotCouldn't read segment count for logical volume %s.segment_count and actual number of segments disagree for logical volume %s.Couldn't read minor number for logical volume %s.WARNING: Couldn't read major number for logical volume %s.WARNING: Ignoring invalid major, minor number for logical volume %s.WARNING: Unrecognised flag(s) %s.Unrecognised format %s for volume group %s.Couldn't read 'seqno' for volume group %s.Error reading flags of volume group %s.Couldn't read extent size for volume group %s.Couldn't read 'max_lv' for volume group %s.Couldn't read 'max_pv' for volume group %s.WARNING: Ignoring unrecognised allocation policy %s for VG %sAdding profile configuration %s for VG %s.Failed to add configuration profile %s for VG %sCouldn't find all physical volumes for volume group %s.Couldn't read tags for volume group %s.Couldn't read all logical volume names for volume group %s.Couldn't read all historical logical volumes for volume group %s.Couldn't read all logical volumes for volume group %s.Couldn't read all removed logical volume interconnections for volume group %s.Failed to fixup mirror pointers after import for volume group %s.Failed to allocate memory for system_id in _read_vg.Couldn't create lv_names radix tree.Couldn't create pv_names radix tree.%s: Preparing PV label header %s size %lu with%s%.*lu%s%.*lu%s%s%.*lu%s%.*lu%s%s%.*lu%s%.*lu%s%s%.*lu%s%.*lu%sInternal error: %s label header currently requires a data area.Found pv_header_extension version %u on %sWARNING: Scanning %s mda1 found mismatch with other metadata.WARNING: Scanning %s mda1 failed to save internal summary.Found metadata seqno %u in mda1 on %sWARNING: scanning %s mda1 failed to read metadata summary.WARNING: Scanning %s mda2 found mismatch with other metadata.WARNING: Scanning %s mda2 failed to save internal summary.Found metadata seqno %u in mda2 on %sWARNING: scanning %s mda2 failed to read metadata summary.Failed to allocate text format type structure.Couldn't allocate labeller object.Couldn't create text label handler.Couldn't allocate memory for labeller list object.Couldn't register text label handler.Reading metadata from %s at %llu size %d (+%d)WARNING: couldn't read volume group metadata from %s.WARNING: couldn't read volume group metadata from file.Skipped parsing metadata on %sFailed to allocate VG fmtdata for text format.'%s' does not contain volume group '%s'.There are %d physical volumes missing.text_export buffer allocation failedError parsing metadata for VG %s.VG %s seqno %u metadata write to %s mda_start %llu mda_size %llu mda_last %lluVG %s %u metadata on %s (%llu bytes) exceeds maximum metadata size (%llu bytes)VG %s %u new metadata start align from %llu to beginning %uVG %s %u new metadata start align from %llu to %llu (+%llu)VG %s %u wrapping metadata new_start %llu new_size %llu to size1 %llu size2 %lluVG %s %u metadata area location old start %llu last %llu size %llu wrap %lluVG %s %u metadata area location new start %llu last %llu size %llu wrap %lluVG %s %u metadata on %s (%llu bytes) too large for circular buffer (%llu bytes with %llu used)VG %s %u metadata disk location start %llu size %llu last %lluVG %s %u metadata disk location write1 start %llu size %llu last %llu write2 start %llu size %llu last %lluVG %s %u metadata last align from %llu to %llu (+%u)VG %s %u %s adjusted metadata end %llu extra %u larger than write buffer %lluVG %s %u metadata last align from %llu to %llu (+%u) (wrapped)VG %s %u %s adjusted metadata end %llu wrap %llu extra %u larger than write buffer %lluVG %s %u %s metadata write size %llu %llu larger than buffer %lluVG %s %u metadata write at %llu size %llu (wrap %llu)VG %s %u metadata write at %llu size %llu (wrapped)Failed to write metadata wrap to %sScanning for labels to wipe from %sFailed to read label from %s sector %lluFailed to remove label from %s at sector %llu%s: Wiping label at sector %lluĊĊي#orphans_lvm2printDM_ABORT_ON_INTERNAL_ERRORSInternal error: failed to report cmdstatusCODE_LINE=687CODE_FILE=log/log.c%s%s %s:%d%s%s %s:%d%s%s%s %s#globallabel allocation failedrwrwexCannot extend bcache fd tableFailed to set bcache fd.open %s %s di %d fd %dio_setup failed %dFailed to set up sync io.dev_read bcache not set up %sclose and reopen to write %sFailed to write label to %ssome blocks are still lockedlabel/hints.cnewhints createdtouch_hints errno %d %stouch_hints close errno %d %sunlink_nohints errno %d %sclear_hints open errno %dunlink_hints errno %d %sclear_hints flush errno %d %sclear_hints close errno %d %slock_hints existing fd %dlock_hints open errno %d %slock_hints close errno %d %sunlock_hints no existing fdunlock_hints flock errno %dFinding devices to scanFailed to set up devices.Failed to get device list.get_hints: pvscan recreateget_hints: nohints filenohints_exist errno %d %snewhints_exist errno %d %sget_hints: newhints fileget_hints: no fileget_hints: lock failget_hints: read failget_hints: needs refreshget_hints: no entriesValidating hintsInvalid hints: none used.No size for %s./dev/mdclear_hint_file%s/P_%slocking/file_locking.c%s/V_%sUnrecognised lock type: %dmisc/lvm-flock.cLocking %s %c%c convertLocking %s %c%c:auxmemlock reset.mm/memlock.cglobal flock already held exlocking/locking.cstderrstdoutstdindup2dup2(%d, %d) returned %dread%d Cannot parse content of %s.metadata/cache_manip.cmetadata/lv.cfailed to write log file: %s failed to write log file Unknown cache mode: %s.another LVCan't convert internal LV %s.%s_cpoolsmqreporter_poolmetadata/writecache_manip.cFailed to deactivate %s.flush_on_suspendRemoving previous wcorig %smetadata/integrity_manip.cpartialbitmapunassigned:%u-%u(%u)not enablednot monitored%s is %son %stpoolvpoollvpath snprintf faileddm_pool_alloc failedActivating logical volume %s.Thin volume %s is active.Flushing of %s aborted.vsnprintf failed: skipping external logging function %s:%d %sAborting. Command has reached limit for logged lines (LVM_LOG_FILE_MAX_LINES=%lu).Device open %s has DEV_IN_BCACHE already setDevice open %u:%u has no path names.Device open %s already open with di %d fd %dCan't open %s exclusively. Mounted filesystem?Drop alias for %u:%u failed open %s (%d).Invalid path %s for device %u:%u, trying different path._SC_PAGESIZE returns negative value.couldn't create control block setFailed to set up async io, using sync io.WARNING: _SC_PAGESIZE returns negative value.bcache block size must be a multiple of page sizeFailed to set up io layer with %d blocks.Error opening device %s for reading at %llu length %u.Error reading device %s at %llu length %u.dev_write bcache not set up %sError opening device %s for writing at %llu length %u.Error writing device %s at %llu length %u.Set last byte mixed block sizes physical %u logical %u using 512Set last byte mixed block sizes physical %u logical %u using 4096Label handler does not support label writesLabel sector %lu beyond range (%ld)%s: Writing label to sector %lu with stored offset %u.Error writing device value %s at %llu length %u.dev_set_bytes bcache not set up %s# Created empty by %s pid %d %sEnable full md component check.Filtering devices to scan (nodata)Filtering devices to scan done (nodata)Clear pvid and info for filtered dev %s.get_hints: applied using %d other %d vgname %sWARNING: metadata may not be usable with current io_memory_size %d KiBWARNING: increase lvm.conf io_memory_size to at least %llu KiBHints not used with duplicate pvsHints not used with duplicate vg namesUncertain hint for unread device %d:%d %sInvalid hint device %d:%d %s pvid %s had hint pvid %sInvalid hint device %d:%d %s pvid %s had vgname %s no VG info.Will scan %d remaining devicesextra md component check skip %llu %llu device_hint %s dev %sIgnoring PV from md component %s with PVID %s (metadata %s %llu)extra md component check %llu %llu device_hint %s dev %sInvalid hint device %d:%d %s pvid %s had vgname %s no PV info.Too long locking filename %s/P_%s.Too long locking filename %s/V_%s.Failed to convert flock on %s %dInternal error: Unknown locking mode %s.Internal error: reopen_standard_stream called on non-standard stream %*c %*d %*d %*d %*d %*d %*u %*u %*u %*u %*u %*u %*u %*d %*d %*d %*d %*d %*d %lluCannot use chunk size %s with cache pool %s metadata size %s.Minimal size for cache pool %s metadata with chunk size %s would be %s.Cannot use too small chunk size %s with cache pool %s data volume size %s.Maximum configured chunks for a cache pool is %lu.Use smaller cache pool (<%s) or bigger cache chunk size (>=%s) or enable higher values in 'allocation/cache_pool_max_chunks'.WARNING: Ignoring unrecognized journal value.Internal error: Cache pool %s has undefined cache mode, using writethrough instead.Internal error: Cannot set cache mode for non cache volume %s.Cannot use locked cache pool %s.Logical volume %s is already in use by %s.Cannot use locked origin volume %s.Cache is not supported with %s segment type of the original logical volume %s.Cache chunk size %s is not in the range %s to %s.Cache chunk size %s must be a multiple of %s.Can't prepare new cachepool name for %s.WARNING: Cannot detect default cache policy, using "mq".Default cache policy is not available.Detected default cache_policy "%s".Internal error: Cannot set cache metadata format for non cache volume %s.Failed to duplicate policy name.WARNING: Cannot detect default cache metadata format, using format: %u.Cache metadata format %u is not supported by kernel target.Replacing chunk size %s in cache pool %s with chunk size %s from profile.WARNING: Data redundancy could be lost with writeback caching of raid logical volume!Detected default cache metadata format: %u.Internal error: Failed to wipe cache pool for volume %s.Skipping wipe of %s volume with %s segtype.Aborting. Failed to activate cache pool %s.Aborting. Failed to wipe cache pool %s.Aborting. Could not deactivate cache pool %s.Failed to get mem for LV status.Failed to get device mapper status for %sNo device mapper info exists for %sInvalid device mapper status type (%d) for %sLV %s segment is not writecache.LV %s writecache segment has no writecache.LV %s writecache segment has no originFailed to activate LV %s for flushing writecache.Failed to flush writecache for %s.Failed to get writecache error status for %s.Failed to flush writecache (error %u) for %s.Failed to deactivate LV %s for detaching writecache.Failed to set flush_on_suspend in writecache detach %s.Failed to remove seg in writecache detach.Failed to remove lv layer in writecache detach.Failed to write VG in writecache detach.Failed to get lv_committed in writecache detach.Suspending writecache to detach %sFailed to suspend LV in writecache detach.Checking writecache errors to detach.Failed to commit VG in writecache detach.Resuming after writecache detached %sFailed to resume LV in writecache detach.Deactivating previous cachevol %sFailed to deactivate previous cachevol in writecache detach.Deactivating previous wcorig %sFailed to deactivate previous wcorig LV in writecache detach.Failed to remove previous wcorig LV in writecache detach.Failed to write and commit VG in writecache detach.integrity_meta_bytes %llu from lv_size_bytes %llu meta_bytes %llu initial_bytes %llu journal_sectors %uLV %s segment is unsupported raid for integrity.Removing integrity from raid LV %s %sRemoving integrity layers from %sLV %s segment has no integrity metadata device.LV %s integrity segment has no originFailed to update and reload LV after integrity remove.Deactivating unused integrity layers %s %sFailed to deactivate unused iorig LV %s.Failed to deactivate unused imeta LV %s.Removing unused integrity LVs %s %sFailed to remove unused iorig LV %s.Failed to remove unused imeta LV %s.Invalid raid integrity mode (use "bitmap" or "journal")_format_pvsegs: str_list_create failedInternal error: Unknown area segtype._format_pvsegs: extent range dm_snprintf failed._format_pvsegs: extent number dm_snprintf failed._format_pvsegs: list item dm_snprintf failed_format_pvsegs: failed to add item to list_format_pvsegs: list item dm_pool_zalloc failedWARNING: Thin volume %s maps %s while the size is only %s.Internal error: for_each_sub_lv failure.Internal error: Bad pvmove structureInternal error: Cannot find mirror segment.Internal error: %s is not a RAID imageFailed to find RAID segment for %s%s on %s is not a RAID segmentInternal error: sub-LV %s was not found in raid segmentCannot remove from lv_names LV %sDuplicate LV name %s detected.Cannot insert to lv_names LV %sFailed to lock logical volume %s.Deactivating logical volume %s.Failed to unlock logical volume %s.WARNING: Skipping flush for failed cache %s.Flushing %lu blocks for cache %s.WARNING: Dirty blocks found on read-only cache volume %s.Internal error: LV %s is not cache volume.Internal error: LV %s is already dropped cache volume.Failed to activate %s to flush cache.Failed to deactivate after cleaning cache.Internal error: %s is not of RAID typeInternal error: %s on %s is not a RAID segment.LV layout list allocation failedLV role list allocation failedInternal error: WARNING: Failed to properly detect layout and role for LV %s/%s.0p؍Xp unknownnonepublicprivatehistorylinearstripederrorzeromirrorraidthincachesparseoriginthinoriginmultithinoriginthickoriginmultithickorigincacheoriginextthinoriginmultiextthinoriginsnapshotthinsnapshotthicksnapshotpvmoveimagelogmetadatapooldatasparevdovirtualraid0raid0_metaraid1raid10raid4raid5raid5_nraid5_laraid5_raraid5_lsraid5_rsraid6raid6_zrraid6_nrraid6_nclockdsanlockcachevolwritecachewritecacheoriginintegrityintegrityoriginpre-cmdcmdorphanpvlabelvglvshellprocessing_vprint_logfatalerrorwarnnoticeinfodebug/proc/self/stat/run/lvm/hints/run/lvm/nohints/run/lvm/newhints %s/%s uses %sFailed to allocate memory with PV tags: Changing Consideringhistorical Failed to create new nameCannot rename locked LV %s--dry-run--verbose--yes--forcequeue/discard_max_bytesqueue/discard_granularity%s: discarding failed.metadata areaCan't resize reshaping LV %s.Skip unmount in test mode.Skip fsck in test mode.Skip mount in test mode.Skip cryptsetup in test mode.Skip fs extend in test mode.Stack %s:%u[%u] on LV %s:%u.Internal error: Meta le != 0.Failed to suspend %s.Failed to reactivate %s.metadata/pv_manip.cNo meta_areas for RAID typeFailed to extend %s in %s.Failed to remove LVFailed to commit VG %sup to contiguous metadata/pv_map.cpvl->pv->devdm_pool_begin_object faileddm_pool_grow_object failedCling_to_allocated is %sset %u %s%s of %u extents eachSorting %u log areasSorting %u areascreate_pv_maps alloc failed_cdata_tdatarimagemetadata/pool_manip.c%s_%s%s_%s_%u%s_rmeta_%uFailed to insert layer for %sReducingExtending%s logical volume %s to %s%sHistorical physicallogicalat most and open resize2fs+crypto_LUKSequal tosmaller thanlarger than cryptsetup, mount, fsck, unmount, xfs_growfsNo size change.locking/lvmlockd.cgfs2ocfs2%s/%s/%sFailed to activate %s.checksizelv_info failed: aborting.resize_fsadmFilesystem check failed.Filesystem resize failed.ext2ext3ext4xfsFile system %s%s found on %s.reiserfsnochangeFile system not reduced.Skip fs reduce in test mode.Problem deactivating %s.Found fs %s last_byte %lluFile system not extended.Resized %s to %u extents.metadata/thin_manip.cFile system extend error.Memory reallocation for parallel areas failed.PV tags string allocation failed.PV tags string extension failed.%s allocation area %u %s %s start PE %u length %u leaving %u%s%s.LV %s using PV %s is not redundant.Cannot rename "%s": name format not recognized for internal LV "%s"Failed to allocate space for new nameCannot rename "%s". New logical volume name "%s" is invalid.%sLogical Volume "%s" already exists in volume group "%s"Cannot use misconfigured fsadm executable to resize %s.Couldn't create LV path for %s.Couldn't generate new LV size string.Name too long - device not discarded (%s)%s: not found: device not discarded.%s: max bytes and granularity query fails.WARNING: %s: Discarding %s at offset %lu, please wait...Snapshot origin volumes cannot be reduced in size yet.Resize of snapshot origin VDO volume is not supported.Snapshot origin volumes can be resized only while inactive: try lvchange -an.Cannot resize a RAID %s directly for %sCannot resize %s LV %s. Convert to more stripes first.Thin pool volumes %s cannot be reduced in size yet.Thin pool metadata volumes cannot be reduced.Cannot reduce VDO pool data volume %s.Reduce not yet allowed on LVs with writecache attached.RAID module does not support shrinking.Cannot reduce LV with integrity.Support for online metadata resize of %s not detected.Thin target does not support external origin smaller then thin volume.Ignoring PVs on command line when reducing.Internal error: LV is not specified.Can't resize locked logical volume %s.Can't resize logical volume %s while lvconvert in progress.Cannot resize logical volume %s with active component LV(s).Cannot resize logical volume %s while it is tracking a split image.Cannot resize inactive VDO logical volume %s.Cannot resize inactive VDO POOL volume %s.Cannot resize external origin logical volume %s.Overriding default 'mirror_region_size' setting with 'raid_region_size' setting of %u kiBReducing region size to %u kiB (power of 2).Using default region size %u kiB (multiple of page size).Adding %s:%u as an user of %s.Failed to allocate segment list.%s:%u is no longer a user of %s.Internal error: Segment %s:%u is not a user of %s.Internal error: get_only_segment_using_this_lv() called with NULL LV.%s is expected to have only one segment using it, while %s:%u uses it %d times.%s is expected to have only one segment using it, while it has %d.Internal error: No single component user of logical volume %s.Internal error: alloc_lv_segment: Missing segtype.Internal error: Try to set to high area number (%u >= %u) for LV %s.Failed to allocate widened LV segment for %s.Refusing refresh of partial LV %s. Use '--activationmode partial' to override.Failed to remove temporary SubLVs from %sInternal error: Cannot remove undefined LV.Dropping snapshot merge of %s to removed origin %s.Dropping snapshot merge of removed %s to origin %s.Internal error: Pool size mismatched data size for %sSegment extent reduction %u not divisible by #stripes %uUnable to deactivate spare logical volume %s.Internal error: Removing still active LV %s.discard_pv_segment with unallocated segment: %s PE %uSkipping discard on missing device with uuid %s.Discarding %u extents offset %lu sectors on %s.release_pv_segment with unallocated segment: %s PE %uRemove %s:%u[%u] from the top of LV %s:%u.Failed to unlock vdo pool in lvmlockd.Aborting. Failed to extend %s in %s.Failed to copy tags onto LV %s to clear metadata.Test mode: Skipping wiping of metadata areas.allocate_extents does not handle virtual segmentsInternal error: Missing allocatable pvs.Metadata format (%s) does not support required LV segment type (%s).Consider changing the metadata format by running vgconvert.Internal error: _alloc_init called for virtual segment.Internal error: _alloc_init called for non-virtual segment with no disk space.allocation pool creation failedInternal error: Bad metadata_area_countLog size needs too many extents %lu with region size of %u sectors.Adjusted allocation request to %u logical extents. Existing size %u. New size %u.Mirror log of %u extents of size %u sectors needed for region size %s._allocate called with no work to do!Number of extents requested (%u) needs to be divisible by %u.Couldn't create physical volume maps in %sParallel PVs at LE %u length %u: %sNot enough PVs with free space available for parallel allocation.Consider --alloc anywhere if desperate.Couldn't allocate areas array.Trying allocation using %s policy.Insufficient free space: %lu extents needed, but only %u available%u preferred area(s) to be filled positionally.Areas to be sorted and filled sequentially.Still need %s%u total extents from %u remaining (%u positional slots): %u (%u data/%u parity) parallel areas of %u extents eachFound %u areas for %u parallel areas and %u log areas so far.Filled %u out of %u preferred areas so far.Not using free space on existing parallel PV %s.Internal error: _alloc_parallel_area called without any allocation to do.allocated_area allocation failedMetadata does not fit on a single PV.Allocating parallel metadata area %u on %s start PE %u length %u.Allocating parallel area %u on %s start PE %u length %u.Insufficient suitable %sallocatable extents for logical volume %s: %u more requiredInsufficient suitable %sallocatable extents found for logical volume %s.Found fewer %sallocatable extents for logical volume %s than requested: using %u extents (reduced by %u).Insufficient free space for log allocation for logical volume %s.allocation handle allocation failedInternal error: Mirror layer must be inserted before adding mirrors.Conflicting region_size %u != %u.Generating list of PVs that %s/%s uses:Adding segment of type %s to LV %s.Internal error: Pool %s already has extents.Name of logical volume %s is too long to be a pool name.%s: Required device-mapper target(s) not detected in your kernel.WARNING: Pool %s is created without initialization.Aborting. Failed to activate pool metadata %s.Aborting. Failed to wipe pool metadata %s.Aborting. Could not deactivate pool metadata %s.Failed to deactivate pool volume %s.Manual intervention may be required to remove abandoned LV(s) before retrying.Internal error: Non-empty LV passed to _lv_insert_empty_sublvFailed to create mapping segment for %s.Failed to create sub LV name for LV %s.Insufficient suitable allocatable extents for logical volume %sextend not needed for imeta LV %sFailed to build list of PVs for extending %s.Failed to extend integrity metadata LV %sUnable to read sync percent while LV %s is not locally active.Do full resync of extended portion of %s? [y/n]: Failed to get sync percent for %s.Skipping initial resync for extended portion of %sLV %s cannot be extended while it is recovering.Size of logical volume %s unchanged from %s (%u extents).Size of logical volume %s changed from %s (%u extents) to %s (%u extents).Cannot rename internal LV "%s".Cannot rename active VDOPOOL volume %s, VDO target feature support is missing.Failed to allocate space for new name.lvresize_extents_from_percent type %d extents %u percent_value %uReducing %u%%VG to remaining free space %s in VG.Specified LV does not have an origin LV.Internal error: Unsupported percent type %u.Converted %u%%%s into %s%u %s extents.Stripe size cannot be larger than %s.Reducing stripe size %s to maximum, physical extent size %s.Stripe size must be power of 2.Can't resize internal logical volume %s.--poolmetadatasize can be used only with thin pools.Extending thin pool metadata to %llu for larger dataLV in VG %s with lock_type %s requires lvmlockd.LV path too long for lvmlockd refresh.Cannot activate to resize %s without using device-mapper kernel driver.Ignoring fs resizing options for LV type %s.The LV must be active to safely reduce (see --fs options.)Failed to activate %s to check for fs.Logical volume %s must be active for file system %s.File system not found for --resizefs or --fs options.LUKS dm-crypt device must be active for fs resize.WARNING: Reducing active%s logical volume to %s.THIS MAY DESTROY YOUR DATA (filesystem etc.)Do you really want to reduce %s? [y/n]: Logical volume %s NOT reduced.File system size %llub is adjusted for crypt data offset %ub.Found fs %s last_byte %llu new_size_bytes %lluFile system %s%s found on %s mounted at %s.File system reduce for reiserfs requires --fs resize_fsadm.File system device usage is not available from libblkid.File system size (%s) is %s the requested size (%s).File system reduce is not needed, skipping.File system reduce is required (see resize2fs or --resizefs.)File system reduce is required and not supported (%s).File system reduce is required using resize2fs.File system needs to be mounted to reduce fs (see --fsmode).File system needs to be unmounted to reduce fs (see --fsmode).Unknown file system resize options: --fs %s --fsmode %sFile system unmount is needed for reduce.File system fsck will be run before reduce.File system mount is needed for reduce.cryptsetup resize is needed for reduce.Continue with %s file system reduce steps:%s%s%s%s%s? [y/n]:crypt device is already reduced to %llu bytes.crypt reduce is required (see --resizefs or cryptsetup resize.)Failed to resize crypt dev with lvresize_fs_helper.Failed to lock VG, cannot reduce LV.VG was changed during fs operations, restarting.File system last byte %llu is greater than new size %llu bytes.Resized thin pool metadata %s to %u extents.File system extend for reiserfs requires --fs resize_fsadm.File system extend is not supported (%s).File system must be mounted to extend (see --fsmode).File system type %s not handled.File system fsck skipped for extending mounted fs.File system unmount is needed for extend.File system fsck will be run before extend.File system mount is needed for extend.cryptsetup resize is needed for extend.Continue with %s file system extend steps:%s%s%s%s%s? [y/n]:Internal error: Updated LV %s is not thin pool.77T88L99NONEVGFREELVPVSORIGIN_create_mapspv_list allocation failed merging origin clustered and DISCARD with %u snapshots(s) with snapshot %sLV %s in VG %s is now hidden. persistentHistorical llockd_lvremove_lock %sFailed to remove cachevol %s.Failed to deactivate LV %sFailed to update pool %s.Removing snapshot volume %s.lvremovevgremovePostponing write and commit.lockd_lvremove_done unlock %sWARNING: Failed to unlock %s.cache originexternal originVDO pool (origin only)unlocking on revertRemoving layer %s for %sFailed to find layer %s in %s_mimageCreation of layer LV failedInserting layer %s for %slvol%dsnapshot exception storestart of new LVmetadata/vg.cCreating LV: thin poolCreating LV: thin volumeCreating LV: cow snapshotCreating LV: vdo volumeFailed to find vdo pool %s/%sFailed to lock vdo pool %s/%sCannot find free device_id.Found free pool device_id %u.Adding integrity to new LVCache pool is prepared.Failed to activate thin %s.Failed to activate new LV %s.Aborting. Failed to wipe %s.%s_voriginCouldn't create snapshot.deactivating to revert new lvreverting new lvlvconvertvpool%dLogical volume "%s" created.metadata/merge.cno meta areasnon power of 2 stripe sizenon-zero region_sizenon-zero write behindnon-zero min recovery ratenon-zero max recovery ratereshapenon power of 2 region sizenon-zero stripe sizeDo you really want to remove%s%s%s%s logical volume %s%s? [y/n]: Logical volume %s not removed.WARNING: Read-only activated logical volume %s not zeroed.WARNING: Logical volume %s not zeroed.Signature wiping on logical volume %s not requested.Failed to allocate generic volume list item for indirect glv %sUnable to allocate logical volume structureparallel_areas allocation failedFailed to find segment for %s extent %uLV %s in VG %s is now visible.Can't remove logical volume %s under snapshot.Can't remove external origin logical volume %s.Can't remove logical volume %s used by a mirror.Can't remove logical volume %s used as mirror log.Can't remove logical volume %s used as RAID device.Can't remove logical volume %s used by a pool.Internal error: Thin LV %s without pool.Can't remove locked logical volume %s.lockd_lvremove_lock thin pool %s for %slockd_lvremove_lock skip repeat thin pool %slockd_lvremove_lock cow origin %s for %slockd_lvremove_lock vdo pool %s for %sDetach cachevol before removing.lockd_lvremove_lock cache main %s for %sInternal error: data_lv_from_thin_pool arg not thin pool %sFailed to detach writecache from %sCannot deactivate logical volume %s.Cannot deactivate subvolume %s of logical volume %s.Ignoring update failure of pool %s.Error releasing logical volume %s with pending delete.Unable to deactivate logical volume %s.Releasing %slogical volume "%s"Error releasing %slogical volume "%s"Failed to update thin pool %s.lockd_lvremove_done skip unlock of active thin pool %s for %slockd_lvremove_done unlock thin pool %s for %slockd_lvremove_done skip unlocked thin pool %s for %slockd_lvremove_done skip unlock %s for %slockd_lvremove_done unlock %s for %s%s%sogical volume "%s" successfully removed.Failed to obtain merging snapshot progress percentage for logical volume %s.Can't remove merging snapshot logical volume %s.Removing snapshot %s that failed to merge may leave origin %s inconsistent. Proceed? [y/n]: Removing origin logical volume %s with %u snapshots(s).Removing merging origin logical volume %s.Unable to remove %s, volume is merged to %s.Removing external origin logical volume %s.Unable to fully deactivate unused cache-pool %s.Removal of pool metadata spare logical volume %s disables automatic recovery attempts after damage to a thin or cache pool. Proceed? [y/n]: Removing %s %s will remove %u dependent volume(s). Proceed? [y/n]: Updating logical volume %s on disk(s)%s.Dropping origin_only for %s as lock holds %sFailed to suspend logical volume %s.Failed to revert logical volume %s.Updating logical volume %s in kernel.Problem reactivating logical volume %s.Internal error: Wrong layer %s in %sInvalid %d segments in %s, expected only 1.Invalid %d area count(s) in %s, expected only 1.Invalid seg_type %d in %s, expected LV.Layer doesn't match segment in %s.Inconsistent extent count (%u != %u) of layer %s.Layered name is too long. Please use shorter LV name.Creating transient LV %s for mirror conversion in VG %s.Creation of transient LV %s for mirror conversion in VG %s failed.Aborting. Unable to tag transient mirror layer.Failed to write intermediate VG %s metadata for mirror conversion.Failed to commit intermediate VG %s metadata for mirror conversion.Failed to resume transient LV %s for mirror conversion in VG %s.Internal error: Empty list of LVs given for wiping.Internal error: LVs must be set visible before wiping.Failed to activate locally %s for wiping.ACTIVATION_SKIP flag set for LV %s/%s, skipping activation.Rounding size %s (%u extents) %s to stripe boundary size %s (%u extents).Maximum number of logical volumes (%u) reached in volume group %sMetadata does not support %s segments.Volume group %s does not support tags.Metadata only supports readahead values between 2 and 120.Stripe size may not exceed %s.Can't create %s without using device-mapper kernel driver.WARNING: Skipping zeroing and wiping, compiled without activation support.The extent size in volume group %s is too small to support striped RAID volumes.Reducing requested stripe size %s to maximum, physical extent size %s.Internal error: Unable to create new logical volume with no extents.Unable to create %s smaller than 1 chunk.Number of stripes (%u) must not exceed number of physical volumes (%d)lockd_lvcreate_lock creating_thin_pool %d creating_thin_volume %d created pool %d volume %dlockd_lvcreate_lock invalid thin transition creating p %d v %d created p %d v %dlockd_lvcreate_lock creating_thin_volume locking thin pool %sCouldn't find thin pool %s for creating thin volume.Failed to lock thin pool %s for creating thin volume.lockd_lvcreate_lock creating_cow_snapshot locking origin %sCannot create snapshot without origin LV in shared VG.Failed to find origin LV %s/%sFailed to lock snapshot origin LV %s/%slockd_lvcreate_lock creating_vdo_volume locking vdo pool %sInternal error: Cannot create %s volume without %s pool.Couldn't find volume %s in Volume group %s.Cannot use locked pool volume %s.Rounding size (%d extents) up to chunk boundary size (%d extents).Aborting. Failed to locally activate thin pool %s.Cannot read thin pool %s transaction id locally, perhaps skipped in lvm.conf volume_list?Cannot use thin pool %s with transaction id %lu for thin volumes. Expected transaction id %lu.Deactivating public thin pool %s.Aborting. Could not deactivate thin pool %s.Cannot create new thin volume, free space in thin pool %s reached threshold.Origin volume %s not found in Volume group %s.Caching of origin cache volume smaller then chunk size is unsupported.Internal error: Pool LV for cache is missing.Logical volume %s is not a cache pool.WARNING: New %s won't be synchronized. Don't read what you didn't write!Logical volume %s is not a thin pool.Snapshots of locked devices are not supported.Couldn't find origin volume '%s'.Can't share virtual origins. Use --virtualsize.Virtual size matching available free logical size in VDO pool.Volume group "%s" has insufficient free space (%u extents): %u required.Setting read ahead sectors %u.Setting device number to (%d, %d).Internal error: Segment in %s is not a thin pool segment.Multiple-segment mirror is not supported.lockd_init_lv: unknown lock_type.lockd_init_lv thin invalid without lockd_creating_thin_poollockd_init_lv creating new lock for thin poolTest mode: Skipping activation, zeroing and signature wiping.lockd_creating_thin_pool lockd_lv ex for new thin pool.Failed to lock thin pool after creating it.WARNING: Loss of snapshot %s will cause the activation of the %s LV %s to fail!Aborting. Failed to activate LV %s.Aborting. Failed to activate LV %s locally exclusively.Failed to suspend thin snapshot origin %s.Aborting. Failed to read transaction_id from thin pool %s.WARNING: Metadata for thin pool %s have transaction_id %lu, but active pool has %lu.Restoring previous transaction_id %lu for thin pool %s.Internal error: thin pool not lockedFailed to activate thin pool %s.Cannot activate thin pool %s, perhaps skipped in lvm.conf volume_list?Failed to deactivate thin pool %s.Aborting. Failed to activate snapshot exception store.Aborting. Failed to activate temporary volume for VDO pool creation.Aborting. Couldn't deactivate VDO LV %s with skipped activation.Aborting. Leaving cache pool %s and uncached origin volume %s.Reverting created caching layer.LV %s has no suffix for cachepool (skipping rename).Aborting. Couldn't deactivate snapshot COW area %s.Zero segment type for virtual origin not foundVirtual origin name is too long.Failed to activate sparse volume %s.Aborting. Manual intervention required.Unable to deactivate failed new LV %s. Manual intervention required.Failed to resume thin snapshot origin %s.Internal error: Unsupported creation of cache and cache pool volume.Internal error: Logical volume is not cache %s.Logical volume %s is now cached.Internal error: Creation of pool for unsupported segment type %s.Temporary logical volume "%s" created.LV %s invalid: %s for %s segment.LV %s invalid: %s (is %u) for %s segment.min recovery larger than max recovery_tdata_cdata_corig_wcorig_vdata_tpool%d_tdata_cdata_corig_wcorig_vdata%s: read_ahead is %u sectorsmirror image is not mirroredis not flagged as cache LVis missing cache pool LVsets cleaner_policyis missing cache policy namehas invalid chunk size.sets METADATA_FORMAT flagsets cache metadata formatsets cache modesets policy namesets policy settingslog LV is not a mirror logregion size is zero_mlogregion size is non power of 2zero area countzero areasextents_copied too largenon-zero origin LVnon-zero cow LVnon-zero origin_listno DataLVDataLV size variationsno MetaLVMetaLV size variationsminimum 2 areas requiredminimum 5 areas requiredminimum 4 areas requirednon-zero writebehindbogus RAID segment typeno raid image SubLVvisible raid image LVno raid meta SubLVvisible raid meta LVis missing a pool data LVis missing a pool metadata LVzero_new_blocks is invalidsets zero_new_blockssets discardssets thin_messages listsets CROP_METADATA flagis missing thin pool LVhas too large device idsets device_idsets external LVsets merge LVsets indirect_origin LVis not flagged as VDO pool LVis missing a VDO pool data LVis not VDO pool data LVsets invalid VDO parameter(s)sets vdo_pool_header_sizesets vdo_pool_virtual_extentssets vdo_paramsis not flagged as VDO LVis missing VDO pool LVsets pool LVsets chunk_sizesets transaction_idset segtype_private_cmetapvmove%uLV pvmove %s has no segment.LV %s: has no segment.Name is zero length.vg_remove_mdas %s failed%s: Couldn't get size.Adding PVs to VG %s.Adding PV %s to VG %s.PV %s has wrong block size.2.4.vg_createsnprintf random bit failed.Failed to store lvname.Failed to store lvid.Failed to hash lvname.Failed to store pvid.Failed to allocate uuid hashFailed to allocate pvid hash.Internal error: Referenced LV %s not listed in VG %s.Internal error: Referenced PV %s not listed in VG %s.Internal error: Read ahead data missing.WARNING: Failed to open %s to get readahead %s.WARNING: %s: ioctl BLKRAGET %s.Internal error: Invalid character at index %u of lock_args "%s"Internal error: Invalid colon at index %u of lock_args "%s"LV %s, segment %u invalid: %s for %s segment.is not referencing cache pool LVhas invalid cache metadata formathas invalid cache's feature flagis missing METADATA_FORMAT flagdoes not support flag ERROR_WHEN_FULL.log LV does not point back to mirror segmentregion size is bigger then LV itselflog LV is not a mirror log or a RAID imageLV %s invalid: maximum supported areas %u (is %u) for %s segment.DataLV without RAID image flagMetaLV without RAID metadata flagdata LV does not refer back to pool LVmetadata LV does not refer back to pool LVmust not have pool metadata LV setis not flagged as thin pool LVis a thin volume that must not contain thin pool segmentis not flagged as thin volume LVis a thin pool that must not contain thin volume segmentis not referencing thin pool LVexternal LV is not flagged as a external origin LVmerge LV is not flagged as a thin LVmerge LV is not flagged as mergingis not referencing VDO pool LVLV %s: segment %u mirror image %u missing mirror ptr.LV %s: mirrored LV segment %u has wrong size %u (should be %u).LV %s must have exactly one segment.LV %s: segment 1 pool data LV does not point back to same LV.LV %s: thin pool metadata LV does not use _tmeta.LV %s: cache pool metadata LV does not use _cmeta.LV %s: external origin count does not match.LV %s: external origin can't be writable.LV %s invalid: segment %u is referencing different LV.LV %s invalid: segment %u should begin at LE %u (found %u).LV %s: segment %u with len=%u has inconsistent area_len %u.LV %s: segment %u has same LV %s for both origin and snapshot.LV %s: segment %u has unassigned area %u.LV %s: segment %u has inconsistent PV area %u.LV %s: segment %u has inconsistent LV area %u.LV %s segment %u uses LV %s, but missing ptr from %s to %s.LV %s has duplicated links to LV %s segment %u.LV %s: inconsistent LE count %u != %u.LV %s is used by LV %s:%u-%u, but missing ptr from %s to %s.Reference count mismatch: LV %s has %u links to LV %s:%u-%u, which has %u links.LV %s is indirectly used by historical LV %s but that historical LV does not point back to LV %s.LV %s is indirectly used by LV %s but that LV does not point back to LV %s.LV segment %s:%u-%u is incorrectly listed as being used by LV %s.Physical volume %s not in volume group %sName cannot start with hyphen.Name starts with . or .. and has no following character(s).Name contains invalid character, valid set includes: [a-zA-Z0-9.-_+].Name length exceeds maximum limit of %d.Internal error: Unknown error %d on name validation.New volume group name "%s" is invalid.%s: already exists in filesystemRemoving physical volume "%s" from volume group "%s"Failed to remove physical volume "%s" from volume group "%s"Volume group "%s" successfully removedVolume group "%s" not properly removedPhysical extent size used for volume group %s is less than logical block size (%u bytes) that %s uses.WARNING: Device %s has size of %lu sectors which is smaller than corresponding PV size of %lu sectors. Was device resized?WARNING: PV %s has unknown block size.Devices have inconsistent block sizes (%u and %u)Devices have inconsistent logical block sizes (%u and %u).Adding physical volume '%s' to volume group '%s'Physical volume '%s' is already in volume group '%s'PV %s is used by a VG but its metadata is missing.Physical volume %s is of different format type (%s)Physical volume %s might be constructed from same volume group %sFormat-specific setup of physical volume '%s' failed.Physical volume '%s (%s)' already in the VG.No space for '%s' - volume group '%s' holds max %d physical volume(s).Unable to add %s to %s: new extent count (%lu) exceeds limit (%u).PV %s cannot be added to VG %s.vg->name allocation failed for '%s'pv_list allocation for '%s' failedVolume group %s does not support tagsFailed to add tag %s to volume group %sFailed to duplicate tag %s from %sMajor number %d outside range 0-255.Minor number %d outside range 0-255.Major number %d outside range 0-4095.Ignoring supplied major %d number - kernel assigns major numbers dynamically.Minor number %d outside range 0-1048575.Volume Group allocation policy cannot inherit from anythingPhysical extent size may not be zeroNumber of volumes may not exceed 255Couldn't create uuid for volume group '%s'.Failed to create format instanceFormat specific setup of volume group '%s' failed.Rounding up size to full physical extent %sVolume too large (%s) for extent size %s. Upper limit is less than %s.Failed to allocate bitset for setting random bits.dm_pool_begin_object failed for random list of bits.Failed to generate list of random bits.Failed to finish list of random bits.Selected %u random bits from %u: %sAdjusting ignored mdas for %s: %u of %u mdas in use but %u required. Changing %u mda.Internal error: Unable to find %u metadata areas to unignore on volume group %sCalculated readahead of LV %s is %uInternal error: VG %s allocation policy set to invalid cling_by_tags.Internal error: VG %s has external flag LVM_WRITE_LOCKED set internally.Internal error: VG %s tag %s has invalid form.Internal error: PV list corruption detected in VG %s.Internal error: VG %s PV list entry points to different VG %s.Internal error: VG name for PV %s is corrupted.Internal error: Duplicate PV id %s detected for %s in %s.Internal error: PV %s tag %s has invalid form.Internal error: PV segments corrupted in %s.Internal error: LV %s is not marked as removed while it's part of removed LV list for VG %sInternal error: LV %s is marked as removed while it's still part of the VG %sInternal error: LV %s has external flag LVM_WRITE_LOCKED set internally.Internal error: LV name "%s/%s" length %zu is not supported.Internal error: LV %s has VG UUID %s but its VG %s has UUID %sInternal error: LV %s is extra pool metadata spare volume. %u found but only 1 allowed.Internal error: LV %s is not the VG's pool metadata spare volume.Internal error: LV segments corrupted in %s.Internal error: LV %s allocation policy set to invalid cling_by_tags.Internal error: LV name %s has invalid form.Internal error: LV %s tag %s has invalid form.Internal error: #LVs (%u) != #visible LVs (%u) + #snapshots (%u) + #internal LVs (%u) in VG %sInternal error: Duplicate LV name %s detected in %s.Internal error: Duplicate LV id %s detected for %s in %s.Internal error: Segment in %s is not 2-way.Internal error: Segment in %s has wrong number of areas: %d.Internal error: Volume group %s has limited PV/LV count but limit is not set.Internal error: VG references non pool metadata spare LV %s.Internal error: VG %s with lock_type %s without lock_argsInternal error: VG %s with lock_type %s is clusteredInternal error: VG %s with lock_type %s has system_id %sInternal error: VG %s has unknown lock_type %sInternal error: VG %s has invalid lock_args charsInternal error: VG %s has lock_args %s without lock_typeInternal error: LV %s/%s has invalid lock_args charsInternal error: LV %s/%s has invalid lock_args "%s"Internal error: LV %s has duplicate lock_args %s.lock_args will be ignored on cache volInternal error: LV %s shouldn't have lock_args %s.Internal error: LV %s with no lock_type has lock_args %s.Internal error: LV %s/%s appearing in VG's historical list is not a historical LV.Internal error: Historical LV %s points to different VG %s while it is listed in VG %s.Internal error: Historical LV %s has VG UUID %s but its VG %s has UUID %sFailed to store historical LV name.Internal error: Duplicate historical LV name %s detected in %s.Failed to store historical LV id.Internal error: Duplicate historical LV id %s detected for %s in %s.Internal error: Name %s appears as live and historical LV at the same time in VG %s.Internal error: Historical LV %s is not part of any LV chain in VG %s.Failed to allocate lv_lock_args hashFailed to allocate lv_name hashUnable to split the %s segment at LE %u in LV %s.Couldn't allocate cloned LV segment.LV segment tags duplication failed.Split %s:%u[%u] at %u: %s LE %u.Split %s:%u[%u] at %u: %s PE %u.Unassigned area %u found in segment.Segment with extent %u in LV %s not found.,<Allowing forced access to clustered vg %sInvalid index (%u) of mirror image supplied to shift_mirror_images().Device path name too long - log header not written (%s).Writing log header for LV %s to device %s.%s: not found: log header not written.Failed to open %s/%s to write log header.Failed to write log header to %s.WARNING: Couldn't find device with uuid %s.Couldn't find device with uuid %s.WARNING: VG %s was previously updated while PV %s was missing.Fixing up missing size (%s) for PV %sWARNING: Physical Volume %s is too large for underlying deviceFormat does not support writing physical volumesAssertion failed: can't _pv_write non-orphan PV (in VG %s)Internal error: Missing volume group.Volume group %s is not resizeable.Internal error: FID is not defined!metadata_area allocation failed%s ignored flag for mda %s at offset %lu.Automatically removing historical logical volume %s/%s%s.Failed to handle historical LVs in VG %s.Validating volume group structure.Skipping validation of volume group structure.Cannot update partial volume group %s.Cannot update volume group %s while physical volumes are missing.Cannot update volume group %s with duplicate PV devices.Cannot update volume group %s with unknown segments in it!Internal error: Unable to find %u metadata areas to ignore on volume group %sAborting vg_write: No metadata areas to write to!Internal error: lvmcache_get_outdated_devs no vginfo %sInternal error: lvmcache_get_outdated_mdas no vginfoWARNING: wiping mda on outdated PV %sFailed to read outdated pv mda header on %sFailed to write outdated pv mda header on %sWARNING: failed to wipe mda on outdated PV %s_wipe_outdated_pvs no label for %sWARNING: wiping header on outdated PV %sWARNING: failed to wipe header on outdated PV %sInternal error: lvmcache_del_outdated_devs no vginfoInternal error: Writing metadata in critical section.WARNING: updating PV header on %s for VG %s.WARNING: updating old metadata to %u on %s for VG %s.Format does not support writing volume group metadata areas.WARNING: Failed to write an MDA of VG %s.Internal error: LV %s (UUID %s) not found in committed metadata.Internal error: lvmcache_get_mdas no vginfo %sRescan for text mismatch - no mdas.Rescan for text mismatch - no mda dev.bcache_invalidate: block (%d, %llu) still heldRescan for text mismatch - cannot invalidate.Rescan for text mismatch - no mda header.Rescan for text mismatch - bad_fields.Rescan for text checksum mismatch - now %x prev %x.Rescan skipped - unchanged offset %llu checksum %x.Rescan for text offset mismatch - now %llu prev %llu.Failed to read existing physical volume '%s'No cached label for orphan PV %sMust be exactly one data area (found %d) on PV %sMust be at most one bootloader area (found %d) on PV %sWARNING: PV %s is marked in use but no VG was found using it.WARNING: PV %s might need repairing.Failed to allocate pv structure.Volume group name "%s" has invalid characters.Can't allocate DM cache memory for VG %s.WARNING: activating multiple VGs with the same name is dangerous and may fail.Cannot reopen rw device %u:%u with no valid paths di %d fd %d.Cannot reopen rw device %u:%u with no valid name di %d fd %d.Failed to open writable %s index %d fd noneFailed to open writeable %s index none fd %dFailed to open rw %s errno %d di %d fd %d.Internal error: Cannot change not opened DI with FD:%dreopen writeable %s close prev errno %d di %d fd %d.reopen writable %s di %d prev %d fd %dIgnoring metadata for VG %s from missing dev.Reading VG %s metadata from %s %lluWARNING: Reading VG %s on %s failed.WARNING: ignoring metadata seqno %u on %s for seqno %u on %s for VG %s.WARNING: Inconsistent metadata found for VG %s.See vgck --updatemetadata to correct inconsistency.Internal error: lvmcache_update_vg %s no vginfolvmcache_update_vg %s vginfo from metadataWARNING: outdated PV %s seqno %u has been removed in current VG %s seqno %u.See vgck --updatemetadata to clear outdated metadata.lvmcache_update_vg %s no info for %s %sWARNING: PV %s %s belongs to VGID %s, ignoring claim from VGID %s (%s).WARNING: PV %s %s belongs to VG %s, ignoring claim from VG %s.lvmcache_update_vg %s failed to update info for %slvmcache_update_vg %s copy ignored mdas for %slvmcache_update_vg %s failed to update mdas for %svg_read %s ignore mda for outdated dev %sInternal error: Verify PV info in %s: skip, no devVerify PV %s in %s: uncertain, no pvidVerify PV %s %s in %s: uncertain, no vginfoVerify PV %s %s in %s: fail, other VG %sVerify PV %s %s in %s: fail, other vgid %sWARNING: PV %s in VG %s is using an old PV header, modify the VG to update.WARNING: PV %s in VG %s is missing the used flag in PV header.Failed to destroy record about historical LV %s/%s.WARNING: failed to strip outdated historical lvs.Outdated record for historical logical volume "%s" automatically destroyed.VG %s is missing PV %s (last written to %s)WARNING: VG %s is missing PV %s (last written to %s).WARNING: VG %s is missing PV %s.WARNING: VG %s has unused reappeared PV %s %s.WARNING: VG %s was missing PV %s %s.WARNING: One or more devices used as PVs in VG %s have changed sizes.WARNING: Couldn't find all devices for LV %s while checking used and assumed devices.WARNING: Device mismatch detected for %s which is accessing %s instead of %s.Cannot access VG %s with lock type %s that requires lvmlockd.Cannot access VG %s due to failed lock.Test mode is not yet supported with lock type %s.WARNING: Found LVs active in VG %s with foreign system ID %s. Possible data corruption.Cannot access VG %s with system ID %s with unknown local system ID.Cannot access VG %s with system ID %s with local system ID %s.Cannot use VG %s referencing incorrect PVs.(See vgreduce --removemissing with --devices options.)Cannot change VG %s while PVs are missing.See vgreduce --removemissing and vgextend --restoremissing.WARNING: vg_read no vg copy: pool locked.WARNING: vg_read no vg copy: copy exists.WARNING: vg_read no vg copy: pre copy exists.Internal error: Missing committed config tree.Internal error: vg_read vg %p vg_precommitted %pInternal error: vg_read vg %p vg_committed %pCannot change VG %s with unknown segments in it!Reopen writeable %s uncached fd %d di %dFailed to change to rw fd %s di %d fd %d.Failed to find mirror_seg for %sLV %s on %s is not a mirror segments.Internal error: Log LV %s is not top level LV for initialization.Test mode: Skipping mirror log initialisation.Aborting. Unable to create in-sync mirror log while activation is disabled.Aborting. Unable to tag mirror log.Aborting. Failed to activate mirror log.Aborting. Failed to wipe mirror log.Aborting. Failed to write mirror log header.Aborting. Failed to deactivate mirror log. Manual intervention required.Unable to deactivate mirror log LV. Manual intervention required.Manual intervention may be required to remove abandoned log LV before retrying.Manual intervention may be required to remove/restore abandoned log LV before retrying.Unable to determine mirror sync status of %s.Unable to split non-mirrored LV %s.Internal error: split_count is zero!Detaching %d images from mirror %s.Insufficient removable PVs given to satisfy request.Unable to rename newly split LV.Failed to build new mirror, %s.Failed to build new image name for %s.Failed to generate new image names for %s.Failed to group split images into new mirror.Failed to rename newly split LV in the kernelABORTING: Failed to remove orphan volume(s).Please remove orphan volume(s) when possible.Manual intervention may be required to remove/restore abandoned LVs before retrying.Reducing mirror set %s from %u to %u image(s)%s.Incompatible parameters to _remove_mirror_images.Unable to remove primary mirror image while mirror volume %s is not in-sync.%s being removed due to failures.Failed error target substitution for %s.Cannot detach mirror log from %s.Failed to initialize log device %s.Using reduced mirror region size of %sUnable to allocate mirror extents for %s.Failed to split segment at %s extent %u.Failed to add mirror areas to %s.Internal error: Non-pvmove LV, %s, passed as argument.Internal error: Bad segment type for first segment area.Failed to build pvmove LV-type mirror %s.Internal error: Unknown mirror flag.Failed to find segment for %s extent %u.Unable to determine mirror sync status.Full resync required to convert inactive mirror volume %s to core log. Proceed? [y/n]: Logical volume %s NOT converted.Failed to build new mirror log name for %s.Failed to build new mirror image name for %s.Aborting. Failed to create mirror image LV. Remove new LV and retry.Failed to add mirror image segment to %s. Remove new LV and retry.Aborting. Failed to add mirror image segment to %s. Remove new LV and retry.Aborting. Failed to add mirror segment. Remove new LV and retry.Adjusting region_size to %s for mirrored log.Failed to initialise mirror log.Skipping clustered VG %s.Volume group %s is read-onlySettingClearingWriting metadata for VG %s.WARNING: mda without device.Failed to write VG %s.WARNING: Duplicate id found!%s=%s%s=%llu#orphans_lvm2PV %s size is zero.pv allocation failedmissingnaReading orphan VG %s.Can't get lock for %s.VG name not found for vgid %sVolume group "%s" not foundRescanning DM cache.lvmcache_update_vg %s for %sVolume group "%s" not found.Reading VG %s without a lock.Volume group %s is exportedVolume group %s is read-only.Failed to import written VG.vg_devs_checkRescanning devices for %s %sReading VG %s %sLV %s assigned to be split.lv_list alloc failed._mimage_%d%s_mimage_%%dUnable to allocate memory. and no log volumeFailed to add mirror images.All mimages of %s are gone.%u image(s) removed from %s._mimage_0_mlogtmp_%dFailed to create mirror log.Failed to form mirrored log.metadata/pv_list.cAllocation of list failed.rmeta%s_%s_%%dcoreFailed to convert mirror logNot a mirror segment.Discarding message for LV %s.%s_pmsparemetadata/pv.cSkipping invalid tag %s.Failed to clone PV name.pv_segment allocation failed%s %u: %6u %6u: %s(%u:%u)Gap in pvsegs: %u, %uWrong lvseg area typeInconsistent pvseg pointersInconsistent length: %u %uto_go <= pva->countMemory allocation failed.%s_%s%sFailed to allocate new name.raid0_metaFailed to get device count.Failed to get device health.%s called on non-raid1 LV._rimage_0Adding %s to %s.Failed to add %s to %s._rimage_metadata/segtype.cAdding PE range: start PE %u length %u on %s.Overlapping PE ranges specified (%u-%u, %u-%u) on %s.WARNING: Physical volume %s not allocatable.WARNING: Physical volume %s is missing.WARNING: No free extents on physical volume "%s".Unable to allocate physical volume list.Allocation of pe_ranges list failed.PE range error: start extent %u to end extent %u.Physical extent parsing error at %s.Activating logical volume %s before %s in kernel.Failed to activate %s before resuming %s.Internal error: Bad type provided to _alloc_raid_component.Component name for raid %s is too long.Failed to allocate new raid component, %s.Failed to add segment to LV, %s.Unable to allocate extents for mirror(s).Aborting. Unable to inherit tag.WARNING: Can't deactivate temporary volume %s.Mirror %s already has a %s log.Log type "mirrored" creation/conversion is not supported for regular operation!Log type "mirrored" is DEPRECATED. Use RAID1 LV or disk log instead.Unable to allocate extents for mirror log.Removing more than existing: %d <= %d.Persistent log is not supported on segment-by-segment mirroring.Segment is not mirrored: %s:%uSegment status does not match: %s:%u status:0x%lx/0x%lxInternal error: Unable to attach pool metadata LV to %s segtype.Internal error: Logical volume %s is not valid pool.Internal error: Unable to attach pool data LV to %s segtype.Internal error: No pool associated with %s LV, %s.Internal error: Cannot detach pool from LV %s.Internal error: Trying to delete %u again.Internal error: Unsupported message type %u.Failed to create historical LV representation for removed logical volume %s.Initialization of historical LV representation for removed logical volume %s failed.%s is referenced by more than one segment (%s, %s).Pool segment not found for %s.%s on %s is not a %s pool segmentInternal error: %s is not a pool logical volume.No usable device hint found while recalculating pool chunk size for %s.Calculated chunk size %s for pool %s is out of allowed range (%s-%s).Updating chunk size %s for pool %s to %s.Size %s of pool metadata volume %s is bigger then maximum usable size %s.Reducing pool metadata size %s to maximum usable size %s.Can't use volume %s with size %s as pool metadata. Minimal required size is %s.Extending pool metadata size %s to required minimal size %s.Internal error: LV %s is not pool metadata spare.Internal error: LV %s has no suffix for pool metadata spare.Failed to generate unique name for pool metadata spare logical volume.Renaming existing pool metadata spare logical volume "%s" to "%s/%s".Preparing pool metadata spare volume for Volume group %s.Unable to deactivate pool metadata spare LV. Manual intervention required.Can't create pool metadata spare. Name of pool LV %s is too long.Renaming %s as pool metadata spare volume %s.WARNING: recovery of pools without pool metadata spare LV is not automated.Dropping unused pool metadata spare LV %s.Adding new pool metadata spare %u extents.Extending pool metadata spare from %u to %u extents.Internal error: PV %s unexpectedly not in cache.No specified PVs have space available.Failed to create PV entry for missing device.Physical Volume "%s" not found in Volume Group "%s".Segment with extent %u in PV %s not foundMissing PV segment on %s at %u.Internal error: _merge_free_pv_seg called on a segment that is not free.Internal error: WARNING: PV %s is without initialized PE ranges.PV segment pe_count mismatch: %u != %uPV segment pe_alloc_count mismatch: %u != %uPV segment VG pv_count mismatch: %u != %uPV segment VG free_count mismatch: %u != %uPV segment VG extent_count mismatch: %u != %uAllowing allocation on %s start PE %u length %uCannot restripe LV %s from %u to %u stripes during conversion.Adjusting region_size from %s to %s for %s.Region size may not be smaller than stripe size on %s LV %s.Region size is too large for %s LV %s.Adjusting region size of %s LV from %s to %s.Internal error: Missing image sub lv in area %u of LV %s.Failed to prevent PVs holding image components from LV %s being used for allocation.Internal error: LVs must be set visible before removing.Internal error: Unable to remove RAID layer from segment type %s.Internal error: Unable to remove RAID layer when there is more than one sub-lv.Internal error: stripes may not be 0.Can't convert %s LV %s with number of stripes not divisible by number of data copies.Internal error: LV %s is missing stripes.Failed to find a valid mirror in stripe %u!Failed to new raid name for %s.New logical volume name "%s" is not valid.%sLogical Volume %s already exists in volume group %s.Can't remove reshape space from inactive LV %s.Can't get data offset for %s from kernel.Failed to allocate out-of-place reshape space for %s.Checking raid device count for LV %s/%sNo proper new segment length for %s!Failed to build list of PVs for %s.Internal error: Unable to allocate RAID metadata area for non-linear LV %s.Extracting image components %s and %s from %s.Can't change number of mirrors of degraded %s.Please run "lvconvert --repair %s" first.WARNING: %s already has image count of %d.Failed to extract images from %s.Integrity must be removed before converting raid to linear.Are you sure you want to convert %s LV %s to type %s losing all resilience? [y/n]: Logical volume %s NOT converted to "%s".Failed to remove RAID layer after linear conversion.Can't add image to out-of-sync RAID LV: use 'lvchange --resync' first.Can't add image to RAID LV that is still initializing.RAID module does not support rebuild+emptymeta.Unable to add RAID images to %s of segment type %s.Failed to clear REBUILD flag for %s components.Allocation of new meta areas failed.Allocation of new areas failed.%s is out-of-sync! Please try refreshing first.Minimum 3 stripes required for %s LV %s.Internal error: No change of image count on LV %s.Ignoring layout change on device removing reshape.WARNING: Removing stripes from active%s logical volume %s will shrink it from %s to %s!THIS MAY DESTROY (PARTS OF) YOUR DATA!Interrupt the conversion and run "lvresize -y -l%u %s" to keep the current size if not done already!If that leaves the logical volume larger than %llu extents due to stripe rounding,you may want to grow the content afterwards (filesystem etc.)WARNING: to remove freed stripes after the conversion has finished, you have to run "lvconvert --stripes %u %s"Can't remove stripes without --force option.Are you sure you want to remove %u images from %s LV %s? [y/n]: No correct kernel/lvm active LV count on %s.No correct kernel/lvm total LV count on %s.Failed to adjust LV %s to new size!Removing %u data and metadata image LV pair%s from %s.Internal error: Bad return provided to %s.WARNING: ignoring --stripesize on conversion of %s to 1 stripe.%s cannot be merged because --trackchanges was not used.Unable to merge non-raid image %s.Unable to find containing RAID array for %s.Failed to find meta for %s in RAID array %s.Failed to deactivate %s before merging.%s successfully merged back into %s.Allocating metadata LVs for %s.Allocating new metadata LV for %s.Failed to allocate metadata LV for %s.Failed to allocate metadata LVs for %s.Clearing newly allocated metadata LVs for %s.Failed to initialize metadata LVs for %s.Adding newly allocated metadata LVs to %s.Failed to add newly allocated metadata LVs to %s.Internal error: Unrecognised segment type flag 0x%016lxInternal error: No segment for %s.Failed to retrieve raid0 segments from %s._raid_reshape_remove_imagesconsume_pv_areaLogical volume %s is already of requested type %s.An entire mirror group has failed in %s.All components of raid LV %s have failed.More than %u components from %s %s have failed.%s contains a segment incapable of degraded activation.Logical volume %s already is type %s.Converting the segment type for %s from %s to %s is not supported.Converting the segment type for %s from %s to %s is not supported yet.Extracting all MetaLVs of %s to activate as raid0.Deactivating pulled out MetaLVs of %s before initializing.Clearing allocated raid0_meta metadata LVs for conversion to raid4.Failed to initialize metadata LVs.Adding metadata LVs back into %s.%s is not a RaidLV with metadata.Can't clear transiently failed devices on still failed %s.Internal error: Missing metadata areas on %s!Can't %s failed devices with active %s metadata volume %s.Skipping activation of failed devices for degraded %s metadata volume %s.Failed to activate %s metadata volume %s.Skipping clear of failed devices for degraded %s metadata volume %s.Failed to build device path for %s.Failed to %s failed device(s) in superblock of %s metadata volume %s.%s %u failed device(s) in superblock of %s metadata volume %s.The %s volume %s is %s with %u transiently failed device(s).Volume has been restored after clearing %u superblocks(s). Once online please check its content.Cannot determine sync percentage of %s.Unable to determine sync status of %s.WARNING: Sync status for %s is inconsistent.Unable to convert %s while it is not in-sync.Clearing newly allocated metadata LVs.Failed to allocate metadata LV for %s in %s.Failed to allocate meta areas memory.Internal error: Cannot change region size of %s.Region size is already %s on %s LV %s.Region size is already matching %s on %s LV %s due to adjustment.Do you really want to change the region_size %s of LV %s to %s? [y/n]: Region size %s on %s is too small for metadata LV size.Unable to change region size on %s LV %s while it is not in-sync.Converting %s LV %s to regionsize %s.Changed region size on %s LV %s to %s.%s must be active to perform this operation.Internal error: New segtype not specified.Unable to handle raid arrays with more than %u devices.Checking LV %s requested %s segment type for convenienceConvert %s LV %s to 2 images first.WARNING: Converting %s LV %s to %u stripes first.Converting %s LV %s to %u stripes first.Convert %s LV %s to raid4/raid5 first.Convert %s LV %s to 2 stripes first (i.e. --stripes 1).Replaced LV type %s%s with possible type %s.Repeat this command to convert to %s after an interim conversion has finished.Unable to convert LV %s from %s to %s.WARNING: ignoring --stripes option on takeover of %s (reshape afterwards).WARNING: ignoring --stripesize option on takeover of %s (reshape afterwards).Are you sure you want to convert %s LV %s%s%s%s? [y/n]: Can't convert RAID LV %s while under snapshot.RAID module does not support reshape.Region size may not be smaller than stripe size on LV %s.Can't remove stripes from raid10.Unable to convert stacked volume %s.Unable to convert %s containing sub LVs to remove after a reshape.Run "lvconvert --stripes %u %s" first.Internal error: Failed to free reshape space of %s.No change in RAID LV %s layout, freeing reshape space.LV %s does not have reshape space allocated.Can't reshape out of sync LV %s.Device count is incorrect. Forgotten "lvconvert --stripes %d %s" to remove %u images after reshape?Internal error: Bad return=%d provided to %s.Converting stripesize %s of %s LV %s to %s.Ignoring layout change on device adding reshape.Can't reshape %s LV %s to odd number of stripes.WARNING: Adding stripes to active%s logical volume %s will grow it from %u to %u extents!Run "lvresize -l%u %s" to shrink it or use the additional capacity.Are you sure you want to add %u images to %s LV %s? [y/n]: Adding %u data and metadata image LV pair%s to %s.Allocating reshape space for %s.(Re)allocating reshape space for %s.Setting delta disk flag on new data LVs of %s.Converting %s%s LV %s to %s%s.Are you sure you want to convert %s LV %s? [y/n]: %sllocating reshape space for %s.Reshape request failed on LV %s.Invalid conversion request on %s.Can't convert %s LV %s to %s containing sub LVs to remove after a reshape.WARNING: Converting %s LV %s to 2 stripes first.Failed to allocate memory for unknown segtypeWARNING: Unrecognised segment type %sCannot convert striped LV %s with non-power of 2 stripe size %u.Failed to allocate empty image components for raid0 LV %s.Failed to insert linear LVs underneath %s.Internal error: Invalid data lvs for raid0 LV %s.Failed to allocate new raid0 segment for LV %s.Cannot convert striped LV %s with varying stripe count to raid0.Are you sure you want to convert %s back to the older %s type? [y/n]: Internal error: raid1 conversion supported only.can't convert %s to fewer than 2 data_copies.Unable to handle mirrors with more than %u devices.Unable to convert %s LV %s with %u images to %s.At least reduce to the maximum of %u images with "lvconvert -m%u %s".Changing image count to %u on %s.Extracting and renaming metadata LVs.Internal error: Name %s lags image part.Snapshot volume cannot be smaller than 3 chunks (%u extents, %s).an origin that has a merging snapshotWARNING: Snapshots of mirrors can deadlock under rare device failures.WARNING: Consider using the raid1 mirror type to avoid this.WARNING: See global/mirror_segtype_default in lvm.conf.Snapshots of %s are not supported.Failed to deactivate logical volume "%s"Failed to remove internal snapshot LV %sPostponing write and commit for remove of snapshot %s.Failed to refresh %s without snapshot.Internal error: LV %s already has external origin.Setting logical volume "%s" read-only.Internal error: Inconsistent external origin.Internal error: LV %s is not a thin pool.Internal error: Cannot attach message to non-pool LV %s.Message referring LV %s already queued in pool %s.Delete for device %u already queued in pool %s.Failed to allocate memory for message.Internal error: thin_pool_is_active called with non thin pool volume %s.Pool's thin volume %s is active.Internal error: LV %s is not thin pool.WARNING: Thin pool %s%s%s%s%s%s.Threshold configured for free data space in thin pool %s has been reached (%s%% >= %s%%).WARNING: Remaining free space in metadata of thin pool %s is too low (%s%% >= %s%%). Resize is recommended.Threshold configured for free metadata space in thin pool %s has been reached (%s%% > %s%%).WARNING: Thin pool %s has unexpected transaction id %lu, expecting %lu%s. and the size of whole volume group and the amount of free space in volume groupWARNING: Sum of all thin volume sizes (%s) exceeds the size of thin pool%s%s%s (%s).WARNING: You have not turned on protection against thin pools running out of space.WARNING: Set activation/thin_pool_autoextend_threshold below 100 to trigger automatic extension of thin pools before they get full.WARNING: Set activation/thin_pool_autoextend_percent above 0 to specify by how much to extend thin pools reaching the threshold.Can't use "%s" as external origin with "%s" pool. Size %s is not a multiple of pool's chunk size %s.Internal error: Cannot find configuration.Thin pool chunk size calculation policy "%s" is unrecognised.Using metadata size without cropping.Thin pool discards type "%s" is unknown.Thin pool chunk size %s is not in the range %s to %s.Thin pool chunk size %s must be a multiple of %s.Chunk size must be a power of 2 for this thin target version.Internal error: Could not find configuration.WARNING: Chunk size is too small for pool, suggested minimum is %s.WARNING: Chunk size is smaller then suggested minimum size %s.Selected chunk size %s cannot address more than %s of thin pool data space.Thin pool volume with chunk size %s can address at most %s of data.Size of %s data volume cannot be smaller than chunk size %s.WARNING: Pool zeroing and %s large chunk size slows down thin provisioning.WARNING: Consider disabling zeroing (-Zn) or using smaller chunk size (<%s).Preferred pool metadata size %s.Cannot use %s volume %s as external origin.Cannot use active LV for the external origin., perhaps skipped in lvm.conf volume_list?Cannot activate thin pool %s%sPool %s needs to be locally active for threshold check.Free space in pool %s is above threshold, new volumes are not allowed.Failed to suspend %s with queued messages.Internal error: Unrecognized index state: %u.Failed to build VDO DM name %s.Cannot parse %s VDO pool status %s.statistics/logical_blocks_usedclearfully operationalstill failedClearedCountedRemoving mirror log %s.Failed to remove mirror log.Setting new segtype for %s.Renaming %s to %s.Rea--stripes-I/--stripesize-R/--regionsizeLV %s already has %u stripes.Too few stripes requested.Converting %s from %s to %s.Failed to allocate name.Adjust data LVs of %s._mimage_Data LV renamed to %s.raid with integritylocked volumespvmoved volumeshidden volumescache type volumesthin pool type volumesmirror subvolumesraid subvolumesFailed to resume %s.Added %s message. has read-only metadata is erroring needs check is out of data space is failed or lower by 1no free space in volume groupperformanceCropping metadata size to %s.nopassdownSetting chunk size to %s.Setting chunk size %s.Enabling%s pool zeroing on default.internalwritableclosedopeningclosingstatistics/data_blocks_used0P`p@     _raid_reshape@CNew size %lu for %s%s not an exact number of new extents.New extent count %lu for %s%s exceeds 32 bits.Couldn't read 'device_count' or 'stripe_count' for segment '%s'.Only one of 'device_count' and 'stripe_count' allowed for segment '%s'.alloc_time_item: dm_pool_zalloc failedCouldn't read 'mirror_count' for segment '%s'.Couldn't read 'extents_moved' for segment %s of logical volume %s.Couldn't read 'region_size' for segment %s of logical volume %s.Unrecognised mirror log in segment %s of logical volume %s.Missing region size for mirror log for segment %s of logical volume %s.Couldn't find mirrors array for segment %s of logical volume %s.struct mirr_state allocation failedMirrored transient status: "%s"Active mirror has a wrong number of mirror images!Metadata says %u, kernel says %u.Check for existence of mirror log %s failed.Mirror log mismatch. Metadata says %d:%d, kernel says %u:%u.Check for existence of mirror image %s failed.Failed to find image %d (%d:%d).Couldn't read '%s' for segment %s of logical volume %s.Couldn't find RAID array for segment %s of logical volume %s.Bad volume name in areas array for segment %s.Couldn't find volume '%s' for segment '%s'.Missing data device in areas array for segment %s.Incorrect number of areas in area array for segment '%s'.Failed to import RAID component pairs.Target raid does not support %s.RAID target does not support RAID4 for LV %s.Internal error: _raid_add_target_line called with no areas for %s.Unable to handle more than %u devices in a single RAID arrayMissing region size for raid segment in %s.Internal error: Invalid request for delta disks minus and delta disks plus!mirror string list allocation failedraid module string list allocation failedWARNING: Failed to reserve memory, %d bytes missing.Allocation of maps buffer failed.%s area unreadable %s : Skipping.%s ignore filter '%s' matches '%s': Skipping.%s default filter '%s' matches '%s': Skipping.%s_filter '%s' matches '%s': Skipping.%s %10ldKiB %12lx - %12lx %c%c%c%c%sActive raid has a wrong number of raid images!Check for existence of raid meta %s failed.Check for existence of raid image %s failed.Failed to create cache for values used during reporting._get_now: failed to cache current time_preparse_fuzzy_time: dm_pool_alloc failedUnrecognized string in date/time specification at "%s".Unrecognized number in date/time specification at "%s".Mixed absolute and relative date specification found at "%s".Ambiguous date specification found at "%s".Mixed absolute and relative time specification found at "%s".Ambiguous time specification found at "%s"._translate_time_items: invalid time._translate_time_items: dm_snprintf failed_translate_time_items: dm_pool_strdup failed_get_now: dm_pool_zalloc failedFailed to get value for parsed time specification.Failed to allocate space to store time range.Deprecated VDO setting write_policy specified.Deprecated VDO setting use_metadata_hints specified.Sysinfo free:%llu bufferram:%llu sharedram:%llu freehigh:%llu unit:%u.Failing to parse value from %s. %s RAM for physical volume size %s%s %s RAM for virtual volume size %s%s %s RAM for block map cache size %s%sNot enough free memory for VDO target. %s RAM is required, but only %s RAM is available.VDO requires %s RAM, currently available %s RAM.Failed to allocate volume group structureInternal error: global memory pool used for VG %sPhysical Extent size must be a multiple of %s when not a power of 2.Metadata format only supports Physical Extent sizes that are powers of 2.Extent size must be between %s and %sExtent size must be multiple of %sVolume group "%s" must be resizeable to change PE sizeNew extent size is not a perfect fitUnassigned area %u found in segmentVolume group "%s" must be resizeable to change MaxLogicalVolumeMaxLogicalVolume is less than the current number %d of LVs for %sVolume group "%s" must be resizeable to change MaxPhysicalVolumesMaxPhysicalVolume limit is 255MaxPhysicalVolumes is less than the current number %d of PVs for "%s"Internal error: Unable to find configuration for %s options.Too many options for %s command.Invalid string in config file: global/%s_options.Failed to build device path for VDO formatting of data volume %s.Slab size %s converted to %u bits.Internal error: Failed to wipe logical VDO data for volume %s.WARNING: Cannot read output from %s.Logical blocks defaulted to %lu blocksAvailable VDO logical blocks %lu (%s).Number of VDO logical blocks was not provided by vdo_format output.Using bigger VDO virtual size unaligned on extent size by %s.Rounding size up to 4,00 KiB VDO logical extent boundary: %s.Test mode: Skipping formatting of VDO pool volume.Cannot format VDO pool volume %s.Cannot deactivate formatted VDO pool volume %s.Cannot create fully fitting VDO volume, --virtualsize has to be specified.Size %s for VDO volume cannot be smaller then extent size %s.Can't prepare vdo pool name for %s.Can't generate new name for %s.Aborting. Failed to wipe VDO data store %s.Names including "%s" are reserved. Please choose a different LV name.Names starting "%s" are reserved. Please choose a different LV name.Missing region size for mirror segment.Failed to build uuid for log LV %s.Failed to build uuid for mirror LV %s.WARNING: Mirror %s without monitoring will not react on failures.Couldn't find mirror log uuid %s.Internal error: Name is too long.Failed to create udev library context.Lock: Memlock counters: prioritized:%d locked:%d critical:%d daemon:%d suspended:%dSkipping memory locking (reserved memory: %zu stack: %zu).Skipping %slocking of memory maps (running in VALGRIND).Raised task priority %d -> %d.WARNING: setpriority %d failed: %s.Entering critical section (%s).Entering prioritized section (%s).Restoring original task priority %d.WARNING: setpriority %u failed: %s.Unlock: Memlock counters: prioritized:%d locked:%d critical:%d daemon:%d suspended:%dSkipping memory unlocking (reserved memory: %zu stack: %zu).Internal error: Reserved memory (%ld) not enough: used %ld. Increase activation/reserved_memory?Suppressed internal error: Maps lock %ld < unlock %ld, a one-page difference.Internal error: Missing command.wait4 child process %u failed: %sUnexpected errno: %d on lockfile open, returning runningUnexpected errno: %d on lockf, returning runningdbus daemon not running, not notifyingorg.freedesktop.systemd1.NoSuchUnitorg.freedesktop.DBus.Error.ServiceUnknownFailed to parse dbus response message: %dBad return value from dbus service: %ddevice_countstripe_countreport/report.c Mirrors %umirror/mirrored.c Mirror size %u Mirror log volume %s Mirror region size %s Mirror original: Mirror destinations: Raid Data LV%2d Raid Metadata LV%2d %smirror_countextents_movedmirror_count = %uextents_moved = %umirror_log = "%s"region_size = %uFound mirror log at %d:%dStatus of log (%d:%d): %c.Found mirror image at %d:%dStatus of image %d: %c.raid0_lvsstripe_sizemin_recovery_ratemax_recovery_rateNo areas found for segment %s_rmeta_raid4Unsupported raid type %s.locale/locale-archiveUnlmunlockalllseekmunlock%lx-%lx %c%c%c%c%nFailed to parse maps line: %s%socked %ld bytesraid0_lvstripe_count = %ustripe_size = %udevice_count = %uwritebehind = %umin_recovery_rate = %umax_recovery_rate = %udata_offset = %uRaid transient status %s.time_nowdevice_mapper/libdm-report.c@%ld:@%ldasyncasync-unsafeUnknown VDO write policy %s.AnonPagesMemAvailableMemFreeMemTotalShmemSwapFree%s/meminfoParsed %s = %lu KiB. %s RAM for index memoryVDO configuration needs%s.Allocated VG %s at %p.Failed to allocate VG name.Freeing VG %s at %p. free space allocated space PV segment start PV segment length area length extents moved virtual extents pvseg start pvseg length area startMaxLogicalVolume limit is 255STDINmisc/lvm-exec.cwaitpid--logical-size=%luK--slab-bits=%u--uds-memory-size=%u--uds-memory-size=0.%2u--uds-sparseCommand %s failed.Skipping VDO formatting %s._vdata%s_vpool%%dsync_dir failed in strdup%s: write error_undo_flock %sUnlocking %sflock_drop_shared_flock %s.SIG_SETMASKsigprocmasksigaction_block_signals_do_flock %s %c%cGiving up waiting for lock.pvmovelog uuid pool_strdup failedmisc/lvm-wrappers.cCould not get udev state.Assuming udev is not running.read_urandom: /dev/urandomLocking memory%s/self/mapsproc_dir too longgetprioritysuspendingUnlocking memoryExecuting:%sforkexecvpChild %u exited abnormally%s failed: %u/var/lock/lvm/lvmdbusdLVM_DBUSD_LOCKFILEnotify/lvmnotify.cFailed to connect to dbus: %dcom.redhat.lvmdbus1Notify dbus at %s.ExternalEventcom.redhat.lvmdbus1.Manager/com/redhat/lvmdbus1/ManagerWARNING: %s: %s/LC_MESSAGES/gconv/gconv-modules.cache/ld-2./libattr.so./libblkid.so./libbz2.so./libcap.so./libdl-/libdw-/libedit.so./libelf-/libgcrypt.so./libgpg-error.so./liblz4.so./liblzma.so./libmount.so./libncurses.so./libpcre.so./libpcre2-/libreadline.so./libresolv-/libselinux.so./libsepol.so./libsystemd.so./libtinfo.so./libudev.so./libuuid.so./libz.so./libzstd.so./libjson-c.so./libkeyutils.so./libcrypto.so./libnvme.so./etc/selinuxxZ3$i'*  ''''''''' !!" !##$ #%#&#' '( () )* *+,/)0)1)2)3)4)5)6)7)8)9):)cachecrypterrorlinearmirrorsnapshotsnapshot-originsnapshot-mergestriped zero writecache integrity thin-pool thinvdoraid0raid0_metaraid1raid10raid4raid5_nraid5_laraid5_raraid5_lsraid5_rsraid6_n_6raid6_zrraid6_nrraid6_ncraid6_ls_6raid6_rs_6raid6_la_6 raid6_ra_6raid5raid6raid10_nearD-Bus notification failed[vdso][vsyscall][vectors]pvmovesnapshot_cdata_cmeta_corig_cpool_cvol_wcorig_mimage_mlog_rimage_rmeta_tdata_tmeta_vdata_imeta_iorig_pmspare_vorigin0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z- and,,shrinkingrebuild+emptymetreshapingqueueallocatableextendableinitial image syncconvertingallocation lockedfixed minormerge failedsnapshot invalidlive table presentinactive table presentwriteableread-only-overrideFailed to get segtype name.mergingimage syncedactive locallylvname snprintf faileddm_pool_strdup failedsharedunmanagedFailed to allocate buffer.active exclusivelyInternal error: Using string as sort value for numerical field.dm_report_field_string: dm_pool_strdup failedInternal error: Unknown discards type encountered.Kernel reports unknown discards status %u.lvseg_kernel_discards_dup_with_info_and_seg_status: dm_pool_strdup failed.Failed to allocate buffer for host.Failed to create list of writecache settings.Failed to create list of integrity settings.modules str_list allocation failedNo lv_raid found for lv_image %s lv_iorig %sNo raid seg found for lv_raid %s lv_image %s lv_iorig %sNo raid health for seg area %u lv_raid %s lv_image %s lv_iorig %sraid health %c for seg area %u lv_raid %s lv_image %s lv_iorig %sNo seg area found for lv_raid %s lv_image %s lv_iorig %sNo lv_image found for lv_iorig %sFailed to allocate buffer for mode.Failed to allocate buffer for time.Failed to display layout for LV %s/%s.Failed to display role for LV %s/%s.unknown01check neededskip activationhistoricalsnapshot-mergerefresh neededmismatches existwritemostlyout_of_data Device ID %usnapshot/snapshot.cmerging_storecow_storestriped/striped.ccow_store = "%s"merging_store = "%s"thin_pool = "%s"transaction_id = %ludevice_id = %dexternal_origin = "%s"merge = "%s"snapshot-originzero/zero.c Stripes %u Stripe size %s Stripe size %u KB Stripe %d: Discards %s Thin count %u Transaction ID %lu Zero new blocks %sdiscards = "%s"zero_new_blocks = 1crop_metadata = %umessage%d {create = "%s"delete = %d# linearstripeexternal_originMissing metadata uuid %s.Ignoring %lu of device.Missing pool uuid %s.Thin pool delete %u.Thin pool create_%s %s.Missing thin pool uuid %s.abbrev_dup_uuid/uuid.chexnew UUIDLV percent: %sdataBlocksUsedlogicalBlocksUsedstatsVDO property %s = %lu%llu %llu %llu %lludevice_mapper/libdm-targets.c%llu %llu %15sCached as inactive %s.dev_manager%sblock/dm-%u/holdersCached as not present %s.undefinedqueue when fullqueue if no spaceerror when fullerror if no spacero-overrider-overrideread-writeinactive tableinactivelive tableliveactive remotelyfixedundefUnique identifier.LV layout.LV role.Set if LV is being converted.LV allocation policy.Active state of the LV.Size of LV in current units.Number of segments in LV.The integrity modeThe integrity block sizeTags, if any.Set if the LV is historical.The writecache block sizeLV permissions.Set if LV is suspended.Set if LV device is open.Total cache blocks.Used cache blocks.Dirty cache blocks.Cache read hits.Cache read misses.Cache write hits.Cache write misses.Cache policy used in kernel.LV health status.Set if snapshot merge failed.Total writecache blocks.Total writecache free blocks.Total writecache errors.Type of metadata.Name.Device major number.Device minor number.PV header extension version.Size of PV in current units.Set if PV is used.Device ID such as the WWID.VG permissions.Set if VG is extendable.Set if VG is exported.Set if VG is partial.VG allocation policy.Set if VG is clustered.Set if VG is shared.Number of PVs in VG.Number of LVs.Number of snapshots.Type of LV segment.Number of data copies.Integrity settings.Sparse indexing (vdopool).IO enqueue (vdopool).Number of extents in segment.Description of Device Type.Log sequence number.Log type.Current context.Current object type.Current object name.Current object ID.Current object group.Current object group ID.Log message.Errno.Return code.vg_Logical Volumelv_Logical Volume Device InfoLogical Volume Device StatusPhysical Volumepv_Physical Volume LabelLogical Volume SegmentPhysical Volume Segmentpvseg_Device Typesdevtype_Command LogInternal error: Unrecognized VDO write policy: %u.Couldn't read chunk size for snapshot.Merging store must be a string in segment %s of logical volume %s.Both snapshot cow and merging storage were specified in segment %s of logical volume %s.Cow store must be a string in segment %s of logical volume %s.Snapshot cow storage not specified in segment %s of logical volume %s.Snapshot origin not specified in segment %s of logical volume %s.Snapshot origin must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for snapshot cow store in segment %s of logical volume %s.Unknown logical volume %s specified for snapshot origin in segment %s of logical volume %s.Couldn't read 'stripe_count' for segment '%s'.Target snapshot may leak metadata.snapshot string list allocation failedString list allocation failed for thin_pool.String list allocation failed for thin.zero module string list allocation failedCouldn't read stripe_size for segment %s of logical volume %s.Couldn't find stripes array for segment %s of logical volume %s.Internal error: Invalid discards value %d.Internal error: Invalid zero new blocks value %d.Internal error: LV %s is not a thin volume.Internal error: Passed unsupported message.Metadata must be a string in segment %s of logical volume %s.Unknown metadata %s in segment %s of logical volume %s.Pool must be a string in segment %s of logical volume %s.Unknown pool %s in segment %s of logical volume %s.Could not read transaction_id for segment %s of logical volume %s.Could not read chunk_size segment %s of logical volume %s.Could not read discards for segment %s of logical volume %s.Discards option unsupported for segment %s of logical volume %s.Unsupported value %u for chunk_size segment %s of logical volume %s.Could not read zero_new_blocks for segment %s of logical volume %s.Could not read crop_metadata for segment %s of logical volume %s.Unknown LV %s for create message in segment %s of logical volume %s.Unknown message in segment %s of logical volume %s.Thin pool must be a string in segment %s of logical volume %s.Unknown thin pool %s in segment %s of logical volume %s.Origin must be a string in segment %s of logical volume %s.Unknown origin %s in segment %s of logical volume %s.Merge lv must be a string in segment %s of logical volume %s.Unknown merge lv %s in segment %s of logical volume %s.Could not read device_id for segment %s of logical volume %s.Unsupported value %u for device_id segment %s of logical volume %s.External origin must be a string in segment %s of logical volume %s.Unknown external origin %s in segment %s of logical volume %s.WARNING: Ignoring invalid string in config file %s.Internal error: Thin pool is missing metadata device.Thin pool target does not support %s chunk size (needs kernel >= 3.6).Failed to build uuid for metadata LV %s.Failed to build uuid for pool LV %s.WARNING: Thin pool target does not support discards (needs kernel >= 3.4).WARNING: Thin pool target does not support error if no space (needs version >= 1.10).Internal error: Unsupported message.Thin pool set transaction id %lu.Internal error: Segment %s has no pool.Internal error: Failed to add merged segment of %s.Device id %u is higher then %u.Thin target does not support smaller size of external origin LV %s.Failed to build uuid for external origin LV %s.Missing thin external origin uuid %s.Delaying resume for new external origin %s.Skipping checks for old devices without LVM- dm uuid prefix (kernel vsn %d >= %d).dm_report_set_output_field_name_prefix: dm_pool_strdup failedUUID contains invalid character '%c'Too many characters to be uuid.Couldn't read uuid: incorrect number of characters.Failed to mangle new device UUID "%s"New device uuid mangled [%s]: %s --> %sdm_task_set_newuuid: strdup(%s) failedWARNING: Failed to query uuid with LIST.Number of segments in active LV %s does not match metadata.Checking VDO pool stats message for LV %s.Internal error: Corrupted message structure returned: start %d > end %dInternal error: Message response doesn't contain terminating NUL characterCannot parse %s in VDO DM stats message.Get read ahead request failed: device name unrecorded.WARNING: Cannot find matching %s segment for %s.WARNING: Detected %s segment type does not match expected type %s for %s.Failed to parse writecache params: %s.Failed to parse integrity params: %s.Getting device info for %s [%s].WARNING: Using linear target for %s/%s: Striped requires extent size (%u sectors) >= page size (%u).Internal error: striped add_target_line called with no areas for %s.Kernel driver has incomplete udev support so LVM will check and perform some operations itself.sysfs_path dm_snprintf failed.Failed to parse dm device minor number from %s.Checking holder of %s %s (%u:%u) %s.Cannot find holder with device name %s in VG %s.Cached as present %s %s (%d:%d).Volume %s (%u:%u) differs from already active device (%u:%u).The requested major:minor pair (%u:%u) is already used.Failed to add device (%u:%u) to dtree.Tracking pending delete for %s%s%s (%s).Reserved value for undefined numeric value.Name. LVs created for internal use are enclosed in brackets.Full name of LV including its VG, namely VG/LV.Full pathname for LV. Blank for internal LVs.Internal device-mapper pathname for LV (in /dev/mapper directory).For LVs that are components of another LV, the parent LV.Set if mirror/RAID images underwent initial resynchronization.Set if mirror/RAID image is synchronized.Set if snapshot LV is being merged to origin.Set if LV is locked against allocation changes.Set if LV has fixed minor number assigned.Set if LV is skipped on activation.Set if LV autoactivation is enabled.For thin pools, behavior when full.Set if the LV is active locally.Set if the LV is active remotely.Set if the LV is active exclusively.Persistent major number or -1 if not persistent.Persistent minor number or -1 if not persistent.Read ahead setting in current units.For thin and cache pools, the size of the LV that holds the metadata.For snapshots and thins, the origin device of this LV.For snapshots and thins, the UUID of origin device of this LV.For snapshots, the size of the origin device of this LV.LV ancestors ignoring any stored history of the ancestry chain.LV ancestors including stored history of the ancestry chain.LV descendants ignoring any stored history of the ancestry chain.LV descendants including stored history of the ancestry chain.For RAID, number of mismatches found or repaired.For RAID, the current synchronization action being performed.For RAID1, the number of outstanding writes allowed to writemostly devices.For RAID1, the minimum recovery I/O load in kiB/sec/disk.For RAID1, the maximum recovery I/O load in kiB/sec/disk.The number of integrity mismatches.For pvmove, Source PV of temporary LV created by pvmove.For pvmove, the UUID of Source PV of temporary LV created by pvmove.For lvconvert, Name of temporary LV created by lvconvert.For lvconvert, UUID of temporary LV created by lvconvert.For mirrors, the LV holding the synchronization log.For mirrors, the UUID of the LV holding the synchronization log.For cache/thin/vdo pools, the LV holding the associated data.For cache/thin/vdo pools, the UUID of the LV holding the associated data.For cache/thin pools, the LV holding the associated metadata.For cache/thin pools, the UUID of the LV holding the associated metadata.For cache/thin/vdo volumes, the cache/thin/vdo pool LV for this volume.For cache/thin/vdo volumes, the UUID of the cache/thin/vdo pool LV for this volume.Configuration profile attached to this LV.Lock args of the LV used by lvmlockd.Creation time of the LV, if knownRemoval time of the LV, if knownCreation host of the LV, if known.Kernel device-mapper modules required for this LV.Currently assigned major number or -1 if LV is not active.Currently assigned minor number or -1 if LV is not active.Currently-in-use read ahead setting in current units.Set if LV has live table present.Set if LV has inactive table present.For snapshot, cache and thin pools and volumes, the percentage full if LV is active.For snapshots, the percentage full if LV is active.For cache and thin pools, the percentage of metadata full if LV is active.For Cache, RAID, mirrors and pvmove, current percentage in-sync.Cache settings/parameters as set in kernel, including default values (cached segments only).Cache metadata format used in kernel.For thin pools, how discards are handled in kernel.For thin pools and cache volumes, whether metadata check is needed.Set if snapshot LV is invalid.For vdo pools, its current operating mode.For vdo pools, whether compression is running.For vdo pools, state of index for deduplication.For vdo pools, currently used space.For vdo pools, percentage of saved space.Total writecache writeback blocks.Various attributes - see man page.Size of underlying device in current units.Free metadata area space on this device in current units.Size of smallest metadata area on this device in current units.Offset to the start of data on the underlying device.Total amount of unallocated space in current units.Total amount of allocated space in current units.Set if this device can be used for allocation.Set if this device is exported.Set if this device is missing in system.Total number of Physical Extents.Total number of allocated Physical Extents.Number of metadata areas on this device.Number of metadata areas in use on this device.Offset to the start of PV Bootloader Area on the underlying device in current units.Size of PV Bootloader Area in current units.Set if PV is an unchosen duplicate.Type of device ID such as WWID.Set if VG autoactivation is enabled.Total size of VG in current units.Total amount of free space in current units.System ID of the VG indicating which host owns it.Lock type of the VG used by lvmlockd.Lock args of the VG used by lvmlockd.Size of Physical Extents in current units.Total number of unallocated Physical Extents.Maximum number of LVs allowed in VG or 0 if unlimited.Maximum number of PVs allowed in VG or 0 if unlimited.Number of PVs in VG which are missing.Revision number of internal metadata. Incremented whenever it changes.Configuration profile attached to this VG.Number of metadata areas on this VG.Number of metadata areas in use on this VG.Free metadata area space for this VG in current units.Size of smallest metadata area for this VG in current units.Target number of in use metadata areas in the VG.Number of stripes or mirror/raid1 legs.Number of data stripes or mirror/raid1 legs.Size of out-of-place reshape space in current units.Size of out-of-place reshape space in logical extents.Data offset on each image device.New data offset after any reshape on each image device.Number of (rotating) parity chunks.For stripes, amount of data placed on one device before switching to the next.For mirrors/raids, the unit of data per leg when synchronizing devices.For snapshots, the unit of data used when tracking changes.For thin pools, the number of thin volumes in this pool.For thin pools, how discards are handled.For cache, metadata format in use.For cache, how writes are cached.For thin pools and volumes, if zeroing is enabled.For thin pools, the transaction id and creation transaction id for thins.For thin volume, the thin device id.Offset within the LV to the start of the segment in current units.Offset within the LV to the start of the segment in physical extents.Size of segment in current units.Size of segment in physical extents.Ranges of Physical Extents of underlying devices in command line format (deprecated, use seg_le_ranges for common format).Ranges of Logical Extents of underlying devices in command line format.Ranges of Logical Extents of underlying metadata devices in command line format.Underlying devices used with starting extent numbers.Underlying metadata devices used with starting extent numbers.Dmeventd monitoring status of the segment.The cache policy (cached segments only).Cache settings/parameters (cached segments only).Set for compressed LV (vdopool).Set for deduplicated LV (vdopool).Minimum acceptable IO size (vdopool).Allocated caching size (vdopool).Speed of cache writes (vdopool).Allocated indexing memory (vdopool).Increment size for growing (vdopool).Acknowledging threads (vdopool).IO submitting threads (vdopool).CPU threads for compression and hashing (vdopool).Threads for subdivide parts (vdopool).Logical threads for subdivide parts (vdopool).Physical threads for subdivide parts (vdopool).Maximum discard size volume can receive (vdopool).Header size at front of vdopool.Deprecated use of REQ_SYNC for writes (vdopool).Deprecated write policy (vdopool).Physical Extent number of start of segment.Name of Device Type exactly as it appears in /proc/devices.Maximum number of partitions. (How many device minor numbers get reserved for each device.)Logical Volume Device Info and Status Combinednoyes0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ!#global/thin_disabled_featuresdiscardsexternal_originblock_sizediscards_non_power_2 metadata_resize error_if_no_space @external_origin_extendthinthin-poolInternal error: _emit_target cannot handle segment type %s.Failed to build device path for checking cachevol metadata %s.Failed to build device path for checking pool metadata %s.Metadata checking skipped, detected empty disk header on %s.WARNING: Check is skipped, please install recommended missing binary %s!Found version of %s %s is %s then requested %u.%u.%u.WARNING: Cannot parse output '%s' from %s.WARNING: Check is skipped, please upgrade installed version of %s!Check of pool %s failed (status:%d). Manual repair required!WARNING: Integrity check of metadata for pool %s failed.Skipping %s callback registration for command %s.Internal error: Registering unsupported pool callback.Failed to allocated path for callback.Tracking pending delete for %s-%s (%s).Using error for pending delete of %s-%s.Couldn't determine link pathname.The link %s should have been removed by udev but it is still present. Falling back to direct link removal.%s not symbolic link - not removingCouldn't create path for volume group dir %sCouldn't create source pathname for logical volume link %sCouldn't create destination pathname for logical volume link for %sCouldn't create pathname for LVM1 group file for %sNon-LVM1 character device found at %sSymbolic link %s not created: file existsSymlink %s that should have been created by udev does not have correct target. Falling back to direct link creationSymlink %s that should have been created by udev could not be checked for its correctness. Falling back to direct link creation.The link %s should have been created by udev but it was not found. Falling back to direct link creation.Couldn't construct name of volume group directory.Interval string conversion got truncated.Failed to process request with error %s (errno: %d).%s not found in config: defaulting to "%s"Aborting. LV %s is incomplete and --activationmode partial was not specified.Internal error: Unassigned area found in LV %s.Cannot activate %s: pool incomplete.Internal error: _add_error_or_zero_device called with bad segment._add_new_lv_to_dtree: pool alloc failed for %s %s.%soaded thin volume %s with id %u is %smatching id %u.Merging of snapshot volume %s to origin %s is in progress.Postponing pending snapshot merge for origin %s, merge was not started before suspend.Postponing pending snapshot merge for origin %s, origin volume is opened.Postponing pending snapshot merge for origin volume %s, merging thin snapshot volume %s is active.Postponing pending snapshot merge for origin volume %s, merging snapshot volume %s is opened.Internal error: LV %s is not merging snapshot.Couldn't find snapshot origin uuid %s.Couldn't find snapshot for '%s'.Checking kernel supports %s segment type for %s%s%sCan't process LV %s: %s target support missing from kernel?Skipping users for already added external origin LV %s.Adding external origin LV %s and all active users.Finished adding external origin LV %s and all active users.Using error for pending delete %s.Failed to create partial dtree.Failed to add device %s (%u:%u) to dtree.%s: Reserved uuid %s on internal LV device %s not usable.%s: Reserved internal LV device %s/%s%s%s not usable.%s: Reserved uuid %s on %s device %s not usable.No space to stack fs operationInternal error: Cannot create tree for %s.Partial dtree creation failed for %s._clean_tree: Couldn't split up device name %s.Failed to remove all device symlinks associated with %s._create_lv_symlinks: Couldn't split up old device name %s._create_lv_symlinks: Couldn't split up new device name %s.Failed to create symlinks for %s._clean_tree: Failed to duplicate uuid.Successfully connected to lvmpolld on fd %d.WARNING: Failed to connect to lvmpolld. Proceeding with polling without using lvmpolld.WARNING: Check global/use_lvmpolld in lvm.conf or the lvmpolld daemon state.Internal error: Use of lvmpolld requires uuid set.Internal error: Use of lvmpolld requires vgname set.Internal error: Use of lvmpolld requires lvname set.Asking lvmpolld for pvmove%s on %s/%s.Asking lvmpolld for mirror conversion on %s/%s.Asking lvmpolld for snapshot merge on %s/%s.Asking lvmpolld for thin snapshot merge on %s/%s.Internal error: Unsupported poll operation.Internal error: Use of lvmpolld requires uuid being set.Asking lvmpolld for progress status of an operation on %s/%s.Failed to create progress_info request.No polling operation in progress regarding LV %s.Command executed by lvmpolld got terminated by signal (%d).LVM command run by lvmpolld responded with: 'No such command.'LVM command run by lvmpolld failed due to invalid parameters.LVM command executed by lvmpolld failed.lvmpolld failed to duplicate file descriptors.lvmpolld failed to exec() lvm binary.lvmpolld responded with unexpected return code.For more information see lvmpolld messages in syslog or lvmpolld log file.Polling finished successfully.Fail to allocate PV list for VG %sFail to allocate PV path for VG %sHandle sanlock LV %s path too long.Cannot get size of sanlock LV %s.Refresh sanlock lv %llu dm %lluExtend sanlock LV from %llus (%llu bytes) to %us (%u bytes)Extend sanlock LV %s to size %s failed.Failed to refresh sanlock LV %s after extend.Extend sanlock LV zeroing %u bytes from offset %llu to %lluZeroing %u MiB on extended internal lvmlock LV...Extend sanlock LV %s cannot find device.Extend sanlock LV %s cannot open device.Extend sanlock LV %s cannot zero device at %lu.Invalid host_id %d, use 1-250 (sanlock_align_size is 1MiB).Invalid host_id %d, use 1-500 (sanlock_align_size is 2MiB).Invalid host_id %d, use 1-1000 (sanlock_align_size is 4MiB).Invalid host_id %d, use 1-2000 (sanlock_align_size is 8MiB).Invalid sanlock_align_size %u, use 1,2,4,8.Invalid host_id %d, use 1-2000.VG %s init failed: lvmlockd not availableVG %s init failed: invalid parameters for sanlockVG %s init failed: sanlock cannot open device /dev/mapper/%s-%sCheck that sanlock has permission to access disks.VG %s init failed: lock manager sanlock is not runningVG %s init failed: lock manager sanlock is not supported by lvmlockdVG %s init failed: no disk space for leasesVG %s init failed: a lockspace with the same name existsVG %s init failed: lock_args not returnedVG %s init failed: vg_write vg_commitFailed to deactivate sanlock lv %s/%sVG %s init failed: lock_args alloc failedUsing sector size %u for sanlock LVLV %s/%s must be inactive on all hosts.Force unprotected removal of shared VG? [y/n]: Cannot change VG %s with active LVsCannot free VG sanlock, lvmlockd is not in use.Cannot free VG sanlock, lvmlockd is not connected.Global lock failed: global lock was lost by removing a previous VG._free_vg_sanlock %s no lock_argsLockspace for "%s" not stopped on other hostsLockspace for "%s" is not started._free_vg_sanlock lvmlockd result %dVG %s held the sanlock global lock, enable global lock in another VG.VG %s start failed: lvmlockd is not enabledVG %s start failed: lvmlockd is not runninglockd start VG %s lock_type %sFailed to activate sanlock lv %s/%sVG %s start failed: lvmlockd not availableVG %s start error: already startedVG %s start error: already startingVG %s start failed: invalid parameters for %sVG %s start failed: invalid sanlock host_id, set in lvmlocal.confVG %s start failed: lock manager %s is not runningVG %s start failed: lock manager %s is not supported by lvmlockddm_build_dm_name failed-cmeta%s/%s%slv_dmpath snprintf failedRunning check command on %s-Vbetterolderactivate/fs.cRemoving link %s%s/groupCouldn't create path for %s.Removing %sLinking %s -> %ssymlinkCreating directory %smkdirRemoving directory %sLVM_SYSTEM_DIRlvmpolld/lvmpolld-client.clvname = %svgname = %slvid = %scmdline = %sinterval = %sFailed to create %s request.abort = %ldhandle_missing_pvs = %ldsysdir = %sdevicesfile = %smissing_%d_%dPrelAdding new LV %s%s%s to dtreecryptostratisCRYPT-TEMPCRYPT-SUBDEVstratis-Syncing device names origin-onlyCreating %s%s tree for %s.Deleting tracked UUID %s. abortmerge_thinprogress_infoin_progressreasonsignalnot_foundpath_num = %ldFailed to create pvs request.path[%d] = %%sFail to any PVs for VG %sVG %s find PV device %sNo internal lvmlock LV found.Cannot open sanlock LV %s.Failed to refresh %s.lockd find_free_lock %svg_name = %spid = %ldfind_free_locklv_size_bytes = %ldUnsupported sector size %u.Failed to create internal lv.init_vgopts = %salign_mb = %ldvg_lock_args = %svg_lock_type = %sVG %s init failed: %dvg_lock_argsUnknown lock_type.Failed to unlock LV %s/%s.VG not removed.free_vgadoptadopt_onlynodelay,start_vghost_id = %ldversion = %ldvg_uuid = %sVG %s starting %s lockspaceVG %s start failed: %dhTtL$PRELOADACTIVATEDEACTIVATESUSPENDSUSPEND_WITH_LOCKFSCLEANvdo_poolvdo_offsetvdo_pool = "%s"vdo_offset = %u Virtual size %s Header size %sCompression %s %sDeduplicationMetadata hints Minimum IO size %s Block map cache sz %s Block map era length %uSparse index Index memory size %s Slab size %s # Ack threads %u # Bio threads %u Bio rotation %u # CPU threads %u # Hash zone threads %u # Logical threads %u # Physical threads %u Max discard %u Write policy %sUnknown logical volume %s.block_map_era_lengthheader_size = %uvirtual_extents = %uuse_compression = 1use_deduplication = 1use_metadata_hints = 1minimum_io_size = %ublock_map_cache_size_mb = %ublock_map_era_length = %uuse_sparse_index = 1index_memory_size_mb = %umax_discard = %uslab_size_mb = %uack_threads = %ubio_threads = %ubio_rotation = %ucpu_threads = %uhash_zone_threads = %ulogical_threads = %uphysical_threads = %uwrite_policy = %sV%u %*s %lu %*u %uMissing VDO's data uuid %s.dumpconfig.ccurrentdiffIncorrect version format.Failed to load profile %s.LVM configuration valid.LVM configuration invalid.profilableprofilable-commandprofilable-metadataDumping configuration to %sFailure while writing to %spersistent,lvextendlvresizelvchangelockd_lv %s %s/%s %s %sLocking failed for LV %s/%sRefresh lvmlocklockd_lv disabled %s %s/%slockd init_lv %s %sinit_lvprev_lv_args = %slv_uuid = %slv_name = %slv_lock_argslv_lock_args not returnedfree_lvlv_lock_args = %slockd global disabled %slockd global %slock_glRetrying %s global locklockd global %s already held.Global lock failed: error %dGlobal lock failed: error %d.Skip LV unlock: no lockspacelockd_lv_thin thin_volumelockd_lv_thin thin_poollockd_lv_thin thin_datalockd_lv_thin thin_metadatalvcreatelockd_lv_thin for %sNo vdo pool for %s/%sno_modelockd_lv %s %sshupdatenorefreshskipglskipvgskiplvautonowaitadoptlsadoptgladoptvgadoptlvnodelay_longcommand.cStringSelect--uuidstr prev ... -%c| (, %c%c [ --type %s|%s ] (implied) [ -l|--extents [ [ COMMON_OPTIONS ]lvchange.cMonitoring LV %sUnmonitoring LV %sPolling LV %sdevtypesdumpconfigformatsfullreportDisplay full reporthelpDisplay help for commandslastlogChange logical volume layoutCreate a logical volumelvdisplayAdd space to a logical volumelvmchangelvmconfigManage the devices filelvmdiskscanlvmsadcCollect activity datalvmsarCreate activity reportlvpolllvreducelvrenameRename a logical volumeResize a logical volumelvscanpvchangepvckpvdatapvdisplaypvremovepvresizeResize physical volume(s)pvspvscanList all physical volumessegtypesList available segment typessystemidvgcfgbackupvgcfgrestorevgchangevgckvgconvertCreate a volume groupvgdisplayvgexportvgextendvgimportvgimportcloneImport a VG from cloned PVsvgimportdevicesvgmergeMerge volume groupsvgmknodesvgreduceRemove volume group(s)vgrenameRename a volume groupvgsvgscanSearch for all volume groupsvgsplitERRy|n[+|-]Number[+]Numberpartial|degraded|completey|n|ayauto|1|2passdown|nopassdown|ignorecore|disk[+|-]Size[k|UNIT][+|-]Size[m|UNIT][+]Size[m|UNIT][-]Size[m|UNIT][+|-]Number[PERCENT][+]Number[PERCENT][-]Number[PERCENT]rw|rsanlock|dlm|noneauto|none|Numberall|unmanaged|NumberPV[:t|n|y]check|repairbasic|json|json_stdlog|vg|lv|pv|pvseg|segnone|abbrev|full|0|1|2Couldn't read '%s' for VDO segment.Unknown VDO pool logical volume %s.Internal error: Passed segment is not VDO type.Internal error: Passed segment is not VDO pool.Checking VDO pool table line for LV %s.Failed to parse VDO parameters %s for LV %s.WARNING: Unknown VDO table line version %u.WARNING: Target %s version %u.%u.%u is too old.Target %s %s support disabled by %s.String list allocation failed for VDO module.Only one of --type and --validate permitted.Only one of --type and --list permitted.Only one of --atversion and --sinceversion permitted.--atversion requires --type or --list--sinceversion requires --type newOnly one of --ignoreunsupported and --showunsupported permitted.--atversion has no effect with --type %s--ignoreadvanced and --ignoreunsupported has no effect with --type current--mergedconfig has no effect without --type current or --type fullFailed to merge configuration.--withcomments has no effect with --type list--withlocalpreamble has no effect with --type list--withgeneralpreamble has no effect with --type list--valuesonly has no effect with --type listIncorrect type of configuration specified. Expected one of: current, default, diff, full, list, missing, new, profilable, profilable-command, profilable-metadata.Failed to create default config tree.Failed to create temporary config tree while creating full tree.Failed to clone current config tree.Failed to merge default and current config tree.# This is an example configuration file for the LVM2 system. # It contains the default settings that would be used if there was no # @DEFAULT_SYS_DIR@/lvm.conf file. # # Refer to 'man lvm.conf' for further information including the file layout. # # Refer to 'man lvm.conf' for information about how settings configured in # this file are combined with built-in values and command line options to # arrive at the final values used by LVM. # # Refer to 'man lvmconfig' for information about displaying the built-in # and configured values used by LVM. # # If a default value is set in this file (not commented out), then a # new version of LVM using this file will continue using that value, # even if the new version of LVM changes the built-in default value. # # To put this file in a different directory and override @DEFAULT_SYS_DIR@ set # the environment variable LVM_SYSTEM_DIR before running the tools. # # N.B. Take care that each setting only appears once if uncommenting # example settings in this file. # This is a local configuration file template for the LVM2 system # which should be installed as @DEFAULT_SYS_DIR@/lvmlocal.conf . # # Refer to 'man lvm.conf' for information about the file layout. # # To put this file in a different directory and override # @DEFAULT_SYS_DIR@ set the environment variable LVM_SYSTEM_DIR before # running the tools. # # The lvmlocal.conf file is normally expected to contain only the # "local" section which contains settings that should not be shared or # repeated among different hosts. (But if other sections are present, # they *will* get processed. Settings in this file override equivalent # ones in lvm.conf and are in turn overridden by ones in any enabled # lvm_.conf files.) # # Please take care that each setting only appears once if uncommenting # example settings in this file and never copy this file between hosts. Configuration node %s not foundLV locks are not allowed with readonly option.WARNING: shared LV may require refresh on other hosts where it is active.WARNING: skipping LV lock in lvmlockd.LV %s/%s lock failed: lvmlockd is required for VG lock_type %s.LV %s/%s lock failed: lvmlockd connection is required.Shared activation not compatible with LV type %s of %s/%sFail to find any PVs for %s/%s, try to find PVs from VG insteadFail to allocate PV list for %s/%sFail to allocate PV path for LV %s/%sFind PV device %s for LV %s/%sLV locked by other host: %s/%sLV %s/%s lock failed: orphan lock needs to be adopted.LV %s/%s lock failed: adopt found no orphan.LV %s/%s lock failed: adopt found other mode.WARNING: extending LV with a shared lock, other hosts may require LV refresh.LV is already locked with incompatible mode: %s/%sLV %s/%s lock failed: lockspace is inactiveLV %s/%s lock failed: storage %s for sanlock leasesLV %s/%s lock failed: error %dLock already exists for LV %s/%sNo sanlock space for lock for LV %s/%s_init_lv_sanlock lvmlockd result %dlv_lock_args allocation failedLV %s/%s free lock in shared VG: lvmlockd is required.LV %s/%s free lock in shared VG: lvmlockd is not connected.lockd free LV %s/%s %s lock_args %sLV %s/%s free lock in shared VG: lockspace not startedLV %s/%s free lock in shared VG: lvmlockd error %d.lockd free LV disabled %s/%s %s lock_args %slockd_free_lv: unknown lock_type.VG %s init failed: invalid parameters for dlmVG %s init failed: lock manager %s is not runningVG %s init failed: lock manager %s is not supported by lvmlockdExclusive locks are not allowed with readonly option.WARNING: skipping global lock in lvmlockd.Reading without shared global lock.Global lock failed: check that lvmlockd is running.Start a lock manager, lvmlockd did not find one running.Global lock failed: lockspace is startingGlobal lock failed: check that global lockspace is startedGlobal lock failed: storage errors for sanlock leasesGlobal lock failed: lock manager errorGlobal lock failed: storage failed for sanlock leasesGlobal lock failed: orphan lock needs to be adoptedGlobal lock failed: adopt found no orphanGlobal lock failed: adopt found other modeSkipping global lock: lockspace is startingSkipping global lock: storage %s for sanlock leasesSkipping global lock: VG with global lock was removedSkipping global lock: orphan lock needs to be adoptedSkipping global lock: adopt found no orphanSkipping global lock: adopt found other modeSkipping global lock: lock manager errorSkipping global lock: lockspace not found or startedDuplicate sanlock global locks should be correctedGlobal lock failed: held by other host.Lock on incorrect thin lv type %s/%sCannot find thin pool for %s/%slockd_lv_thin creating_thin_poollockd_lv_thin creating_thin_volumelockd_lv_thin creating_thin_pool skip without LDLV_CREATING_THIN_POOLlockd_lv_thin creating_thin_volume skip without LDLV_CREATING_THIN_VOLUMElockd_lv_thin invalid use of LDLV_CREATING_THIN_POOLlockd_lv_thin invalid use of LDLV_CREATING_THIN_VOLUMElockd_lv_thin creating cow snapshot of thin volumelockd_lv_thin for lvcreate_new_plus_old_cachepool_or_lvconvert_old_plus_new_cachepoollockd_lv_thin from lvcreate undefined case.lockd_lv_thin skip unlock for active pool %slockd_lv_thin skip repeated unlock for inactive pool %slockd_lv_thin skip repeated lock for active pool %sLock on incorrect vdo lv type %s/%sSkip LV lock: no lock args for %sIgnoring unknown lockopt value: %sParsing command defs: unknown opt str: "%s"%s%s.Parsing command defs: unknown lv type %s.Parsing command defs: unknown opt arg: %s.Parsing command defs: unknown pos arg: %s.Too many args, increase CMD_RO_ARGS.Too many args, increase CMD_OO_ARGS.Too many args, increase CMD_IO_ARGS.Parsing command defs: option %s must be followed by an arg.Parsing command defs: options must be specified in long form: %s.Parsing command defs: can't parse argc %d argv %s%s%s.Parsing command defs: no OO line found for %s.Updating %s%slogical volume %s on disk(s).Failed to update %smetadata of %s on disk.Logical volume %s is not active.Failed to change monitoring for %s volume.Display and manipulate configuration informationDisplay recognised built-in block device typesList available metadata formatsDisplay last command's log reportChange the attributes of logical volume(s)Display information about a logical volumeWith the device mapper, this is obsolete and does nothing.List devices that may be used as physical volumesContinue already initiated poll operation on a logical volumeReduce the size of a logical volumeRemove logical volume(s) from the systemDisplay information about logical volumesList all logical volumes in all volume groupsChange attributes of physical volume(s)Check metadata on physical volumesInitialize physical volume(s) for use by LVMDisplay the on-disk metadata for physical volume(s)Display various attributes of physical volume(s)Move extents from one physical volume to anotherRemove LVM label(s) from physical volume(s)Display information about physical volumesDisplay the system ID, if any, currently set on this hostList tags defined on this hostDisplay software and driver version informationBackup volume group configuration(s)Restore volume group configurationChange volume group attributesCheck the consistency of volume group(s)Change volume group metadata formatDisplay volume group informationUnregister volume group(s) from the systemAdd physical volumes to a volume groupRegister exported volume group with systemAdd devices for a VG to the devices file.Create the special files for volume group devices in /devRemove physical volume(s) from a volume groupDisplay information about volume groupsMove physical volumes into a new or existing volume groupwritethrough|writeback|passthrough[Number]r|R|h|H|b|B|s|S|k|K|m|M|g|G|t|T|p|P|e|Elinear|striped|snapshot|raid|mirror|thin|thin-pool|vdo|vdo-pool|cache|cache-pool|writecachecontiguous|cling|cling_by_tags|normal|anywhere|inheritpvmove|convert|merge|merge_thincurrent|default|diff|full|list|missing|new|profilable|profilable-command|profilable-metadatapv_header|metadata|label_headerheaders|metadata|metadata_all|metadata_searchr\F0\TTT\TTlT-----abort--activationmode --addtag --adddev --deldev--delnotfound--addpvid--delpvid--aligned --alloc !--atomic --atversion --auto --autoactivation--setautoactivation--binary--bootloaderareasize--cache--cachemetadataformat--cachemode--cachepool--cachevol--cachedevice --cachesize--check--commandprofile--compression--config--configreport+--typeconfig,--dataalignment--dataalignmentoffset --deduplication!--deltag" --detachprofile#--deviceidtype$--devices% --devicesfile&--discards'--driverloaded(--dump).--errorwhenfull*--force+ --foreign,--fs---fsmode.--handlemissingpvs/--headings0/--ignoreadvanced1--ignorelocal2--ignorelockingfailure3--ignoremonitoring4--ignoreskippedcluster5--ignoreunsupported6--importdevices7--journal8--labelsector9--listlvs:--listvg;--checkcomplete<--lockopt=--lockstart>--lockstop?--locktype@"--logonlyA--longhelpB--majoritypvsC--maxrecoveryrateD--mergeE--mergemirrorsF--mergesnapshotG--mergethinH--mergedconfigI--metadataignoreJ--metadataprofileK--metadatasizeL--minorM--minrecoveryrateN--mirrorlogO--mirrorsonlyP--mknodesQ--monitorR--nameprefixesS--noheadingsT--nohintsU--nohistoryV--nolockingW--norestorefileX--nosuffixY--nosyncZ--notifydbus[--noudevsync\--originname]--setphysicalvolumesize^--settings_--poll`--polloperationa'--pooldatasizeb--pooldatavdoc--poolmetadatad--poolmetadatasizee--poolmetadatasparef--profileg--pvmetadatacopiesh%--raidintegrityi--raidintegrityblocksizej--raidintegritymodek--readonlyl--refreshm--removemissingn--rebuildo --repairp--repairtypeq---replacer --reportformats*--restorefilet--restoremissingu--resyncv--rootvgw--rowsx--segmentsy--separatorz--shared{--sinceversion|--splitcache}--splitmirrors~--splitsnapshot--showdeprecated--showunsupported--startpoll--stripes--swapmetadata--syncaction)--sysinit--systemid--thinpool--trackchanges--trustcache--type --udevoutput--unbuffered--uncache--update--cachepolicy--cachesettings--unconfigured--units--unquoted--usepolicies--validate--valuesonly--vdo--vdopool--vdosettings--version--vgmetadatacopies$--vgonline--withsummary--withcomments--withgeneralpreamble--withlocalpreamble--withspaces--withversions--writebehind--writemostly(--corelog--resizable--allocation--available --raidrebuild --raidsyncaction)--raidwritemostly(--raidminrecoveryrate--raidmaxrecoveryrate--raidwritebehind--virtualoriginsize--split--metadatacopies&--activatea --alla--autobackupA--activevolumegroupsA--allpvsA--backgroundb--basevgnamen--blockdeviceb--chunksizec--clusteredc--colonc--columnsC--contiguousC--debugd--exportede--physicalextentE--filef--forcef--fullf--helph--cacheH--historyH--?--importi--intervali--iop_versioni--stripesi--stripesizeI--logicalvolumel--maxlogicalvolumesl--extentsl--listl--lvmpartitionl--sizeL--persistentM--majorj--setactivationskipk--ignoreactivationskipK--integritysettings--mapsm--mirrorsm--metadatatypeM--namen--nofsckn--novolumegroupn--oldpathn--optionso--sortO--maxphysicalvolumesp--permissionp--partialP--physicalvolumeP--quietq--readaheadr#--resizefsr--resetR--regionsizeR--physicalextentsizes--snapshots--shorts--stdins--selectS--testt--thinT--updatemetadata--uuidu--uuidu--uuidlistU--verbosev--volumegroupV--virtualsizeV--wipesignaturesW--allocatablex--resizeablex--yesy--zeroZ---linearstripedsnapshotcachecachepoolintegritymirrorraidraid0 raid1 raid10 raid4 raid5 raid6thinthinpoolthinpooldatavdovdopoolvdopooldatawritecachezeroerrorglobal/vdo_disabled_featuresonline_renameversion4kvdoInternal error: Missing function for command definition %d:%s.Logical volume %s is already read-only. Refreshing kernel state.Logical volume "%s" is already read only.Logical volume %s is already writable. Refreshing kernel state.Logical volume %s is already writable.Setting logical volume %s read/write.Setting logical volume %s read-only.Allocation policy of logical volume %s is already %s.Setting contiguous allocation policy for %s to %s.Updating logical volume %s on disk(s).Error when full is already %sset for %s.Read ahead is already auto for %s.WARNING: Overriding readahead to %u sectors, a multiple of %uK page size.Read ahead is already %u for %s.Setting read ahead to %u for %s.Unable to change write%s on %s while it is not in-sync.%s not found in volume group, %sCan't set all images of %s LV %s to writemostly.Minimum recovery rate cannot be higher than maximum, adjusting.Changing configuration profile for LV %s: %s -> %s.Changing activation skip flag to %s for LV %s.Changing autoactivation flag to %s for LV %s.Unable to change compression for non VDO volume %s.Logical volume %s already uses --compression %c.Unable to change deduplication for non VDO volume %s.Logical volume %s already uses --deduplication %c.Internal error: Failed to check for option %sCannot change support for discards while pool volume %s is active.Logical volume %s already uses --discards %s.Logical volume %s already %szero new blocks.Cannot change existing block size %u bytes.Clear all writecache settings? WARNING: repairing a damaged cachevol is not yet possible.WARNING: cache mode writethrough is suggested for safe operation.Continue using writeback without repair?Cache %s is not clean, refusing to switch cache mode.Cannot change VDO settings for active VDO pool %s.VDO pool %s with all its LVs needs to be deactivated.A raid LV with integrity is required.No integrity found in specified raid LV.LV must be inactive to change integrity settings.Clear all integrity settings? Operation not permitted on hidden LV %s.Do you want to activate component LV in read-only mode? [y/n]: Allowing activation of component LV.Change of snapshot %s will also change its origin %s%s. Proceed? [y/n]: Logical volume %s not changed.Cannot activate LVs in a foreign VG.Cannot change LV properties when activating component LVs.WARNING: Combining activation change with other commands is not advised.Refreshing logical volume %s (if active).Can't resync open logical volume %s.Do you really want to deactivate logical volume %s to resync it? [y/n]: Logical volume %s not resynced.Unable to deactivate %s for resync.Starting resync of %s%s%s%s %s.Failed to reactivate %s to resynchronize mirror.Failed to reattach %s device after clearing.Failed to reactivate %s after resync.RAID logical volume %s cannot be active remotely.Internal error: Missing syncaction arg.Use syncaction check to detect and correct integrity checksum mismatches.Thin pool data or metadata volume must be specified. (E.g. "%s_tdata")%s must be a RAID logical volume to perform this action.Kernel driver does not support this action: %s"%s" is not a supported sync operation.%s state is currently "%s". Unable to switch to "%s".Internal error: %s is not a RAID logical volume.Internal error: Unknown RAID message: %s.Do you really want to rebuild %u PVs of logical volume %s [y/n]: Logical volume %s not rebuild.Cannot convert %s LV %s to %s.Conversion using --type %s is not supported.--mirrorlog and --corelog are incompatible.--mirrors/--type mirror/--type raid* and --splitmirrors are mutually exclusive.Please name the new logical volume using '--name'Internal error: Changing conv_type from %d to %d.--stripes or --stripesize argument is only valid with --mirrors/--type mirror/--type raid*/--type striped/--type linear, --repair and --thinpool--chunksize is only available with snapshots or pools.--zero is only available with snapshots or pools.cannot be used with --type raid0 or --type striped or --type linearInternal error: Wrong params for lvconvert _create_id.Internal error: Name "%s/%s" is too long.Poll operation ID allocation failed.Failed to copy one or more poll operation ID members.lvconvert: layer name creation failed.lvconvert: layer name generation failed.Allocation of list of failed_pvs failed.Allocation of failed_pvs list entry failed.Conversion of tracking raid1 LV %s is not supported.Failed to find RaidLV of RAID subvolume %s.Conversion of tracked raid1 subvolume %s is not supported.--corelog and --mirrorlog are only compatible with mirror devices.Mirror segment type cannot be used for thinpool%s. Try "%s" segment type instead.Mirrors are not yet supported on cache LVs %s.Cannot specify mirrors with linear type.Unable to split mirrors in VG with lock_type %sOnly up to %d images in mirror supported currently.Unable to reduce images by specified amount - only %d in %sAdjusting mirror image count of %sCopying region size %s from existing mirror.Internal error: Unknown mirror log count %d.Mirror log region size cannot be changed on an existing mirror.Logical volume %s has multiple mirror segments.Cannot both allocate and free extents when specifying physical volumes to use.Please specify the operation in two steps.Logical volume %s being converted.Unable to %s images by specified amount.Exactly one image must be split off from %s when tracking changes.--corelog and --mirrorlog are only compatible with mirror devicesSplitting raid image is not allowed with lock_type %s.Integrity must be removed before splitting.Unable to split images from non-mirrored RAID.Unable to split image from %s while not in-sync.Cannot track more than one split image at a time.Are you sure you want to split and track %s LV %s losing resilience for any newly written data? [y/n]: Losing resilience for newly written data on logical volume %s.%s split from %s for read-only purposes.WARNING: Any newly written data will be non-resilient on LV %s during the split!Use 'lvconvert --merge %s' to merge back into %s.Unable to split more than one image from %s.Unable to split logical volume of segment type, %s.%sLogical Volume "%s" already exists in %s.Unable to split %s while it is not in-sync.Are you sure you want to split %s LV %s losing all resilience? [y/n]: Losing all resilience for logical volume %s.Failed to write changes for %s.Failed to suspend %s before committing changes.Failed to commit changes for %s.Failed to resume %s after committing changes.Only up to %u mirrors in %s LV %s supported currently.Cannot add raid images with integrity for this raid level.Are you sure you want to convert %s LV %s to %s%u images %s resilience? [y/n]: Logical volume %s successfully converted.RAID module does not support RAID0.RAID module does not support RAID10.This conversion is not supported for raid with integrity.Unable to find image to satisfy request.Unable to split additional image from %s while tracking changes for %s.Conversions to --type mirror require -m/--mirrorsUnknown operation on mirror LV %s.Unknown operation on raid LV %s.Unknown operation on striped or linear LV %s.Detaching cachevol %s from LV %s.WARNING: writeback cache on %s is not complete and cannot be flushed.WARNING: cannot detach writeback cache from %s without --force.WARNING: Data may be lost by detaching writeback cache without flushing.Detach writeback cache %s from %s without flushing data?LV %s has no suffix for cachevol (skipping rename).%s is not a mergeable logical volume.Cannot merge snapshot %s into the origin %s with merging snapshot %s.Internal error: %s is missing origin.%s is read-only external origin %s.Merging into the old snapshot origin %s is not supported.Delaying merge since snapshot is open.Delaying merge since origin volume is open.Failed to reactivate origin %s.Merging of thin snapshot %s will occur on next activation of %s.Thin repair command is not configured. Repair is disabled.Cannot repair active pool %s. Use lvchange -an first.Failed to build thin metadata path.Failed to build pool metadata spare path.Cannot activate pool metadata spare volume %s.Cannot activate thin pool metadata volume %s.Repair of thin metadata volume of thin pool %s failed (status:%d). Manual repair required!WARNING: Cannot read output from %s %s.Transaction id %lu from pool "%s/%s" does not match repaired transaction id %lu from %s.Cannot deactivate thin pool metadata volume %s.Cannot deactivate pool metadata spare volume %s.Can't prepare new metadata name for %s.WARNING: LV %s holds a backup of the unrepaired metadata. Use lvremove when no longer required.WARNING: New metadata LV %s might use different PVs. Move it with pvmove if required.(inherited)disabled%s:yLogical volume %s changed.No settings changed. and %u other snapshot(s)Failed to prepare message.disk-logged core-logged clustered Failed to clear %s %s for %s.intermediateidlefrozenresyncrecoverNo --rebuild found!raid0lvconvert.cMergedConverted_mimagetmp_%dlayer name creation failed.Failed to insert resync layerNo usable images left in %s.Setting logging type to %s.Logical volume %s converted.raid1 with reducingenhancingLogical volume %s NOT split.Cannot convert LV %s.Conversion aborted.Volume %s replaced origin %s.-i-otransaction="%s_meta%%daHHnonedevtypes_generalformats_generalfullreport_generalhelp_generallastlog_generallvchange_activatelvchange_monitorlvchange_persistentlvchange_poll lvchange_properties lvchange_rebuild lvchange_refresh lvchange_resync lvchange_syncactionlvconvert_change_mirrorloglvconvert_change_region_sizelvconvert_combine_split_snapshotlvconvert_integritylvconvert_mergelvconvert_merge_mirror_imageslvconvert_merge_snapshotlvconvert_merge_thinlvconvert_plainlvconvert_raid_typeslvconvert_repairlvconvert_replace_pvlvconvert_split_and_keep_cachelvconvert_split_and_remove_cachelvconvert_split_cow_snapshotlvconvert_split_mirror_imageslvconvert_start_polllvconvert_swap_pool_metadata lvconvert_to_cache_with_cachepool!lvconvert_to_cache_with_cachevol"lvconvert_to_cache_with_device#lvconvert_to_cachepool$lvconvert_to_cachepool_or_swap_metadata%lvconvert_to_thin_with_data&lvconvert_to_thin_with_external'lvconvert_to_thinpool(lvconvert_to_thinpool_or_swap_metadata)lvconvert_to_vdopool*lvconvert_to_vdopool_param+lvconvert_to_writecache,lvconvert_to_writecache_with_device-lvcreate_and_attach_cachedevice_for_cache.lvcreate_and_attach_cachedevice_for_writecache/lvcreate_and_attach_cachepool0lvcreate_and_attach_cachepool_v21lvcreate_and_attach_cachepool_v32lvcreate_and_attach_cachevol_for_cache3lvcreate_and_attach_cachevol_for_writecache4lvcreate_cachepool5lvcreate_cow_snapshot6lvcreate_cow_snapshot_with_virtual_origin7lvcreate_error_vol8lvcreate_linear9lvcreate_mirror:lvcreate_mirror_or_raid1;lvcreate_new_plus_old_cachepool_or_lvconvert_old_plus_new_cachepool<lvcreate_raid_any=lvcreate_striped>lvcreate_thin_snapshot?lvcreate_thin_snapshot_of_external@lvcreate_thin_volAlvcreate_thin_vol_and_thinpoolBlvcreate_thin_vol_with_thinpool_or_sparse_snapshotClvcreate_thinpoolDlvcreate_vdo_volElvcreate_zero_volFlvdisplay_colonGlvdisplay_columnsHlvdisplay_generalIlvextend_policyJlvextend_pool_metadataKlvextend_pvLlvextend_sizeMlvmchange_generalNlvmconfig_generalOlvmdevices_checkPlvmdevices_editQlvmdevices_listRlvmdevices_updateSlvmdiskscan_generalTlvmsadc_generalUlvmsar_generalVlvpoll_generalWlvreduce_sizeXlvremove_generalYlvrename_lv_lvZlvrename_vg_lv_lv[lvresize_pool_metadata\lvresize_pv]lvresize_size^lvs_general_lvscan_general`pvchange_properties_allapvchange_properties_somebpvck_dumpcpvck_generaldpvck_repairepvck_repair_typefpvcreate_generalgpvdata_generalhpvdisplay_colonipvdisplay_columnsjpvdisplay_generalkpvmove_anylpvmove_onempvremove_generalnpvresize_generalopvs_generalppvscan_cacheqpvscan_displayrsegtypes_generalssystemid_generalttags_generaluversion_generalvvgcfgbackup_generalwvgcfgrestore_by_filexvgcfgrestore_by_vgyvgcfgrestore_list_by_filezvgcfgrestore_list_by_vg{vgchange_activate|vgchange_lockstart}vgchange_lockstop~vgchange_locktypevgchange_monitorvgchange_pollvgchange_propertiesvgchange_refreshvgchange_systemidvgck_generalvgck_update_metadatavgconvert_generalvgcreate_generalvgdisplay_colonvgdisplay_columnsvgdisplay_generalvgexport_allvgexport_somevgextend_generalvgimport_allvgimport_somevgimportclone_generalvgimportdevices_allvgimportdevices_rootvgimportdevices_somevgmerge_generalvgmknodes_generalvgreduce_allvgreduce_by_pvvgreduce_missingvgremove_generalvgrename_by_namevgrename_by_uuidvgs_generalvgscan_generalvgsplit_by_lvvgsplit_by_pvcount !*"NDgK#'Manual repair required. and withWITHOUT and metadata volumesMetadata LV %s not found.Unknown pool metadata LV %s.Can't convert locked LV %s.pool_metadata%d_tpool%dConverted %s to %s %s.Logical volume %s not split.WARNING: %s not zeroed.LVM_VG_NAMEvg/lv string alloc failed.Cache pool %s not found.Thin pool %s not found.replaceMerging of volume %s started.Cannot find cache %s.Invalid writecache settings.Failed to update VG.Device %s not found.PV %s not found in VG.%s_cache%s_cache%%dFailed to create cachevol LVLV %s is already in use.%s_cvolUse cache metadata format 2.Only inactive cache can be repaired.Cache repair command is not configured. Repair is disabled.Failed to build cache metadata path.Cannot activate cache pool metadata volume %s.Repair of cache metadata volume of cache %s failed (status:%d). Manual repair required!Cannot deactivate pool metadata volume %s.WARNING: If everything works, remove %s volume.WARNING: Use pvmove command to move %s on the best fitting PV.Can't use same LV %s for thin pool and thin volume.Can't use lock_type %s LV as external origin.Failed to activate %s. Conversion cannot proceed.Aborting. Failed to deactivate new thin LV. Manual intervention required.Aborting. Failed to swap identifiers. Manual intervention required.Aborting. Failed to attach external origin. Manual intervention required.Converted %s to thin volume with external origin %s.Failed to deactivate thin LV %s.Failed to deactivate thin LV. Manual intervention required.Internal error: LV %s is already a pool.Cannot convert logical volume %s.Can't use same LV for pool data and metadata LV %s.Use a different LV for pool metadata %s.Mirror logical volumes cannot be used for pool metadata.Try "%s" segment type instead.Pool metadata LV %s is of an unsupported type.Pool metadata LV %s is too small (%u extents) for required metadata (%u extents).WARNING: Volume of "%s" segtype cannot store ANY real data!THIS WILL DESTROY CONTENT OF LOGICAL VOLUME (filesystem etc.)WARNING: Using mismatched cache pool metadata MAY DESTROY YOUR DATA!Do you really want to convert %s? [y/n]: Aborting. Failed to deactivate %s.Aborting. Failed to activate metadata lv.Aborting. Failed to wipe metadata lv.Failed to set up spare metadata LV for pool.Volume %s is already VDO volume, skipping VDO conversion.Aborting. Failed to deactivate metadata lv. Manual intervention required.Failed to create internal lv names, %s name is too long.Cannot allocate lock for new pool LV.Failed to lock new pool LV %s.Failed to activate pool logical volume %s.Manual intervention may be required to handle reported errors.Failed to unlock pool data LV %s/%sFailed to free lock for pool data LV %s/%sFailed to unlock pool metadata LV %s/%sFailed to free lock for pool metadata LV %s/%sWARNING: Converting %s to fully provisioned thin volume.Pool metadata extents %u chunk_size %uWARNING: Converting %s to %s pool's data%s %s metadata wiping.Internal error: Invalid lvconvert pool commandLV %s could not be converted to a thin volume.Failed to get '--replace' argumentInternal error: Unknown pool conversion.Failed to initialize processing handle.Internal error: Volume %s is not a COW.Unable to split off snapshot %s with virtual origin.Unable to split snapshots in VG with lock_type %s.Do you really want to split off active logical volume %s? [y/n]: Splitting snapshot %s from its origin.Logical Volume %s split from its origin.Unable to combine split snapshots in VG with lock_type %sUnable to use %s as both snapshot and origin.Chunk size must be a power of 2 in the range 4K to 512K.Couldn't find origin volume %s in Volume group %s.Cannot use logical volume %s with active component LVs for snapshot origin.WARNING: Converting logical volume %s to snapshot exception store.Couldn't deactivate logical volume %s.Aborting. Failed to wipe snapshot exception store.Logical volume %s converted to snapshot.LV %s with type %s cannot be converted to a cache pool.LV %s is already used as a cachevol.Use a different LV for cache pool LV and cache LV %s.LV %s could not be converted to a cache pool.Cache pool %s is already in use.Do you want wipe existing metadata of cache pool %s? [y/n]: To preserve cache metadata add option "--zero n".WARNING: Reusing mismatched cache pool metadata MAY DESTROY YOUR DATA!WARNING: Reusing cache pool metadata %s for volume caching.Redirecting operation to data sub LV %s.LV %s with type %s cannot be converted to a thin pool.Use a different LV for thin pool LV and thin LV %s.LV %s could not be converted to a thin pool.Internal error: LV %s cannot be found.Cannot convert cache volume %s with %s cache mode to external origin.To proceed, run 'lvchange --cachemode writethrough %s'.Cache %s is not clean, refusing to convert to external origin.LV %s with type %s cannot be used as a metadata LV.Cannot convert pool %s with active volumes.Failed to create internal lv names, pool name is too long.New pool metadata LV %s cannot be locked.Do you want to swap metadata of %s pool with metadata volume %s? [y/n]: Chunk size can be only changed with --force. Conversion aborted.WARNING: Changing chunk size %s to %s for %s pool volume.Do you really want to change chunk size for %s pool volume? [y/n]: Internal error: Invalid lvconvert pool command.LV %s with type %s cannot be used as a %s pool LV.Cannot convert logical volume %s under snapshot.The --poolmetadata option is required to swap metadata.Internal error: Cannot detach writecache.Detaching writecache interrupted - locking VG failed.detach writecache check clean reading vg %sDetaching writecache interrupted - reading VG failed.Detaching writecache interrupted - reading VG error %x.Detaching writecache interrupted - LV not found.Detaching writecache interrupted - LV not active.Detaching writecache cleaning %llu blocksThis command can be cancelled and rerun to complete writecache detach.Detaching writecache completed cleaning.Detaching writecache cachevol failed.Removing the writecache cachevol failed.Logical volume %s write cache has been detached.Convert poll ID list allocation failed.Logical volume %s must be active to perform this operation.Can't clear %u failed superblock(s) in %s volume %s.The maximum number of degraded devices allowed is %u.Attempt to clear %u transiently failed %s superblock(s) in %s? [y/n]: Logical volume %s with %u transiently failed %s superblock(s) NOT repaired.Clearing %u transiently failed %s superblock(s) in %s.Attempt to replace failed RAID images (requires full device resync)? [y/n]: Failed to replace faulty devices in %s.Faulty devices in %s successfully replaced.Use 'lvconvert --repair %s' to replace failed device.Volume %s is consistent. Nothing to repair.Mirror status: %d of %d images failed.Mirror log status: %d of %d images failed.Attempt to replace failed mirror log? [y/n]: Attempt to replace failed mirror images (requires full device resync)? [y/n]: WARNING: Trying to up-convert to %d images, %d logs.WARNING: Failed to replace %d of %d images in volume %s.WARNING: Failed to replace %d of %d logs in volume %s.Conversion starts after activation.WARNING: %d missing and now unallocated Physical Volumes removed from VG.Unsupported volume type for repair of volume %s.Internal error: Cannot get origin from %s COW.Cannot merge snapshot %s into the read-only external origin %s.Cannot merge snapshot %s into the read-only origin %s. (Use lvchange -p rw).Unable to merge invalidated snapshot LV %s.Can't initialize snapshot merge. Missing support in kernel?Delaying merge since origin is open.Merging of snapshot %s will occur on next activation of %s.Cannot find LV with cache from %s.WARNING: writecache on %s is not complete and cannot be flushed.WARNING: cannot detach writecache from %s without --force.WARNING: Data may be lost by detaching writecache without flushing.Detach writecache %s from %s without flushing data?Detaching writecache skipping cleaner...Detaching writecache without cleaner...Failed to activate LV to clean writecache.Detaching writecache already clean.Detaching writecache setting cleaner.Failed to set writecache cleaner for %s.Failed to set cleaner cachesettings to flush cache.See lvchange --cachesettings cleaner=1Detaching writecache finished cleaning.Failed to monitor writecache cleaner progress.Logical volume %s writecache has been detached.Logical volume %s is not cached and %s is removed.Logical volume %s is not cached and %s is unused.Internal error: Unknown cache split command.WARNING: Cache origin logical volume %s is missing.WARNING: Cache pool data logical volume %s is missing.WARNING: Cache pool metadata logical volume %s is missing.Cannot uncache writeback cache volume %s without --force.WARNING: Uncaching of partially missing %s cache volume %s might destroy your data.Do you really want to uncache %s with missing LVs? [y/n]: Logical volume %s is not cached.Detaching cachepool %s from LV %s.Cannot split cache pool while PVs are missing, see --uncache to delete cache pool.No cachedevice specified to create a cachevol.With tag as cachedevice, --cachesize is required.PV %s is in use, --cachesize is required.Use all %s from %s for cache? [y/n]: Use --cachesize SizeMB to use a part of the cachedevice.Cannot allocate from more than %u cache devices.cachedevice not found in VG %s.Failed to create cachevol LV name.Failed to generate cachevol LV format.Failed to generate cachevol LV name.Creating cachevol LV %s with size %s.Erase all existing data on %s? [y/n]: Can't prepare new cachevol name for %s.Internal error: Extend size can't be 0.The minimum cache size is two extents (%s bytes).Rounding down metadata size to max size %sRounding up metadata size to min size %sRounding up metadata size to full physical extent %sCache data blocks %llu and chunk size %u exceed max chunks %llu.Use smaller cache, larger --chunksize or increase max chunks setting.Internal error: Missing cache policy name.Setting LV %s cache on %s meta start 0 len %llu data start %llu len %llu sectorsSetting LV %s cache format %u policy %s chunk_size %u sectorsWARNING: thin pool data will not be automatically extended when cached.WARNING: manual splitcache is required before extending thin pool data.Failed to unlock fast LV %s/%sThere's no 'lvmsadc' command in LVM2.Please use the superior 'dmstats' facilities instead.There's no 'lvmsar' command in LVM2.There's no 'pvdata' command in LVM2.Use lvs, pvs, vgs instead; or use vgcfgbackup and read the text file backup.There's no 'lvmchange' command in LVM2.Use 'dmsetup' commands to reset the kernel device-mapper driver.The vgconvert command has been removed along with the lvm1 format.Use a previous version of lvm to convert the lvm1 format to lvm2.%s and %s are synonyms. Please only supply one.Operation not permitted on LV %s type %s.Conversion of LV %s to vdo pool is not supported.Writecache requires consistent logical block size for LV devices.Writecache block size %u not allowed with device logical block size 4096.Using writecache block size %u for thin pool data, logical block size %u, physical block size %u.Path name too long to get LV block size %sTest mode skips checking fs block size.Using writecache block size %u for unknown file system block size, logical block size %u, physical block size %u.WARNING: unable to detect a file system block size on %sWARNING: using a writecache block size larger than the file system block size may corrupt the file system.Use writecache block size %u? [y/n]: Writecache block size %u cannot be larger than file system block size %u.Unknown memory usage for unknown writecache block_size_sectors %uWARNING: writecache size %s will use %llu GiB of system memory (%llu GiB).Continue adding writecache? [y/n]: LV %s must be linear to use as a writecache.LV %s must be inactive to attach.Failed to activate LV to check block size %sFailed to deactivate LV after checking block size %sCannot initialize readonly LV %sFailed to activate LV %s for zeroing.Failed to deactivate LV %s for zeroing.Logical volume %s now has writecache.Failed to find mirrored LV for %s.Not collapsing %s: out-of-sync.Failed to release mirror imagesFailed to remove temporary sync layer.%s: Failed query for merging percentage. Aborting merge.%s: Merging snapshot invalidated. Aborting merge.%s: Merge failed. Retry merge or inspect manually.Mirror log type "%s" is unknown.%s%s/%s:%s:%lu:%d:-1:%d:%lu:%d:-1:%d:%d:%d:%dSize may not be relative/signed.Region size may not be negative.Region size is too big (max %u).Region size must be a multiple of machine memory page size (%d bytes).Region size must be a power of 2.Extents may not be relative/signed../configure --build=x86_64-redhat-linux-gnu --host=x86_64-redhat-linux-gnu --program-prefix= --disable-dependency-tracking --prefix=/usr --exec-prefix=/usr --bindir=/usr/bin --sbindir=/usr/sbin --sysconfdir=/etc --datadir=/usr/share --includedir=/usr/include --libdir=/usr/lib64 --libexecdir=/usr/libexec --localstatedir=/var --sharedstatedir=/var/lib --mandir=/usr/share/man --infodir=/usr/share/info --with-default-dm-run-dir=/run --with-default-run-dir=/run/lvm --with-default-pid-dir=/run --with-default-locking-dir=/run/lock/lvm --with-usrlibdir=/usr/lib64 --enable-fsadm --enable-write_install --with-user= --with-group= --with-device-uid=0 --with-device-gid=6 --with-device-mode=0660 --enable-pkgconfig --enable-cmdlib --enable-dmeventd --enable-blkid_wiping --with-udevdir=/usr/lib/udev/rules.d --enable-udev_sync --with-thin=internal --with-cache=internal --enable-lvmpolld --enable-lvmlockd-dlm --enable-lvmlockd-dlmcontrol --enable-lvmlockd-sanlock --enable-dbus-service --enable-notify-dbus --enable-dmfilemapd --with-writecache=internal --with-vdo=internal --with-vdo-format=/usr/bin/vdoformat --with-integrity=internal --with-default-use-devices-file=1 --disable-silent-rules --enable-app-machineid --enable-editline --disable-readlineFailed to swap %s with merging %s.Logical volume %s is no longer merging origin, polling has finished.Merge of snapshot into logical volume %s has finished.Could not remove snapshot %s merged into %s.Inconsistent volume group names given: "%s" and "%s"WARNING: Converting logical volume %s to VDO pool volume %s formatting.WARNING: Using invalid VDO pool data MAY DESTROY YOUR DATA!Converted %s to VDO pool volume and created virtual %s VDO volume.Cannot add integrity while LV is missing PVs.Cannot add integrity to non raid type LV %s.Logical volume %s has added integrity.LV %s does not have integrity.Cannot remove integrity from non raid type LV %s.Logical volume %s has removed integrity.Internal error: Buffer is too small for dm_snprintf().Cannot zero %slogical volume with option -Zy or -Wy.Ignoring option -Zy or -Wy for unzeroable %s volume.Option --minor may not be repeated.Snapshot origin LV %s not found in Volume group %s.Thin pool volume %s not found in Volume group %s.Logical volume %s is not a thin pool volume.Please specify either size or extents with snapshots.Logical volume %s is not a thin volume. Thin snapshot supports only thin origins.Switching from snapshot to thin segment type.Change of volume permission is unsupported with cache conversion, use lvchange.is unsupported with cache conversionSkipping activation of cache origin %s.Cannot activate cache origin %s.Cannot deactivate activate cache origin %s.Unable to create RAID LV: requires minimum VG extent size %sUnable to create RAID(1)0 LV: insufficient number of devices.Segment type 'raid0' requires 2 or more stripes.Number of stripes must be at least %d for %sPlease either create snapshot or thin volume.Please specify device size(s).is only available when creating thin poolOnly specify Physical volumes when allocating thin pool.Please either create VDO or snapshot.Maximal supported VDO virtual size is %s.Please express size as %%FREE%s, %%PVS or %%VG.Internal error: Couldn't find origin volume.Can't use %s size. Maximal supported VDO POOL volume size with slab size %s is %s.Using maximal supported VDO POOL volume size %s (with slab size %s).Calculated size of logical volume is 0 extents. Needs to be larger.Converted %u%% of %s (%u) extents into %u (with mimages %u and stripes %u for segtype %s).Internal error: Missing snapshot chunk size.Reducing COW size %s down to maximum usable size %s.Rounding size (%d extents) down to stripe boundary size (%d extents)Not enough space for thin pool creation.Adjusted size of logical volume is 0 extents. Needs to be larger.Internal error: --thinpool not identified.Internal error: Inconsistent snapshot and origin parameters identified.Internal error: Failed to identify what type of thin target to use.Making pool %s in VG %s using segtype %sMaking thin LV %s in pool %s in VG %s%s%s using segtype %s.Use lvconvert to create thin pools and cache pools in a shared VG.lockd_lvcreate_prepare find_free_lock skipped for thin volumelockd_lvcreate_prepare find_free_lock skipped for cow snap of thin volumeNo space for sanlock lock, extend the internal lvmlock LV.Removal of created spare volume failed. Manual intervention required.lockd_lvcreate_done missing name %slockd_lvcreate_done cannot find thin pool %slockd_lvcreate_done hold lock for active thin poolAmbiguous syntax, please create --type cache-pool %s separately.Failed to find LV %s to add writecache.Removing new LV after failing to add writecache.Failed to deactivate new LV %s.Failed to find LV %s to add cache.Removing new LV after failing to add cache.Selected cache metadata format %d is not supported.Command definition index %d enum %d id %sInternal error: Command %s not found. Special options for command: [ --extents Number[PERCENT] ] The --extents option can be used in place of --size. The number allows an optional percent suffix. [ --name String ] The --name option is not required but is typically used. When a name is not specified, a new LV name is generated with the "lvol" prefix and a unique numeric suffix. Common variables for lvm: Variables in option or position args are capitalized, e.g. PV, VG, LV, Size, Number, String, Tag. PV Physical Volume name, a device path under /dev. For commands managing physical extents, a PV positional arg generally accepts a suffix indicating a range (or multiple ranges) of PEs. When the first PE is omitted, it defaults to the start of the device, and when the last PE is omitted it defaults to the end. PV[:PE-PE] ... is start and end range (inclusive), PV[:PE+PE] ... is start and length range (counting from 0). LV Logical Volume name. See lvm(8) for valid names. An LV positional arg generally includes the VG name and LV name, e.g. VG/LV. LV followed by _ indicates that an LV of the given type is required. (raid represents raid type). The _new suffix indicates that the LV name is new. Tag Tag name. See lvm(8) for information about tag names and using tags in place of a VG, LV or PV. Select Select indicates that a required positional arg can be omitted if the --select option is used. No arg appears in this position. Size[UNIT] Size is an input number that accepts an optional unit. Input units are always treated as base two values, regardless of capitalization, e.g. 'k' and 'K' both refer to 1024. The default input unit is specified by letter, followed by |UNIT. UNIT represents other possible input units: BbBsSkKmMgGtTpPeE. (This should not be confused with the output control --units, where capital letters mean multiple of 1000.) Use --longhelp to show all options and advanced commands.Use 'lvm help ' for more informationArgument%s%c%s%s cannot be used in interactive mode.Option%s%c%s%s may not be repeated.Unable to allocate memory for command line arguments.--partial and --activationmode are mutually exclusive argumentsPARTIAL MODE. Incomplete logical volumes will be processed.Invalid activation mode given.WARNING: Ignoring unknown search_for_devnames setting, using %s.A --devices list cannot be used with --devicesfile.Failed to read --devices args.Failed to copy devices file name.lvdisplay.cstub.hlvmcmdline.csystem ID: %sMemTotal:%*s%llu%*sInvalid cachevol LV.LV %s could not be zeroed._wcoriglvconvert_poll.c%s: %s: %s%%LV %s is not merged.lnyljsonpvsegpv_headerlabel_headerheadersmetadata_allmetadata_searchmetadata_areabackup_to_rawlvcreate.cVirtualLogical--- Segments ---%s extents %u to %u: Type %s Monitoring %sSize may not be negative.Size may not be positive.Region size may not be zero.Extents may not be negative.Extents may not be positive.LVM version: %s1.02.206-RHEL9 (2025-05-05)Library version: %sDriver version: %sConfiguration: %spvmove_tmetaOption %s %s.skipped from activation inactive auto activated read-only origin %s%s%s%s%s%s%s, %ORIGINwith generated name as snapshot of toollib.cFailed to unlock thin pool %sFailed to remove new LV %s.Number may not be negative. Common options for lvm: Common options for command:%s: no such command.%s - %s Available lvm commands:%-16.16s%s -Option requires argument.Invalid argument for %s: %sUnrecognised option %d (%c).Invalid devices file name.Invalid units specificationlT$ , L \ >! l l l l l l l l l l ? Filtering devices (no data) for pvid searchFiltering devices (with data) for pvid searchPVID %s not found on any devices.WARNING: PVID %s found on %s which is excluded: %sFailed to create the devices file.Checking filters with data for %sfilter result: %s in devices file is excluded by filter: %s.IDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s%s: remove multipath componentAdding multipath device %s for multipath component %s.Missing multipath device %s for multipath component %s.PRODUCT_UUID=%s (old %s): updateIDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s%s: device not foundIDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s%s: no changeIDTYPE=%s IDNAME=%s DEVNAME=%s (old %s) PVID=%s (old %s)%s: updateIDTYPE=%s IDNAME=%s DEVNAME=%s (old %s) PVID=%s%s: updateIDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s (old %s)%s: updateIDTYPE=%s IDNAME=%s (old %s) DEVNAME=%s (old %s) PVID=%s%s: updateIDTYPE=%s IDNAME=%s (old %s) DEVNAME=%s PVID=%s%s: updateIDTYPE=%s (%s) IDNAME=%s (%s) DEVNAME=%s (%s) PVID=%s%s: device not foundIDTYPE=%s (old %s) IDNAME=%s (old %s) DEVNAME=%s (old %s) PVID=%s%s: updateIDTYPE=%s (old %s) IDNAME=%s (old %s) DEVNAME=%s PVID=%s%s: updateIDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s%s: indeterminateIDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s%s: old entryIDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s%s: new entryIDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s%s: deleteUpdated devices file to version %sNo update for devices file is needed.Updates needed for devices file.Hash update needed for devices file.WARNING: adding device %s that is excluded: %s.PVID already exists in devices file for %s.WARNING: to remove a device by device id, include --deviceidtype.Device %s is used by an active LV, continue to remove? WARNING: to remove a device by name, do not include --deviceidtype.Device %s IDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s%sNo devices file entry with device id %s %s.Multiple devices file entries for PVID %s (%s %s), remove by device name.PVID not found in devices file.WARNING: only considering LVM devices%d LVM physical volume whole disk%sWARNING: Ignoring lvscan --cache because lvmetad is no longer used.Please enter one or more logical volume paths or use --select for selection.Removing devices file entry for device_id %sExisting logical volume "%s" not found in volume group "%s"Cannot rename a RAID %s directlyCannot rename %s while it is tracking a split imageRenamed "%s%s" to "%s%s" in volume group "%s"Existing historical logical volume "%s" not found in volume group "%s"Please use a single volume group name ("%s" or "%s")Old and new logical volume names requiredPlease provide a valid volume group nameLogical volume names must have the same volume group ("%s" or "%s")Old name references live LV while new name is for historical LV.New logical volume name "%s" may not exceed %zu characters.New logical volume name may not be blankNew logical volume name "%s" is invalidOld and new logical volume names must differInternal error: unknown lvresize typeOptions --fs and --resizefs cannot be used together.--resizefs is equivalent to --fs resize.The --fsmode option does not apply to resize_fsadm.Please specify either size or extents but not both.Ignoring type, stripes, stripesize and mirrors arguments when reducing.Mirrors argument may not be signed.Stripes argument may not be negative.Cannot use stripes with linear type.Stripesize may not be negative.Logical volume %s successfully resized.lvextend policy is supported only for snapshot, thin pool and vdo pool volumes.lvextend using policy requires the volume to be active.WARNING: Thin pool autoextend threshold %d%% is set below minimum supported 50%%.WARNING: VDO pool autoextend threshold %d%% is set below minimum supported 50%%.WARNING: Snapshot autoextend threshold %d%% is set below minimal supported value 50%%.lvextend policy disabled by threshold 100Can't extend %s with %s autoextend percent set to 0%%.Can't read state of locally inactive LV %s.lvextend policy calculated percentages main %u meta %u from threshold %d percent %dVG changed during file system resize, LV not resized.Refreshing LV %s on other hosts...Failed to refresh LV on all hosts.Manual lvchange --refresh required on all hosts for %s.ABORTING: Mirror percentage check failed.Failed to generate list of copied LVs: can't abort.ABORTING: Failed to generate list of copied LVsABORTING: Segment progression failed.Can't reread VG for %s error flags %x%s: No pvmove in progress - already finished or aborted.Can't find LV in %s for %s. Already finished or removed.%s: Interrupted: No longer active.ABORTING: Polling interrupted for %s.ABORTING: Can't lock VG for %s.Can't find VG %s. No longer active.ABORTING: Can't reread VG for %s error flags %x.--polloperation parameter is mandatoryArgument to --interval cannot be negativePoll ID list allocation failed.Internal error: Wrong params for _copy_poll_operation_id.Failed to copy one or more poll_operation_id members.Internal error: Handle is undefined.Device name for LV %s not found in metadata. (unfinished pvmove mirror removal?)%s: Skipping inactive LV. Try lvchange or vgchange.Failed to create poll_id_list.Resolve duplicate PV UUIDs with vgimportclone (or filters).Volume group containing %s does not support tagsVolume group containing %s has active logical volumesCan't change tag on Physical Volume %s not in volume groupCan't change PV '%s' without -ff.Allocatability not supported by orphan %s format PV %sPhysical volume "%s" is already allocatable.Physical volume "%s" is already unallocatable.Override preferred number of copies of VG %s metadata? [y/n]: Metadata areas on physical volume "%s" already ignored.Metadata areas on physical volume "%s" already marked as in-use.Physical volume "%s" has no metadata areas.Cannot disable all metadata areas in volume group %s.WARNING: Changing preferred number of copies of VG %s metadata from %u to %uSetting mda_copies to %u for VG %sFailed to generate new random UUID for %s.pv_write with new uuid failed for %s.Physical volume %s not changedFailed to store physical volume "%s" in volume group "%s"Failed to store physical volume "%s"Failed to set pvid for devices file.Failed to update devices file.Marking metadata areas on physical volume "%s" as %s.Setting physical volume "%s" NOT allocatableSetting physical volume "%s" allocatablePlease give one or more of -x, -uuid, --addtag, --deltag or --metadataignorePlease give a physical volume path or use --select for selection.Option --all and PhysicalVolumePath are exclusive.%d physical volume%s changed / %d physical volume%s not changedCommand profile '%s' requested via environment variable.Only one of --profile or --metadataprofile allowed.Only one of --profile or --commandprofile allowed.Argument to --interval cannot be negative.Checking progress %s waiting every %u seconds.devicefile name too long for lvmpolldForking background process from command: %sWARNING: Failed to set SIGCHLD action.Background process failed to setsid: %slvresize.clvmdevices.cFound PVID %s on %s.Devices file not enabled.Devices file does not exist. PART=%dPRODUCT_UUID=%s: addPRODUCT_UUID=%s: removeHOSTNAME=%s (old %s): updateHOSTNAME=%s: addHOSTNAME=%s: removeNo device found for %s.Failed to read %s.Invalid PVID.Device not removed.No devices file entry for %s.Unknown device_id type.lvmdiskscan.cdev_iter_create failedCouldn't get size of "%s"%-*s [%15s] %sLVM physical volume%d disk%s%d partition%s%d LVM physical volume%slvscan.clvremove.cFailed to read devices fileFailed to write devices filelvrename.cUnknown --fs value.Unknown --fsmode value.lvextend policy not needed.refresh_lvpath = %sLV refresh failed for LV %sACTIVE OriginalSnapshot %s%s '%s%s/%s' [%s] %spolldaemon.cCan't find LV in %s for %s.lvpoll.cProvide LV nameMovedUnknown polling operation %sMissing LV uuid within: %s/%spvchange.cChanging uuid of %s to %s.Updating physical volume "%s"Physical volume "%s" changedignoredin-useafterfork failed: %sredirectLVM_EXPECTED_EXIT_STATUS(lvm2)pvck.cZpWXZ0W0W0W0W0W0W0W0W0W0WHZ0W0W0WpWX`Z/dev/nullFailed to apply %s %s.Setting global %s "%s".Failed to add %s %s.command profilemetadata profileGiving preference to command profile specified on command line over the one specified via environment variable.LVM_COMMAND_PROFILECHECK: failed to read mda_header_%d at %lluWriting metadata at %llu length %llu crc 0x%08x mda%dWriting mda_header at %llu mda%dWrite new LVM metadata to %s? Failed to write new mda headerFailed to clone VG or LV name.Please enter a physical volume pathWARNING: skipping global lock for force.--uuid is required with --restorefile--restorefile is required with --uuidCan only set uuid on one volume at oncePhysical volume size may not be negativeUnable to read volume group from %sCan't find uuid %s in backup file %sDevice "%s" has a capacity of %sPhysical volume "%s" of volume group "%s" is exported"%s" is a new physical volume of "%s"%s:%s:%lu:-1:%lu:%lu:-1:%u:%u:%u:%u:%sPV Size %s / not usable %sPlease supply physical volume(s)%d physical volume(s) resized or updated / %d physical volume(s) not resizedOptions -e and -n are incompatibleWARNING: only considering physical volumes %sNo matching physical volumes foundTotal: %d [%s] / in use: %d [%s] / in no VG: %d [%s]Internal error: %s is not a proper mirror imageInternal error: %s is not a pvmove mirror of LV-typeInternal error: Mirror image %u not found in segment--name takes a logical volume name.Named LV and old PV must be in the same VG.Incomplete LV name supplied with --name.Logical volume name %s is invalid.pvmove not allowed on raid LV with integrity.pvmove in a shared VG requires a named LV.pvmove not allowed on internal sanlock LV.pvmove in a shared VG requires exclusive lock on named LV.Detected pvmove in progress for %s.WARNING: Ignoring remaining command line arguments.ABORTING: Failed to generate list of moving LVs.ABORTING: Temporary mirror activation failed.Creation of temporary pvmove LV failed.lvs_changed list struct allocation failed.Unable to pvmove when %s volume %s is present.Unable to pvmove device used for writecache.Unable to pvmove device used for raid with integrity.Internal error: LV name %s is too long.Can't find rimage or rmeta suffix.Can't find '_' after suffix %s.Internal error: Unexpected LV index %s.Raid sublv for name %s too long.Removing PV %s from trim list.Skipping LV %s which is not locally exclusive%s.Skipping LV %s which cannot be activated.Matched PE range %s:%u-%u against %s %u len %uFailed to insert segment in layer LV %s under %s:%u-%uMoving %u extents of logical volume %s.All data on source PV skipped. It contains locked, hidden or non-top level LVs only.Failed to convert pvmove LV to mirrored.Incompatible layer boundary: %s:%u[%u] on %s:%u.Failed to split segments being moved.ABORTING: Temporary pvmove mirror activation failed. Run pvmove --abort.Unable to move device used for writecache cachevol %s.Inserting layer %s for segments of %s on %slayer segment for %s:%u not found.No extents available for allocation.Removing layer %s for segments of %sLayer status does not match: %s:%u status: 0x%lx/0x%lxLayer boundary mismatch: %s:%u-%u on %s:%u / %u-%u / ABORTING: Removal of temporary pvmove mirror %s failed.ABORTING: Unable to deactivate temporary volume %s.ABORTING: Removal of temporary volume %s failed.Writing out final volume group after pvmove.ABORTING: Failed to write new data locations to disk.ABORTING: Failed to remove temporary logical volume(s).Please remove orphan temporary logical volume(s) when possible.Internal error: Invalid resize params.Physical volume %s format does not support resizing.WARNING: %s: Overriding real size %s. You could lose data.%s: Requested size %s exceeds real size %s. Proceed? [y/n]: Physical Volume %s not resized.%s: Requested size %s is less than real size %s. Proceed? [y/n]: %s: Size is already %s (%lu sectors).WARNING: %s: Pretending size is %lu not %lu sectors.Resizing volume "%s" to %lu sectors.Size must exceed minimum of %lu sectors on PV %s.Size must exceed physical extent start of %lu sectors on PV %s.Format specific resize of PV %s failed.Size must leave space for at least one physical extent of %u sectors on PV %s.No change to size of physical volume %s.Resizing physical volume %s from %u to %u extents.%s: cannot resize to %u extents as there is only room for %lu.%s: cannot resize to %u extents as %u are allocated.%s: cannot resize to %u extents as later ones are allocated.Use pvcreate and vgcfgrestore to repair from archived metadata.PV %-*s is in exported VG %s [%s / %s free]PV %-*s VG %-*s %s [%s / %s free]pvscan[%d] %s: autoactivation failed.CHECK: failed to read mda_header at %llumda_header_%d at %llu # metadata areaCHECK: mda_header_%d.checksum expected 0x%xCHECK: mda_header_%d.magic expected 0x%sCHECK: mda_header_%d.version expected %uCHECK: mda_header_%d.start does not match pv_header.disk_locn.offset %lluCHECK: mda_header_%d.size does not match pv_header.disk_locn.size %lluCHECK: failed to read metadata area at offset %llu size %lluFailed to write file %s metadata area size %llu.CHECK: mda_header_%d.raw_locn[%d] no mem for metadata text size %lluCHECK: failed to read metadata text at mda_header_%d.raw_locn[%d].offset %llu size %llu part_a %llu %lluCHECK: failed to read metadata text at mda_header_%d.raw_locn[%d].offset %llu size %llu part_b %llu %lluCHECK: failed to read metadata text at mda_header_%d.raw_locn[%d].offset %llu size %lluCHECK: metadata text at %llu crc does not match mda_header_%d.raw_locn[%d].checksumCHECK: failed to set up metadata parsingCHECK: failed to parse metadata text at %llu size %llumetadata text at %llu crc 0x%x # vgname %s seqno %uFailed to parse UUID from pv_uuid setting.Invalid raw text metadata in file. File size is too small.Invalid raw text metadata in file.(pvck stdout is not valid input, see pvck -f.)(metadata backup file is not valid input.)WARNING: unexpected final bytes of raw metadata, expected \n\n\0.Invalid raw text metadata in file. (No VG UUID found.)WARNING: file data does not begin with a VG name and may be invalid.Write input file data to disk?Failed to read the first 4096 bytes of device %s.Specify at least two values from: mda_num, mda_offset, mda_size.Ignoring mda2 values from settings.Specify at least two values from: mda_num, mda2_offset, mda2_size.Invalid mda_num=1 and mda2 settings.Using common defaults for first mda: offset %llu size %llu.Override defaults with --settings "mda_offset= mda_size="Using defaults for second mda: offset %llu size %llu.Ignoring mda1_offset %llu mda1_size %llu from pv_header.Ignoring mda2_offset %llu mda2_size %llu from pv_header.Searching for metadata at offset %llu size %lluFound bad header or metadata values.CHECK: mdas have different raw_locn[0].checksum valuesSet backup file in --settings backup_file=pathFile does not appear to contain a metadata backup.WARNING: No LVM label found on %s. It may not be an LVM device.Failed to read label_header at %lluWriting label_header.crc 0x%08xFound label on %s, sector %llu, type=LVM2 001Could not find LVM label on %sFound text metadata area: offset=%llu, size=%lluMetadata text %llu too large for mda_size %llu max %lluInternal error: Wrong params for _pvmove_create_id.Failed to allocate poll identifier for pvmove.Required device-mapper target(s) not detected in your kernel.Enable lvmpolld when using lvmlockd.Specify pvmove args when using lvmlockd.Failed to write lookup entry %s %spvscan[%d] Failed to write lookup entry %s %spvdisplay.cSkip writing in test mode.Failed to write new mda textpvmove.cpvremove.cpvcreate.cNEW (exported)(but full)--- %sPhysical volume ---PV Name %sVG Name %s%sPV Size %sAllocatable yes %sAllocatable NOPE Size %sPE Size (KByte) %uTotal PE %uFree PE %uAllocated PE %u--- Physical Segments ---Physical extent %u to %u: Logical volume %s%s/%s Logical extents %d to %d FREEpvresize.cof exported volume group(s)in no volume grouppvscan.cpvmove_poll.cFailed to find an LV name.Logical volume %s not found.pvmove%dCan't find sub LV %s.Can't find PVs for sub LV %s.Skipping locked LV %s.Inserting %s:%u-%u of %s/%sNo data to move for %s.Failed to activate %sanyLayer is not linear: %s:%uMissing error segtypelv_list alloc failedRemoving temporary pvmove LV.Layer segment found: %s:%u%-*s with UUID %sInvalid PV name with uuid.PV %-*s %-*sPV %-*s VG %-*sPV %-*s %-*s %-10s %sPV %-*s VG %-*s %-10s %sPV %-*s %-*s %s [%s]pvscan autoactivating VG %s.%s: autoactivation failed.?mda_header_%d.checksum 0x%xmda_header_%d.magic 0x%smda_header_%d.version %umda_header_%d.start %llumda_header_%d.size %llu LVM2 x[5A%r0N*>Failed to create file %sFailed to set up device %s.Cannot use %s: %s.Cannot access %s. %63[^=]=%63s %nInvalid setting at: %smetadata_offsetbackup_filemda_offsetmda_sizemda2_offsetmda2_sizedevice_sizemda_numInvalid setting: %sCannot open file: %sCannot access file: %sEmpty file: %sCannot read file: %s# Generatedid = No mda location.zero metadata copiesUnknown dump value.Write LVM header to device? Write new LVM header to %s? Failed to write new headerUnknown repair value.Failed to allocate lvid.Failed to clone LV name.Remove pv online devno %u:%uUnlink pv online %sDid not create %s: %dwrite_lookup_file %s LVM2 x[5A%r0N*>Wrong VG found for %d:%d PVID %s: %s vs %spvscan[%d] Wrong VG found for %d:%d PVID %s: %s vs %sNo device set up for online PV %d:%d %s PVID %spvscan[%d] No device set up for online PV %d:%d %s PVID %sPVID %s read from %s last written to %s.pvscan[%d] PVID %s read from %s last written to %s.pvscan using %s for PVID %s in VG %sIgnoring pvscan --cache -aay because event_activation is disabled.Ignoring pvscan with --checkcomplete because event_activation is disabled.pvscan[%d] Ignoring pvscan with --checkcomplete because event_activation is disabled.Both --major and --minor required to identify devices.pvscan_cache_all: label scan allpvscan_cache_all: create list of devicesIgnoring pvscan --cache because event_activation is disabled.Skip pvscan for unknown autoactivation value.pvscan[%d] Skip pvscan for unknown autoactivation value.Skip pvscan for event with event_activation=0.pvscan[%d] Skip pvscan for event with event_activation=0.pvscan[%d] Failed to set up devices.WARNING: Failed to parse major:minor from %s, skipping.WARNING: Invalid major:minor %d:%d, skipping.No device set up for arg %s %u:%u.pvscan[%d] No device set up for arg %s %u:%u.pvscan_cache_args: filter devs nodataFinding symlink names from DEVLINKS for filter regex.Finding symlink names from /dev for filter regex.pvscan_cache_args: read and filter devspvscan[%d] %s cannot read label.pvscan[%d] %s not an lvm device.%s excluded by devices file (checking PVID).pvscan[%d] %s excluded by devices file (checking PVID).pvscan_cache_args: label scan devspvscan[%d] Failed to initialize processing handle.pvscan[%d] VG %s skip autoactivation.pvscan[%d] VG %s run autoactivation.VG %s not using quick activation.pvscan[%d] VG %s not using quick activation.activation for VG %s failed to lock VG.pvscan[%d] activation for VG %s failed to lock VG.activation for VG %s failed to find vgid.pvscan[%d] activation for VG %s failed to find vgid.activation for VG %s cannot read (%x).pvscan[%d] activation for VG %s cannot read (%x).activation for VG %s found different devices.pvscan[%d] activation for VG %s found different devices.Merge is in progress, reporting merged LV %s. and also its SubLV(s) with option '-a'WARNING: RaidLV %s needs to be refreshed! See character 'r' at position 9 in the RaidLV's attributes%s.Internal error: _report_all_in_vg: incorrect report type %u.Unknown report specifier in report option list: %s.Internal error: _set_report_prefix_and_name: no prefix found for report type 0x%x_set_report_prefix_and_name: dm_strncpy failedWARNING: devtypes currently ignores command line arguments.Internal error: _do_report: full report requested at incorrect levelInternal error: _do_report: unknown report type.Failed to compact report output.dm_report: Unrecognized field: %.*sFailed to compact given columns in report output.No physical volume label read from %s.set_pv_devices_online vg %s pv %s missing flag already setset_pv_devices_online vg %s pv %s no online fileWARNING: VG %s PV %s wrong vgname in online file %sVG %s PV %s no device found for online PV %d:%d %spvscan[%d] VG %s PV %s no device found for online PV %d:%d %sset_pv_devices_online vg %s pv %s is online %sInternal error: _report_all_in_lv: incorrect report type %u.Internal error: _report_all_in_pv: missing pv.Internal error: _report_all_in_pv: incorrect report type %u.Internal error: report_for_selection: incorrect report type %uInternal error: _report: unknown report type.Failed to create temporary mempool to process report options.Failed to set selection for log report.Failed to add main report section to report group.Failed to finalize main report section in report group.Supported report formats: %s, %s, %s.dm_report: dm_report_init_group: failed to allocate mem poolFailed to create report group.Failed to add log report to report group.Failed to set log report name for command context.dm_report: failed to allocate root report group itemdm_report: failed to allocate report group structureskip_dev_dir: Couldn't split up device name %s.See lvmlockd(8) for changing a clvm/clustered VG to a shared VG.WARNING: Skipping clustered VG %s.Skipping exported volume group %sCannot access VG %s with system ID %s with %slocal system ID%s%s.Skipping foreign volume group %sCannot process standalone physical volumesCannot process volume group %sCannot access clustered VG %s."%s": Invalid path for Logical Volume."%s": Invalid environment var LVM_VG_NAME set for Volume Group.Path required for Logical Volume "%s".Skipping activation of cache pool %s.Skipping deactivation of used cache pool %s.Refusing to activate merging volume %s while snapshot volume %s is still active.Cannot fully deactivate merging origin volume %s while snapshot volume %s is still active.Activating raid LV %s requires the removal of partial snapshot %s.Cannot activate LVs in VG %s while PVs appear on duplicate devices.Cannot activate uninitialized integrity LV %s from pvscan.Cannot activate uninitialized integrity LV %s without lock.Updating VG to complete initialization of integrity LV %s.Invalid LV type for clearing integrityWARNING: failed to clear integrity recalculate flag for %sSpawning background pvmove process for %s.Spawning background lvconvert process for %s.Failed to allocate poll identifier for lvconvert.Delaying merge for origin volume %s since snapshot volume %s is still active.Setting pool chunk size to %s.Please specify either metadata logical volume or its size.Negative stripesize is invalid.Number of stripes (%d) must be between %d and %d.Ignoring stripesize argument for %s devices.Ignoring stripesize argument with single stripe.Cache mode "writeback" is not compatible with cache policy "cleaner".Ignoring deprecated --vdosettings option "%s" and its value.Invalid argument for VDO setting "vdo_%s".Cannot change VDO setting "vdo_%s" in existing VDO pool.LVM_EVENT_ACTIVATION=0pvscan_recreate_hints_beginDEVLINKSDEVLINKS %spvscan[%d] %s excluded: %s.%s cannot read label.%s not an lvm device.No VGs to autoactivate.VG %s skip autoactivation.VG %s run autoactivation.autoactivate quickautoactivate slowreporter.c and its SubLV(s)successfailureInterrupted.Failed to find device "%s".dev_iter creation failed.use_report_optionsInvalid options string: %sUnknown --headings value.No log report stored.%s: unknown report format.report_groupFailed to create log report.unknown Skipping volume group %sAllocation of vg_name failed.Disabling%s pool zeroing.Setting pool discards to %s.may not be negativemay not be zeroUsing default stripesize %s.Invalid stripe size %s.Unknown VDO setting "%s".Show help.reportFailed to get tag.Failed to add tag %s to %s/%sProcessing each VGstrlist allocation failed.Skipping invalid tag: %sInvalid volume group name %s.No volume groups found.Processing VG %s %sSelection failed for VG %s.Running command for VG %s %sSelection failed for LV %s.Processing LV %s in VG %s.Processing each PVCannot use %s: %sProcessing PVs in VG %sSelection failed for PV %s.Skipping PV %s in VG %s.Processing PV %s in VG %s.Processing device %s.device_id_list alloc failed.No PV found on device %s.Can't get device size of %s.No devices to process.Failed to rescan devs exclCannot read orphans VG %s.alloc pvl failed.Using existing orphan PV %s.Creating a new PV on %s.Zeroing start of device %s.%s not wiped: aborting.%s: command failed for %s.strdup failed.Failed to find PV %sFound root dm_uuid %sSetting fua and nofua cannot both be set.Setting %s is not recognized. Only one unrecognized setting is allowed.WARNING: Unrecognized writecache setting "%s" may cause activation failure.Use unrecognized writecache setting? [y/n]: Aborting writecache conversion.WARNING: Using unrecognized writecache setting: %s = %s.Can't initialize PV '%s' without -ff.Can't initialize physical volume "%s" of volume group "%s" without -ffUnable to add physical volume '%s' to volume group '%s'Really INITIALIZE physical volume "%s" of volume group "%s" [y/n]? WARNING: Forcing physical volume creation on %s of volume group "%s"WARNING: Faking size of PV %s. Don't write outside real device.WARNING: %s: device size %s does not match requested size %s. Proceed? [y/n]: PV %s is used by VG %s so please use vgreduce first.(If you are certain you need pvremove, then confirm by using --force twice.)WARNING: PV %s is used by VG %s.Really WIPE LABELS from physical volume "%s" of volume group "%s" [y/n]? WARNING: prompt answer yes is overridden by prompt answer no.%s: physical volume not initialized.%s: physical volume label not removed.WARNING: Wiping physical volume label from %s of volume group "%s".Invalid lvm.conf writecache setting value for %s.High watermark must be greater than low watermark.Invalid raid integrity journal size %d MiB (use 4-1024 MiB).Logical volume %s/%s does not support tagsFailed to add tag %s to physical volume %s.Failed to duplicate tag %s from %s/%sPlease use a single volume group name ("%s" or "%s").Logical volume name "%s" is invalid._init_processing_handle: failed to allocate memory for processing handle_init_selection_handle: failed to allocate memory for selection handleMultiple VGs found with the same name: skipping %sUse --select vg_uuid= in place of the VG name.Use VG uuid in place of the VG name.Processing VG %s because of matching UUID %sVG name on command line not found in list of VGs: %sObtaining the complete list of VGs to processRepeat lock and read for local to shared vgIgnoring virtual origin logical volume %s.Adding %s to the list of LVs to be processed.Invalidating devs for any PVs on LVs.Internal error: Command %d:%s arg position %d does not permit an LV (%llx)WARNING: Command on LV %s does not accept LV type %s.WARNING: Command on LV %s does not accept LV type unknown (%d).Command not permitted on LV %s.WARNING: Command on LV %s has invalid use of option %s.WARNING: Command on LV %s requires option %s.WARNING: Command on LV %s uses options invalid with LV type %s.WARNING: Command on LV %s with invalid LV type %s.WARNING: Command on LV %s uses options that require LV types %s.WARNING: Command on LV %s does not accept LV type %s. Required LV types are %s.WARNING: Command on LV %s uses options that are invalid with LV properties: %s.WARNING: Command on LV %s is invalid on LV with properties: %s.WARNING: Command on LV %s uses options that require LV properties: %s.WARNING: Command on LV %s requires LV with properties: %s.Processing historical LV %s in VG %s.Failed to free lock for LV %s/%s in lvmlockd.Failed to find logical volume "%s/%s"Failed to allocate final LV list item.Processing lockd_sanlock_lv %s/%s.Tags cannot be used with this command.ignoring claim of PV %s by VG %s.Cannot use PV %s in exported VG %s.Cannot use PV %s in foreign VG %s.Cannot use PV %s in shared VG %s.device_list element allocation failedProcessing duplicate device %s.Internal error: No info for pvidFailed to find physical volume "%s".Processing devices that are not PVslabelsector must be less than %lu.metadataignore only applies to metadatacopies > 0.Physical volume data alignment may not be negative.Physical volume data alignment is too big.Physical volume data alignment offset may not be negative.Physical volume data alignment offset is too big.WARNING: Ignoring data alignment %s incompatible with restored pe_start value %s.Metadata size may not be negative.Bootloader area size may not be negative.Scanning and filtering device args (%u).Command requires all devices to be found.WARNING: Unknown block size for device %s.WARNING: Unknown logical_block_size for device %s.WARNING: Devices have inconsistent physical block sizes (%u and %u).See lvm.conf allow_mixed_block_sizes.Check pvremove arg %s no PVID foundCheck pvremove arg %s device is not a PV.Check pvremove arg %s found vg %s.Check pvremove arg %s found EXT_USED flag.Check pvremove arg %s is orphan.Check pvcreate arg %s no PVID foundCannot use device %s with duplicates.Failed to read lvm info for %s PVID %s.Check pvcreate arg %s found vg %s.Check pvcreate arg %s found EXT_USED flag.Check pvcreate arg %s is orphan.UUID %s already in use on "%s".Check pvremove arg %s device is a duplicate.Failed to reacquire global lock after prompt.Rescanning and filtering device args with exclusive openWiping signatures on new PV %s.Using existing orphan PVs in %s.Failed to create random uuid for %s.WARNING: %s: Overriding real size. You could lose data.%s: Pretending size is %lu sectors.%s: Size must exceed minimum of %lu sectors.Set up physical volume for "%s" with %lu available sectors.Format-specific initialisation of physical volume %s failed.Failed to add metadata area for new physical volume %sFailed to setup physical volume "%s".Failed to wipe existing label on %s.Writing physical volume data to disk "%s".Failed to write physical volume "%s".Physical volume "%s" successfully created.Failed to wipe existing label(s) on %s.Labels on physical volume "%s" successfully wiped.delete dev from initial duplicates %sdelete dev from unused duplicates %sDuplicate device name found on input: %s.Checking %s for pvremove %.32s.Checking %s for pvcreate %.32s.pv_list allocation in pv_create failedVolume group allocation policy is already %svgchange_metadata_copies new %u vg_mda_copies %u D %uWARNING: Number of metadata copies for VG %s is already unmanaged.WARNING: Number of metadata copies for VG %s is already %u.Volume group "%s" is already resizeableVolume group "%s" is already not resizeableVolume group autoactivation is already %s.Error processing filename template %sVGs must be backed up into different files. Use %%s in filename for VG name.No backup taken: specify filename with -f to backup with missing PVs.Volume group "%s" successfully backed up.No backup taken: specify filename with -f to backup with unknown segments.Option -A is not allowed with volume group namesPlease supply volume groups or use --select for selection or use -a for all.No arguments permitted when using -a for all.Please supply volume groups or -S for selection or use -a for all.WARNING: Volume groups with missing PVs will be imported with --force.Volume group name "%s" is invalid.Please specify a *single* volume group to restore.Internal error: VG name is not set.WARNING: Failed to check for active volumes in volume group "%s".WARNING: Found %u active volume(s) in volume group "%s".Restoring VG with active LVs, may cause mismatch with its metadata.Do you really want to proceed with restore of volume group "%s", while %u volume(s) are active? [y/n]: Unable to lock volume group %s.WARNING: Physical extent size cannot be larger than %s.WARNING: Physical extent size of VG %s is already %s.Failed to change physical extent size for VG %s.Volume group has active logical volumes.Failed to generate new random UUID for VG %s.Changing configuration profile for VG %s: %s -> %s.Ignoring invalid string in lock_start list.Ignoring empty string in config file.Cannot change system ID without the majority of PVs (found %d of %d).Volume Group system ID is already "%s".WARNING: Removing the system ID allows unsafe access from other hosts.Remove system ID %s from volume group %s? [y/n]: System ID of volume group %s not changed.Logical Volumes in VG %s must be deactivated before system ID can be changed.WARNING: Requested system ID %s does not match local system ID %s.WARNING: No local system ID is set.WARNING: Volume group %s might become inaccessible from this machine.Set foreign system ID %s on volume group %s? [y/n]: Volume group %s system ID not changed.Changing system ID for VG %s from "%s" to "%s".Volume group "%s" successfully changed.Need one or more command options.Only one of --metadataprofile and --detachprofile permitted.Only one of -a and --refresh permitted.Only -a permitted with --ignorelockingfailure and --sysinit.Only -ay* allowed with --monitor or --poll.Only one of --poll and --sysinit permitted.MaxPhysicalVolumes may not be negative.Physical extent size may not be negative.Change clustered property of all volumes groups? [y/n]: Skip vgchange for unknown autoactivation value.Skip vgchange for event and event_activation=0.Failed early VG locking for autoactivation.Finding online devices to scanNo device found for quick mapping of online PV %u:%u %s PVID %s.Repeat dev cache scan to translate devnos.No device found for %u:%u PVID %s.label_scan_vg_online: read and filter devsMatch device_id %s %s to %s: matching PVIDIncomplete PV list from online files %d metadata %d.PVs online error%s%s, using all devices.PVs online not found for VG %s, using all devices.PVs online incomplete for VG %s, using all devices.WARNING: New lock type %s matches the current lock type %s.Cannot change lock type directly from "%s" to "%s".First change lock type to "none", then to "%s".Changing VG %s lock type not allowed with active LVsFailed to initialize lock args for lock type %sFailed to allocate LV lock on diskCannot change to unknown lock type %sForcibly change VG lock type to %s? [y/n]: Using lock type requires lvmlockd.Not starting %s since it does not pass lock_start_listNot starting %s since it does not pass auto_lock_start_listVG %s stop failed: LVs must first be deactivatedlockd_stop_vg deactivate sanlock lvUsing lock start and lock stop requires lvmlockd.No global lock for lock start.Starting locking. VG can only be read until locks are ready.Starting locking. Waiting for sanlock may take a few seconds to 3 min...Starting locking. Waiting until locks are ready...Starting background polling for volume group "%s".Background polling started for %d logical volume(s) in volume group "%s"Internal error: lvmcache_get_bad_mdas no vginfo %sWARNING: not repairing bad metadata (0x%x) for mda%d on %sWARNING: repairing bad metadata (0x%x) in mda%d at %llu on %s.WARNING: failed to write VG %s metadata to bad mda%d at %llu on %s.WARNING: failed to precommit VG %s metadata to bad mda%d at %llu on %s.WARNING: failed to commit VG %s metadata to bad mda%d at %llu on %s.The volume group is missing %d physical volumes.Volume group "%s" will be extended by %d new physical volumesVolume group "%s" successfully extendedPlease enter volume group name and physical volume(s)%s:%s:%lu:-1:%u:%u:%u:-1:%u:%u:%u:%lu:%u:%u:%u:%u:%s"%s" %-9s [%-9s used / %s free]VG Access %s%s%s%sVG Status %s%sresizableVolume group "%s" has active logical volumesLV %s/%s must be inactive on all hosts before vgexport.Volume group "%s" successfully exportedWARNING: PV %s not found in VG %sWARNING: PV %s was not missing in VG %sVolume group "%s" is not exportedVolume group "%s" is partially missingVolume group "%s" successfully importedPhysical extent size must be smaller than %s.Max Logical Volumes may not be negative.Max Physical Volumes may not be negative.WARNING: VG with system ID %s might become inaccessible as local system ID is %sWARNING: A VG without a system ID allows unsafe access from other hosts.The --shared option requires lock type sanlock, dlm or idm.Failed to get result from lvmlockdFailed to find a running lock manager.Found multiple lock managers, select one with --lock-type.Failed to detect a running lock manager to select lock type.Using a shared lock type requires lvmlockd (lvm.conf use_lvmlockd.)Using a shared lock type requires lvmlockd.Please provide volume group name and physical volumesThe clustered option is deprecated, see --shared.Cannot create VG with lock_type %s without lvmlockd.lockd global create disabled %slockd global create lock_type %sGlobal lock failed: check that VG holding global lock exists and is started.Global lock failed: check that global lockspace is started.Global lock failed: lockspace is starting.VG create failed: lock manager %s is not supported by lvmlockd.A volume group called %s already exists.WARNING: Setting maxlogicalvolumes to %d (0 means unlimited)WARNING: Setting maxphysicalvolumes to %d (0 means unlimited)Volume group "%s" successfully created%s%sStarting locking. VG is read-only until locks are ready.Failed to allocate memory for system_id in vg_set_system_id.Global lock failed: start existing sanlock VGs to access global lock.(If all sanlock VGs are started, enable global lock with lvmlockctl.)Option -j|--major may not be repeated.Options --major and --minor are incompatible with -Mn.Please specify minor number with --minor when using -My.Please specify major number with --major when using -My.WARNING: Ignoring supplied major number %d - kernel assigns major numbers dynamically. Using major number %d instead.Autoactivation is disabled for VG %s.Can't deactivate volume group "%s" with %d open logical volume(s)%d logical volume(s) in volume group "%s" already active%d existing logical volume(s) in volume group "%s" %smonitored%sctivated %d logical volumes in volume group %s.%d logical volume(s) in volume group "%s" now active%d logical volume(s) in volume group "%s" %smonitoredvgchange.cvgdisplay.cFailed to allocate filename.vgcfgbackup.cvgexport.cvgimport.cvgcfgrestore.cNo archives found in %s.Restore aborted.Restore failed.Restored volume group %s.(no profile)Unable to set system ID.%s/devices/auto-import-rootvg for VG No volume groups changed.Skipping device_id filteringVG lock type not changed.lockd stop VG %s lock_type %sstop_vgVG %s stop failed: %dFailed to write VG.vgck.cFailed to commit VG.Volume group %s not changedvgextend.cr/wexported/--- Volume group ---VG Name %sSystem ID %sFormat %sMetadata Areas %dMetadata Sequence No %dClustered yesShared %sMAX LV %uCur LV %uOpen LV %uMax PV %uCur PV %uAct PV %uVG Size %sAlloc PE / Size %u / %sFree PE / Size %u / %sVG UUID %s--- Physical volumes ---No PV has been restored.running_lmlvmlockd found sanlocklvmlockd found dlmlvmlockd found idmlock_type %s is invalidSetting lock_type to %s with system ID vgcreate.cEnabling sanlock global lockFailed to get tagFailed to start lockingDeaVG %s is incomplete.Found %s creating %s/run/lvm/lvm-devices-importfailed to create %sRefreshing volume group "%s"Physical extent size may not be negative.vgimportclone.cFailed to find device %s.scan new devsDevice %s is excluded: %s.No VG found on devices.get other devicesscan other devicesBase vg name %s is too long.%s1%s%uUsing new VG name %s.import vg on new devicesCan't get lock for VG name %sVG is missing a device.vgimportdevices.cFailed to unlink %svgremove.cFailed to find root VG.No devices to add.vgmerge.cvgreduce.cvgsplit.cChanged LVID for %s to %sRefresh failed for %s.vgmknodes.cNo device found for PV.vgreduce_single VG %s PV %sVolume group "%s" not removedvgrename.cCan't get lock for %srename_vg_beforeRenaming "%s" to "%s"Test mode: Skipping rename.Renaming "%s" to "%s" failedrename_vg_finalexported vgscan.cExistingNewInvalid vg name %s.Failed to create new VG %s.Failed to read VG %s.Physical Volume %s not foundDevices file not enabled, ignoring importdevices.Devices file does not exist, ignoring importdevices.Failed to find PVID for device %s.Devices must be from the same VG.Temporary vg name %s1 is too long.Internal error: Old vg name %s is too long.Failed to generated temporary vg name, %s%u is too long.Can't get lock for new VG name %sFailed to read VG %s from devices being imported.Error reading VG %s from devices being imported.VG %s is exported, use the --import option.VG %s is partial, it must be complete.Device %s has active LVs, deactivate first.PV with UUID %s is part of VG %s, but is not included in the devices to import.All PVs in the VG must be imported together.Device %s was not found in VG %s.The devices to import must match the devices in the VG.Failed to add device id for %s.Failed to update VG on devices being imported.Not importing devices for VG %s with missing PV %s.Failed to write device ids in VG metadata.Please enter one or more volume group paths or use --select for selection.Root VG auto import is not enabled.Failed to set up devices file.Failed to create devices file.Failed to write the devices file.Added %u devices to devices file for root VG %s.Added %u devices to devices file.Checking for volume group "%s"vgmerge not allowed for lock_type %sWARNING: Partial LV %s needs to be repaired or removed. There are still partial LVs in VG %s.To remove them unconditionally use: vgreduce --removemissing --force.To remove them unconditionally from mirror LVs use: vgreduce --removemissing --mirrorsonly --force.WARNING: Proceeding to remove empty missing PVs.Volume Groups must always contain at least one PV.Removing PV with UUID %s from VG %s.LVs still present on PV with UUID %s: Can't remove from VG %s.Please enter 2 or more volume groups to mergeDuplicate volume group name "%s"Removing pool metadata spare %s.Marking PV %s as moved to VG %sFailed to generate new random LVID for %sWriting out updated volume groupVolume group "%s" successfully merged into "%s"Physical volume "%s" still in useCan't remove final physical volume "%s" from volume group "%s"Cannot remove final metadata area on "%s" from "%s"Removal of physical volume "%s" from "%s" failedFailed to clear metadata from physical volume "%s" after removal from "%s"Removed "%s" from volume group "%s"Removing "%s" from volume group "%s"Internal error: %s is not a partial LV.Attempting to remove missing devices from %s LV, %s.Partial raid image %s iorig %sPartial raid image %s imeta %sPartial raid image %s rmeta %sRemoving integrity layer from partial raid image %s %s %sFound %d partial integrity images to remove from %sFailed to remove integrity from partial raid LV %s.Replacing %s segments with error target.Failed to replace %s's extents with error target.Non-mirror-image LV %s found: can't remove.WARNING: Removing partial LV %s.Failed to write out a consistent VG for %sPlease give volume group name and physical volume paths.Please give volume group name.--mirrorsonly requires --removemissing.Please enter physical volume paths or option -a.Option -a and physical volume paths mutually exclusive.Please only specify the volume group.Volume group "%s" is already consistent.Wrote out consistent volume group %s.WARNING: %d physical volumes are currently missing from the system.Do you really want to remove volume group "%s" containing %u logical volumes? [y/n]: Volume group "%s" not found, is inconsistent or has PVs missing.Consider vgreduce --removemissing if metadata is inconsistent.Volume group "%s" still contains %u logical volume(s)New VG name must differ from the old VG name.New VG name "%s" already existsNew VG name "%s" matches the UUID of existing VG %sLVs must be inactive before vgrename.Cannot rename VG %s with active LVslockd_rename_vg_before lvmlockd result %dlockd_rename_vg_before deactivate sanlock lvRenaming path is too long %s/%s %s/%slockd_rename_vg_final lvmlockd result %dFailed to start VG %s lockspace.Volume group "%s" successfully renamed to "%s"Failed to restart VG %s lockspace.Old and new volume group names need specifyingNew volume group path exceeds maximum length of %d!Old and new volume group names must differFound %svolume group "%s" using metadata type %sCannot notify dbus: notify_dbus is disabled in lvm config.WARNING: Ignoring vgscan --cache command because lvmetad is no longer used.Logical volume %s (part of %s) must be inactive.Logical volume %s must be inactive.Can't split LV %s between two Volume GroupsExisting VG, new VG and either physical volumes or logical volume required.A logical volume name cannot be given with physical volumes.Failed to lock new VG name %s.Volume group "%s" exists, but new VG option specifiedLogical volume %s not in volume group %sCannot move PV(s) from non resize volume group %s.Cannot move PV(s) to non resize volume group %s.Can't split mirror %s between two Volume GroupsCan't split external origin %s and pool %s between two Volume Groups.Can't split pool data and metadata %s between two Volume Groups.Cannot split cache origin %s and its cache pool data %s into separate VGs.Cannot split cache origin %s and its cache pool metadata %s into separate VGs.Cannot split cache pool data %s and its metadata %s into separate VGs.Cannot split cache origin %s and its cachevol %s into separate VGs.Can't split snapshot %s between two Volume GroupsCannot split: Nowhere to store metadata for new Volume GroupWriting out updated volume groups%s volume group "%s" successfully split from "%s"Can't split Logical Volume %s between two Volume Groups\x5cx#+-.:=@_%2x%128s/proc/devices%u %255s %s: No entry for %s found%s: Wrong inode typeDM_DEBUG_WITH_LINE_NUMBERS%s:%d /run/lvm/lvmlockd.socketHandle initialisation failed.lvmcmdlib.cCmdline copy failed.No command supplied_memlock_inc_memlock_dec_dmeventd_thin_command_dmeventd_vdo_commandTZ:/etc/localtimeCouldn't copy command line.Version: %sParsing: %sCorrect command syntax is:Command requires options: %sMESSAGE=lvm command %sCODE_LINE=907PRIORITY=%iLVM_CMD_ID=%sLVM_CMD_NAME=%sIgnore opt %dProcessing command: %sCommand pid: %dSystem ID: %sO_DIRECT will be usedmpath pool creation failed.LVM_LVMLOCKD_SOCKETCompleted: %s/run/lvmlockd.pidconfig-util.c%.*s= %ld %.*s= "%s" %b%.*s%s ## daemon-client.crequestFailed to duplicate node key.control/proc/miscCreating device %s (%u, %u)mknodDM_DEFAULT_NAME_MANGLING_MODEName "%s" too long.Couldn't create path for %sDevice %s not found%s/../%s) UUID DM_DEVICE_RESUMEDM_DEVICE_REMOVEDM_DEVICE_RENAMEkey setenablechecks ima_measurement securedata deferredremove retryremove skiplockfs readonly noflush noopencount reload %u:%u diff type %s %sreload params1 %sreload params2 %sget_timestampclock_gettime(unknown version)Failed to build sysfs_path.%s (%d:%d): read ahead is %uBLKRAGET%s: read ahead is %u [trust_udev] [verify_udev]%s: %s NODE_DEL%s%s%s: %s NODE_RENAME to %s%s%sProcessingFailed to build size in kB.BLKRASETSkipping_control_fd%*u %*u %u:%u %4096s %4096s%sfs%sfs/%s/%sThe %s "%s" seems to be mangled more than once. This is not allowed in auto mode.The %s "%s" should be mangled but it contains blacklisted characters._do_dm_ioctl_unmangle_string: failed to unmangle %s "%s"Hex encoding mismatch detected in %s "%s" while trying to unmangle it.%s: Wrong device number: (%u, %u) instead of (%u, %u)Too many arguments. Limit is %d.Internal error: _memlock_inc_daemon used in critical section.memlock_count_daemon inc to %dInternal error: _memlock_count_daemon has dropped below 0.memlock_count_daemon dec to %dError during parsing of command line.No command with matching syntax recognised. Run '%s --help' for more information.Nearest similar command has syntax:Command does not accept option: %s%s%s.Command does not accept argument: %s.Command does not accept option combination: %s with %sCommand does not accept options: %sRecognised command %s (id %d / enum %d).MESSAGE_ID=3ca432788c374e4ba684b834188eca36Internal error: config_file_changed: expected file config source, found %s config source.Config file %s has disappeared!Failed to reload configuration filesConfiguration file %s is not a regular fileDetected config file change to %sUpdated config file invalid. Aborting.DEGRADED MODE. Incomplete RAID LVs will be processed.--ignoremonitoring or --sysinit option not allowed with --monitor option.%s: Command not permitted while global/metadata_read_only is set.WARNING: see lvmlockd(8) for information on using cluster/clvm VGs.WARNING: locking_type (%d) is deprecated, using --nolocking.WARNING: locking_type (%d) is deprecated, using --sysinit --readonly.WARNING: locking_type (%d) is deprecated, using file locking.LVM_SUPPRESS_LOCKING_FAILURE_MESSAGESFile locking settings: readonly:%d sysinit:%d ignorelockingfailure:%d global/metadata_read_only:%d global/wait_for_locks:%d.Path for locking_dir %s is invalid.File locking initialisation failed.WARNING: Ignoring unknown md_component_checks setting, using auto.Using md_component_checks %s use_full_md_check %dmpath hash table creation failed.multipath wwids file disabled.Ignore lvmlockd for pvscan cache.Ignore lvmlockd for lvmdevices.WARNING: lvmlockd process is not running.Should not connect to lvmlockd with use_lvmlockd=0.lvmlockd is already connected.Successfully connected to lvmlockd on fd %d.WARNING: lvmlockd connect failed.Run `%s --help' for more information.Failed to strdup command basename.Internal error: Bad format string at '%s'Internal error: Do not use %%d and use correct 64bit formInternal error: Daemon send: socket fd cannot be negative %dInternal error: Daemon send: no memory availableInternal error: Bad format string '%s'Target type name %s is too long.create_target: malloc(%zu) failedcreate_target: strdup(params) failedcreate_target: strdup(type) failedCould not determine kernel version used.Failed to set up list of device-mapper major numbersFailure to communicate with kernel device-mapper driver.Check that device-mapper is available in the kernel.dm_task_set_message: strdup failedAttempted to decrement suspended device counter below zero.Suspended device counter reduced to %dFailed to mangle device name "%s".Device name mangled [%s]: %s --> %s_dm_task_set_name: strdup(%s) failedName "%s" invalid. It contains "/".Couldn't create /dev path for %sFailed to mangle device uuid "%s".Device uuid mangled [%s]: %s --> %sdm_task_set_uuid: strdup(%s) failedInternal error: unknown device-mapper task %dFailed to revert device creation.Failed to create device-mapper task structreload %u:%u diff start %llu %llu type %s %sreload %u:%u diff length %llu %llu type %s %sreload %u:%u diff params ignore for type %sreload %u:%u diff params for type %sInternal error: Performing unsafe table load while %d device(s) are known to be suspended: %s%s%s %s%.0d%s%.0d%s%sInternal error: dm '%s' ioctl should not define parameters.targets and message are incompatibletargets and rename are incompatibletargets and geometry are incompatiblemessage and rename are incompatiblegeometry and rename are incompatiblegeometry and message are incompatiblemessage is required with sectorOverriding major number of %d with %u for persistent device.Missing major number for persistent device.device (%u:%u) is %s for compatibility with old kernelUnable to find name for device (%u:%u)No flush flag unsupported by kernel. Buffers will be flushed.Secure data flag unsupported by kernel. Buffers will not be wiped after use.WARNING: Inactive table query unsupported by kernel. It will use live table.Setting UUID unsupported by kernel. Aborting operation.IMA measurement unsupported by kernel. Aborting operation.Ran out of memory building ioctl parameterCouldn't create ioctl argument.Cookie value is not set while trying to call %s ioctl. Please, consider using libdevmapper's udev synchronization interface or disable it explicitly by calling dm_udev_set_sync_support(0).Switching off device-mapper and all subsystem related udev rules. Falling back to libdevmapper node creation.dm %s %s%s %s%s%s %s%.0d%s%.0d%s%s[ %s%s%s%s%s%s%s%s%s%s] %.0lu %s [%u] (*%u)device_mapper/libdm-timestamp.cdevice-mapper: %s ioctl on %s %s%s%.0d%s%.0d%s%s failed: %sUevent not generated! Calling udev_complete internally to avoid process lock-up.WARNING: libdevmapper buffer too small for dataFailed to get device-mapper versionIncompatible libdevmapper %s%s and kernel driver %s.dm_task_create: malloc(%zu) failedAttempting to suspend a device that is already suspended (%u:%u)Internal error: Attempt to suspend device %s%s%s%.0d%s%.0d%s%sthat uses already-suspended device (%u:%u)%sdev/block/%u:%u/bdi/read_ahead_kbEmpty device name passed to BLKRAGET%s: %s NODE_ADD (%u,%u) %u:%u 0%o%s%s%s: %s NODE_READ_AHEAD %u (flags=%u)%s%s%s: retaining kernel read ahead of %u (requested %u)%s (%d:%d): Setting read ahead to %uFailed to parse mountinfo line.Mount info task creation failed.Replacing mountinfo device (%u:%u) with matching DM device %s (%u:%u).WARNING: sysfs_path dm_snprintf failed.+544444444444444444444444444444444444444444444444444444444444444O5_5W555u5j55555G54Gg /proc/self/mountinfocreate8reload 8remove8remove_all8suspend8resume8info8deps 8rename8version8status 8table 8waitevent8names8clear 8mknodes8versions 8message8setgeometry8armpoll8$target-version8)log_commandParse error at byte %td (line %d): expected a string token.Existing path %s is not a directory.dm_pool_grow_object failed for config linevsnprintf failed for config linedm_vasprintf failed for config line_write_value: Unknown value type: %ddm_pool_begin_object failed for config lineWARNING: Invalid creation_time found in metadata (repaired with next metadata update).Parse error at byte %td (line %d): unexpected tokenParse error at byte %td (line %d): expected a valueFailed to allocate type value.Failed to clone string config value.-------------------------------------------------------------------------------Internal error: Field type undefined._create_dm_tree_node alloc failed.dtree node hash insertion faileddtree uuid hash insertion failedKernel not configured for semaphores (System V IPC). Not using udev synchronization code.Udev is not running. Not using udev synchronization code.Could not get udev state. Assuming udev is not running.Udev is running and DM_DISABLE_UDEV environment variable is set. Bypassing udev, device-mapper library will manage device nodes in device directory.Could not continue to access notification semaphore identified by cookie value %u (0x%x). Incorrect cookie prefix.Could not find notification semaphore identified by cookie value %u (0x%x)No permission to access notification semaphore identified by cookie value %u (0x%x)Failed to access notification semaphore identified by cookie value %u (0x%x): %scookie dec: semid %d: sem_ctl GETVAL failed for cookie 0x%x: %scookie dec: semid %d: semop failed for cookie 0x%x: incorrect semaphore statecookie dec: semid %d: semop failed for cookie 0x%x: %sUdev cookie 0x%x (semid %d) decremented.Udev cookie 0x%x (semid %d) decremented to %dCould not cleanup notification semaphore identified by cookie value %u (0x%x): %sUdev cookie 0x%x (semid %d) destroyedFailed to open /dev/urandom to create random cookie valueFailed to initialize notification cookieNot enough memory to create notification semaphoreLimit for the maximum number of semaphores reached. You can check and set the limits in /proc/sys/kernel/sem.Failed to create notification semaphore: %sUdev cookie 0x%x (semid %d) createdcookie create: semid %d: semctl failed: %scookie create: semid %d: sem_ctl GETVAL failed for cookie 0x%x: %sUdev cookie 0x%x (semid %d) incremented to %dcookie inc: semid %d: semop failed for cookie 0x%x: %sCould not set notification semaphore identified by cookie value %u (0x%x)cookie inc: semid %d: sem_ctl GETVAL failed for cookie 0x%x: %sUdev cookie 0x%x (semid %d) incremented.Udev cookie 0x%x (semid %d) assigned to %s task(%d) with flags%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s (0x%x)Deactivation dm_task creation failed for %sThe %s "%s" contains mixed mangled and unmangled characters or it's already mangled improperly.Mangled form of the %s too long for "%s".Device %s (%u:%u) appears to be mounted on %s.Failed to allocate config pool.Failed to allocate config tree.WARNING: Ignoring duplicate config node: %s (seeking %s)Parse error at byte %td (line %d): empty section identifierWARNING: Ignoring duplicate config value: %sCannot clone NULL config node.dtree uuid hash creation failedMatched uuid %s %s in deptree.Matched uuid %s %s (missing suffix -%s) in deptree.Matched uuid %s %s (missing prefix) in deptree.Not matched uuid %s in deptree.Cannot add device without name and uuid._node_clear_table failed: missing nameFailed to obtain dependencies for %s before clearing table.Clearing inactive table %s (%u:%u)Table clear dm_task creation failed for %s_node_clear_table failed: info missing after running task for %sFailed to deactivate no-longer-used device %s (%u:%u)Suspend dm_task creation failed for %s.Failed to set device name for %s resumption.Suspend dm_task creation failed for %sSuspended device counter increased to %dExpected thin-pool target for %s and got %s.Found transaction id %lu for thin pool %s with status line: %s.Failed to process message "%s".Node %s must have only one segment.Cannot use same device id for origin and its snapshot.New transaction id must be sequential.Current transaction id is different from thin pool.Failed to allocate thin message.dm_tree_node_add_target_area called without deviceDevice %s is not a block device.Thin pool %s transaction_id matches %lu, skipping messages.Thin pool %s transaction_id is %lu, while expected %lu.Cannot send messages to thin pool %s%s%s%s.Thin pool %s already contain thin device with device_id %u.Manual intervention may be required to remove device dev_id=%u in thin pool metadata.Optionally new thin volume with device_id=%u can be manually added into a volume group.WARNING: When uncertain how to do this, contact support!Thin pool %s transaction_id is %lu and does not match expected %lu.Sent messages to thin-pool %s and skipping suspend of its children.Failed to duplicate directory name.Unable to deactivate open %s (%u:%u).Node %s %d:%d has open_count %dUnable to deactivate %s (%u:%u).%s failed to allocate sort value structure%s failed to allocate report string structure%s failed to allocate temporary array for processing%s failed to allocate array of items inside sort value structuredm_report_field_percent: dm_pool_alloc failed for sort_value.dm_report_field_percent: dm_pool_alloc failed for percent report string.dm_report_field_percent: percentage too large.dm_report: field not match: %sdm_report: struct field_properties allocation faileddevice_mapper/libdm-file.cFailed to duplicate token.%f0%lo%s}[%s,%sFailed to read int token.Failed to read float token.Failed to clone config value.Specialstring listunselectable %s Fields%*.*s %sall%-*s - %sAll fields in this section. %-*s - %s%s%s%s%sdtree link allocation failedname pool_strdup failed SUBSYSTEM_7 SUBSYSTEM_6 SUBSYSTEM_5 SUBSYSTEM_4 SUBSYSTEM_3 SUBSYSTEM_2 SUBSYSTEM_1 SUBSYSTEM_0 PRIMARY_SOURCE DISABLE_LIBRARY_FALLBACK LOW_PRIORITY DISABLE_OTHER_RULES DISABLE_DISK_RULES DISABLE_SUBSYSTEM_RULES DISABLE_DM_RULESCREATERELOADREMOVE_ALLINFODEPSWAITEVENTLISTCLEARMKNODESLIST_VERSIONSTARGET_MSGSET_GEOMETRYRemoving %s (%u:%u)\x%02xconfig_outputFailed to allocate valuetruefalseFailed to clone config node.dtree hash creation failedFailed to allocate dtree.Resuming %s (%u:%u). with device flushSuspending %s (%u:%u)%s%s with filesystem syncno targetNode %s is missing a segment.Dropping callback for %s.Reverting %s.Unable to deactivate %s.Node %s has segment type %s.Unsupported message type %d.Couldn't find area uuid %s. in failed state which needs check first with read only metadataUUID "%s" does not match.create_snap %u %ucreate_thin %udelete %uset_transaction_id %lu %lureserve_metadata_snaprelease_metadata_snapUnable to suspend %s (%u:%u)Creating directory "%s"is used by another devicecontains a filesystem in useDevice %s (%u:%u) %s.Unrecognised field: %.*sspecial_^VVĶVVVVVVVVVVͶٶ|| lo ,8x|L\_report_field_string_list: <#devs> %lu/%lu||At least one field must matchLogical negationLeft parenthesisRight parenthesisList startList endList subset startList subset end!~!=>=<=sinceuntilInternal error: %s reserved value handler for field %s has missing implementation of DM_REPORT_RESERVED_PARSE_FUZZY_NAME actionError occurred while processing %s reserved value handler for field %s_add_item_to_string_list: memory allocation failed for string list itemFailed to create report selection regex memory pool.Matching regular expression. [regex] field - Reporting field. number - Non-negative integer value. size - Floating point value with units, 'm' unit used by default if not specified. percent - Non-negative integer with or without %% suffix. string - Characters quoted by ' or " or unquoted. string list - Strings enclosed by [ ] or { } and elements delimited by either "all items must match" or "at least one item must match" operator. regular expression - Characters quoted by ' or " or unquoted._display_selection_help: dm_pool_begin_object failed Logical and grouping operators:dm_report: Unable to extend output line_compare_selection_field: field without value :%dInternal error: _compare_selection_field: regex: incorrect type %u for field %sInternal error: _cmp_field_int: unsupported number comparison type for field %sInternal error: _cmp_field_double: unsupported number comparison type for selection field %sInternal error: _cmp_field_string: unsupported string comparison type for selection field %sInternal error: _cmp_field_time: unsupported time comparison type for field %sInternal error: _compare_selection_field: incorrect type %u for field %sdm_report_enable_compact_output: dm report handler is NULL.dm_report: Missing sort field namedm_report: Ignoring duplicate sort field: %s.dm_report: Unrecognised field: %.*sdm_report: unable to add more than one report to current report groupdm_report: can't use unnamed object at top level of JSON outputdm_report: failed to duplicate json item namedm_report: dm_report_group_push: group item allocation faileddm_report: dm_report_group_pop: group has no itemsdm_report: Could not allocate memory for output line buffer.dm_report: left-aligned snprintf() faileddm_report: right-aligned snprintf() faileddm_report: dm_report_output: interleaved reports detected for JSON outputdm_report: dm_report_output: unfinished JSON output detecteddm_report: sort array allocation faileddm_report: Unable to allocate output linedm_report: Failed to extend row for field namedm_report: Failed to extend row with separatordm_report: Failed to terminate rowdm_report: dm_pool_begin_object failed for headingsdm_report: Could not allocate memory for heading buffer.dm_report: snprintf heading faileddm_report: Failed to generate report headings for printingdm_report: Unable to terminate output lineInternal error: _do_report_object: dm_report handler is NULL.Internal error: _do_report_object: output not requested and selected output variable is NULL too._do_report_object: no data assigned to field %s_do_report_object: report function failed for field %s_do_report_object: struct dm_report_field allocation failed_do_report_object: row sort value structure allocation failed_do_report_object: struct row allocation failedbuild_dm_name: Allocation failed for %zu for %s %s %s.Unrecognised selection field: %sSelection field is uncomparable: %s.Unrecognised comparison operator: %sOperator can be used only with string or string list fields: %sOperator can be used only with number, size, time or percent fields: %sOperator can be used only with time fields: %sFailed to parse regex value for selection field %s.Failed to parse string value for selection field %s.Invalid operator in selection list.List ended with incorrect character, expecting '%s'.Only one type of logical operator allowed in selection list at a time.Internal error: _tok_value_string_list: list has no items_tok_value_string_list: memory allocation failed for sort arrayFailed to parse string list value for selection field %s.Failed to parse numeric value for selection field %s.Found percent value but %s value expected for selection field %s.Found size unit specifier but %s value expected for selection field %s.Specified minutes out of range.Specified seconds out of range.Full date specification needed.Failed to parse time value for selection field %s.Internal error: _tok_value: Forbidden NULL custom parameter detected.Unable to create selection with field '%s' which is not included in current report.dm_report: incompatible comparison type for selection field %sInternal error: %s reserved value handler for field %s has missingimplementation of DM_REPORT_RESERVED_GET_DYNAMIC_VALUE actiondm_report: could not get reserved value while processing selection field %sdm_report: malloc failed to store regex value for selection field %sdm_report: failed to create regex matcher for selection field %sdm_report: malloc failed for regex array for selection field %sInternal error: _create_field_selection: regex: incorrect type %u for field %sString value %s found in selection is reserved.Numeric value %lu found in selection is reserved.Size value %f found in selection is reserved.Percent value %s found in selection is reserved.String list value found in selection is reserved.Time value found in selection is reserved.Internal error: _create_field_selection: incorrect type %u for field %sdm_report: struct field_selection_value allocation failed for selection field %sInternal error: _create_field_selection: Forbidden NULL custom detected.dm_report: struct selection_node allocation faileddm_report: dm_pool_strndup for value of selection field %sdm_report: struct field_selection allocation failed for selection field %sRegular expression expected for selection field %s_tok_value_string_list: memory allocation failed for selection list._tok_value_time: dm_pool_strndup failedtok_value_time: dm_pool_strndup failedMissing list end for selection field %sFailed to allocate report selection structure.Internal error: dm_report_init: definition of report types given contains reserved identifierdm_report_init: allocation of memory pool failed_canonicalize_field_ids: dm_pool_alloc failedInternal error: _check_reserved_values_supported: global reserved value for type 0x%x not supportedInternal error: _check_reserved_values_supported: field-specific reserved value of type 0x%x for field %s not supportedInternal error: dm_report_init_with_selection: trying to register unsupported reserved value type, skipping report selection_canonicalize_field_dup: dm_pool_alloc failed.no memory for size display bufferInternal error: Inconsistent units: %c and %c.Failed to parse invalid snapshot params.Failed to parse snapshot params: %s.Failed to allocate snapshot status structure. <#devices> and and Failed to parse %sraid params: %sSet if item passes selection criteria.Not matching regular expression. [regex]Equal to. [number, size, percent, string, string list, time]Not equal to. [number, size, percent, string, string_list, time]Greater than or equal to. [number, size, percent, time]Greater than. [number, size, percent, time]Less than or equal to. [number, size, percent, time]Less than. [number, size, percent, time]Since specified time (same as '>='). [time]After specified time (same as '>'). [time]Until specified time (same as '<='). [time]Before specified time (same as '<'). [time]ljBhBhiBh|i iBhBhliBhdiBhBhTiBh i|jiBhBhBhBhBhBhBhBhBhBhBhBhBhljBhBhiBhi iBhBhiBhiBhBhiBh i|jiҎxʎ Exabyte EBE Petabyte PBP Terabyte TBT Gigabyte GBG Megabyte MBM Kilobyte KBK Byte BB Exbibyte EiBe Pebibyte PiBp Tebibyte TiBt Gibibyte GiBg Mebibyte MiBm Kibibyte KiBk Byte Bb Exabyte EBE Petabyte PBP Terabyte TBT Gigabyte GBG Megabyte MBM Kilobyte kBK Byte B B Units UnU Sectors SeSFailed to parse string list value for selection field %s.Field selection value %s out of supported range for field %s.Use 'help' for selection to get more help.Selection syntax error at '%s'.Syntax error: right parenthesis expected at '%s'Syntax error: left parenthesis expected at '%s'_display_selection_help: dm_pool_grow_object failedC`?Y@.AWARNING: Unknown mirror health status char: %cOut of memory. Requested %zu bytes.(rx->type != OR) || (rx->left && rx->right)Failed to parse invalid thin params.Failed to parse thin pool params: %s.device_mapper/regex/parse_rx.cWARNING: Path %s/%s is too long.checking all pvid files using lookup file for %sWARNING: Failed to strdup vgname.Internal error: pool_free asked to free pointer not in pool %u %lu/%lu %u %lu/%lu %lu %lu %lu %lu %lu %lu %lu %dFailed to parse cache params: %sFailed to allocate thin_pool status structure.Failed to parse thin params: %s.Failed to allocate thin status structure.Internal error: More than 8 reported in mirror status.Allocation of log type string failed.Failed to parse mirror status %s.Failed to alloc mem pool to parse mirror status.missing ')' in regular expressiondevice_mapper/raid/raid_parser.cFailed to allocate RAID superblock bufferFailed to open RAID metadata volumeFailed to read RAID metadata volumeFailed to seek RAID metadata volumeFailed to clear RAID metadata volumeRegex charset allocation failedInternal error: Unknown calc node typedevice_mapper/vdo/vdo_reader.cFailed to open VDO backend %s.Found mismatching VDO magic header in %s.Expected geometry VDO block instead of block %u.Unsupported VDO version %u.%u.File/Device is shorter and can't provide requested VDO volume region at %lu > %lu.Unknown VDO component version %u.VDO metadata has mismatching VDO nonces %lu != %lu.VDO minimum io size %u is unsupported [512, 4096].device_mapper/vdo/vdo_target.cVDO block map cache size %u MiB is out of range [%u..%u].VDO block map era length %u is out of range [%u..%u].VDO index memory size %u MiB is out of range [%u..%u].VDO slab size %u MiB is out of range [%u..%u].VDO max discard %u is out of range [%u..%u].VDO ack threads %u is out of range [0..%u].VDO bio threads %u is out of range [%u..%u].VDO bio rotation %u is out of range [%u..%u].VDO cpu threads %u is out of range [%u..%u].VDO hash zone threads %u is out of range [0..%u].VDO logical threads %u is out of range [0..%u].VDO physical threads %u is out of range [0..%u].Internal error: VDO write policy %u is unknown.Value of vdo_hash_zone_threads(%u), vdo_logical_threads(%u), vdo_physical_threads(%u) must be all zero or all non-zero.VDO logical size is larger than limit %lu TiB by %lu KiB.Failed to allocate memory for hash.Failed to allocate slots for hash.Couldn't create memory pool %s (size %zu)./base/data-struct/radix-tree-adaptive.cFailed to allocate command contextFailed to allocate line buffer.LVM_SYSTEM_DIR environment variable is too long.Failed to create LVM2 system dir for metadata backups, config files and internal cache.Set environment variable LVM_SYSTEM_DIR to alternative location or empty string.Library memory pool creation failedCommand memory pool creation failedInternal error: Failed to parse command definitions.Volume group %s has active volume: %s.pvscan[%d] ignore %s with no lvm info.pvscan[%d] failed to create format instance.pvscan[%d] PV %s has no VG metadata.pvscan[%d] PV %s not found in VG %s.pvscan[%d] PV %s missing device size.pvscan[%d] ignore md component %s.pvscan[%d] PV %s ignore shared VG.pvscan[%d] PV %s ignore foreign VG.pvscan[%d] PV %s ignore exported VG.PV %s failed to create online file.pvscan[%d] PV %s failed to create online file.checking all pvid files from vg %srechecking all pvid files from vg %spvscan[%d] VG %s complete after recheck.checking all pvid files from lookup filepvscan[%d] PV %s online, VG unknown.PV %s online, VG %s incomplete (need %d).pvscan[%d] PV %s online, VG %s incomplete (need %d).PV %s online, VG %s is complete.pvscan[%d] PV %s online, VG %s is complete.Cannot list LVs from device without metadata.pvscan[%d] Cannot list LVs from device without metadata.pvscan[%d] Failed to find LVs using %s.pvscan[%d] Failed to check partial lvs.Ignore PV %s with VG system id %s with our system id %sMetadata input file is required.See --repairtype pv_header to repair headers.No metadata areas on device to repair.No metadata areas found on device.device_mapper/mm/pool-fast.cdevice_mapper/regex/matcher.ccouldn't get token for '%s'couldn't parse '%s'ErrorFail%lu %lu/%lu %lu/%lu%nout_of_data_spacero rewindignore lookup file line %swritethrough writeback passthrough metadata2 no_discard_passdown Unknown feature in status: %s ro needs_checkAllocation of devs failed.%u:%u %nAllocation of logs failed.userspaceBadly formed 'or' expressionNo RAID signature on %s.(.*(%s)%c)Parse error in regexCouldn't parse regexdevice_mapper/regex/ttree.cRegex optimisation errorout of memoryoperating modeindex statecompression stateused blockstotal blockstoo many tokenscouldn't get token for deviceioctlfstatbase/data-struct/hash.chead1->nn4 != NULLn16 != NULLn48 != NULLsetlocale failedsetvbuf/etc/lvmLVM_RUN_BY_DMEVENTDpending_deleteNo devices found.online_devs %s %signore %s with no lvm info.pvscan[%d] PV %s not used.PV %s has no VG metadata.PV %s not found in VG %s.PV %s missing device size.ignore md component %s.PV %s ignore shared VG.PV %s ignore foreign VG.PV %s ignore exported VG.pvscan[%d] PV %s online.VG %s complete after recheck.PV %s online, VG unknown.VG unknownVG %s finishedLVM_VG_NAME_COMPLETE='%s' VG %s completeLVM_VG_NAME_INCOMPLETE='%s' VG %s incompleteFailed to find LVs using %s.LV %s completeFailed to check partial lvs.LV %s incompleteNo lvm label found on device.No mda1 offset found.No mda2 offset found.@@x@@@@@@@@@@@@@̦ d((XX pzz@ p_degrade_to_n48_degrade_to_n16_degrade_to_n4dm_list_splicedmvdo001errorclosedopeningclosingofflineonlineunknownonlineofflinerecoveringread-onlynormal_fill_table0000000000000000request = %slabel_header at %llulabel_header.idlabel_header.id %slabel_header.sector %llulabel_header.crc 0x%xlabel_header.offset %ulabel_header.typelabel_header.type %sLABELONELVM2 001pv_header at %llupv_header.pv_uuidpv_header.pv_uuid %spv_header.device_size %llupv_header_extension at %llupv_header_extension.flags %uFile already exists.CHECK: second mda not foundInvalid metadata file.Reading labels for pvidmda_header.magicCHECK: no mem for printing %s wrappedprecommitPVSFFRSpecified %%%s is unknown.Size is too big (>=16EiB).Can't parse size argument.is only available with poolsis unsupported with cacheis supported only with cacheis unsupported with snapshotsis unsupported with mirrorsis unsupported with raidsis supported only with raidsis unsupported with thinsis supported only with thinsis unsupported with VDOsSetting logging type to %sUsing 2 stripes for %s.Using 3 stripes for %s.Setting chunksize to %s.No conversion is requested.%s device number not changed.Cannot deactivate %s.%s: reactivation failed.OO_ALL:DESC:AUTOTYPE:FLAGS:SECONDARY_SYNTAXPREVIOUS_SYNTAXRULE:lv_is_Cannot find command %s.Failed to duplicate name %s.Failed to duplicate line %s.OO_ALLlockd VG %s %slock_vgRetrying %s lock on VG %sVG %s lock failed: removedVG %s lock skipped: error %dVG %s lock failed: error %dlockd VG disabled %spositionlvmlockd is not in use.lvmlockd is not connected.busy_vg%s: field name too long.Missing end quote.Failed to create path %s%s/%s%s/%u/fd/%ufputsfflushCHECK: failed to read label_header at %lluCHECK: label_header.id expected %sCHECK: label_header.sector expected %dCHECK: label_header.crc expected 0x%xCHECK: label_header.offset expected 32CHECK: label_header.type expected %sCHECK: pv_header.pv_uuid invalid formatpv_header.disk_locn[%d] at %llu # location of data areapv_header.disk_locn[%d].offset %llupv_header.disk_locn[%d].size %llupv_header.disk_locn[%d] at %llu # location list endCHECK: problem with pv_header.disk_locn[%d] offset calculationpv_header.disk_locn[%d] at %llu # location of metadata areaWARNING: pv_header.disk_locn[%d].offset %llu is unexpected # for first mdapv_header_extension.version %upv_header_extension.disk_locn[%d] at %llu # bootloader areapv_header_extension.disk_locn[%d].offset %llupv_header_extension.disk_locn[%d].size %llupv_header_extension.disk_locn[%d] at %llu # location list endCHECK: problem with pv_header_extension offset calculationWARNING: Cannot get device size.Skipping mda2 (wrong mda_header.version)Skipping mda2 (no matching VG UUID in metadata area)Skipping mda2 (wrong mda_header.start)Found mda2 header at offset %llu size %lluWARNING: PV will have no metadata with zero metadata areas.WARNING: no previous metadata areas found on device.Should a metadata area be included? To repair with zero metadata areas, use --settings "mda_offset=0 mda_size=0".mda2_offset setting %llu does not match mda2_offset found on disk %llu.mda2_size setting %llu does not match mda2_size found on disk %llu.WARNING: device_size setting %llu bytes does not match device size %llu bytes.Metadata input file is needed for pv_header info.See pvck --dump to locate and create a metadata file.WARNING: existing PV UUID %s does not match pv_uuid setting %s.PV UUID %s not found in metadata file.PV UUID %s in existing pv_header not found in metadata file.PV name %s not found in metadata file.No valid PV UUID, specify a PV UUID from metadata in --settings.Scanning failed to get devices.Failed to scan devices to check PV UUID.Cannot use PV UUID %s which exists on %sWriting label_header.crc 0x%08x pv_header uuid %s device_size %lluWriting data_offset %llu mda1_offset %llu mda1_size %llu mda2_offset %llu mda2_size %llumda_header_%d.raw_locn[%d] at %llu # %s%smda_header_%d.raw_locn[%d].offset %llumda_header_%d.raw_locn[%d].size %llumda_header_%d.raw_locn[%d].checksum 0x%xmda_header_%d.raw_locn[%d].flags 0x%x # RAW_LOCN_IGNOREDmda_header_%d.raw_locn[%d].flags 0x%xCHECK: mda_header_%d.raw_locn[%d] for precommit not emptyCHECK: mda_header_%d.raw_locn[%d].size larger than metadata area sizePercentage is too big (>=%d%%).Multiple sign symbols detected.Size requires number argument.Can't parse size argument at '%c'.%s%sSize is not a multiple of 512. Try using %lu or %lu.Segment type %s cannot use pool %s.Logical volume %s already exists in Volume group %s.Persistent major and minor numbers are unsupported with pools.Ambiguous --readahead parameter specified. Please use either with pool or volume.Please specify name of existing pool.Pool %s not found in Volume group %s.Unable to create LV with unknown segment type %s.is unsupported with cache poolsCannot create read-only cache pool.Snapshot segment type is incompatible with thin pools.is unsupported with snapshots and --thinpoolSnapshot segment type requires size or extents.is supported only with sparse snapshotsis supported only with mirrorsPlease specify either size or pooldatasize.is supported only with thin pool creationThin segment type requires --virtualsize.Switching from thin to thin pool segment type.is unsupported with thin poolsCannot create read-only thin pool.is supported only with VDO pool creationis supported only with mirrors or raids--mirrors is supported only with mirrors or raidsis supported only with pools and snapshotsis supported only with vdo, sparse snapshots and thinsSegment type %s does not support --errorwhenfull.Please specify a logical volume to act as the cache pool or origin.Unsupported syntax, cannot use cache origin %s and --cachepool %s.The cache pool or cache origin name should include the volume group.Creation of cached volume and cache pool in one command is not yet supported.Please specify a logical volume to act as the snapshot origin.The origin name should include the volume group.Ambiguous %s name specified, %s and %s.The %s name should include the volume group.Please provide a volume group nameVolume group name expected (no slash)Logical volume name %s and pool name must be different.Volume group name %s has invalid charactersPlease specify either size or extents (not both).Please specify either size or extents.Dropping VDO pool header size to 0 to support maximal size %s.RAID10 currently supports only 2-way mirroring (i.e. '-m 1')--mirrors must be at least 1 with segment type %s.Redundant mirrors argument: default is 0Only up to %u stripes in %s supported currently.Only up to %u mirrors in %s supported currently.nosync option prohibited on RAID6.regionsize in configuration file is invalid.Please use only one of --corelog or --mirrorlog.Minimum of 2 stripes required for %s.Stripes argument cannot be used with segment type, %sMinimum of 3 stripes required for %s.Stripe size argument cannot be used with segment type, %sMirror argument cannot be used with segment type, %sAdjusting %s %s region size to required minimum of stripe size %s.Conflicting contiguous and alloc arguments.Unable to allocate memory for tag %s.WARNING: Logical volume %s is already not mirrored.Cannot convert logical volume %s with active component LV(s).Can't add mirror to out-of-sync mirrored LV: use lvchange --resync first.Can't add additional mirror images to mirror %s which is under snapshots.%s is already being converted. Unable to start another conversion.Failed to insert resync layer.ABORTING: Failed to remove temporary mirror layer %s.Manual cleanup with vgcfgrestore and dmsetup may be required.--trackchanges is not available to 'mirror' segment type.%sLogical Volume "%s" already exists in volume group "%s".Unable to split mirror %s that is not in-sync.Minor number is already not persistent for %s.Disabling persistent device number for %s.Logical volume %s will be deactivated temporarily. Continue? [y/n]: Setting persistent device number to (%d, %d) for %s.Re-activating logical volume %s.Parsing command defs: too many rules for cmd, increase CMD_MAX_RULES.Parsing command defs: too many cmd_rule options for cmd, increase MAX_RULE_OPTS.Parsing command defs: unknown lv property %s.Parsing command defs: invalid OO definition.Parsing command defs: no memory.Parsing command defs: can't process input line %s.WARNING: skipping VG lock in lvmlockd.VG %s lock skipped: lock start in progressVG %s lock failed: lock start in progressVG %s lock skipped: storage %s for sanlock leasesVG %s lock failed: storage %s for sanlock leasesVG %s lock skipped: held by other host.VG %s lock failed: held by other host.VG %s lock skipped: orphan lock needs to be adopted.VG %s lock failed: orphan lock needs to be adopted.VG %s lock skipped: adopt found no orphan.VG %s lock failed: adopt found no orphan.VG %s lock skipped: adopt found other mode.VG %s lock failed: adopt found other mode.VG %s lock skipped: lock manager error.VG %s lock failed: lock manager error.Duplicate sanlock global lock in VG %sOne LV position arg is required.VG name mismatch from %s arg (%s) and option arg (%s).Cannot find VG name for LV %s.Obtaining the complete list of VGs before processing their LVsCreating lvmlock LV for sanlock with size %um %llub %u extentsFailed to create sanlock lv %s in vg %s%s: lock type %s lvmlockd result %ddm_tree_node_add_null_area() called on an unsupported segment typeTest mode: Skipping creation of provisioned thin pool metadata.Cannot create temporary file to prepare metadata. Preparing thin-pool metadata with thin volume mapping: %sc0_busy_vgOO_ALL: --commandprofile String, --config String, --debug,--driverloaded Bool, --help, --nolocking, --lockopt String, --longhelp, --profile String, --quiet,--verbose, --version, --yes, --test, --devicesfile String, --devices PV, --nohints --journal StringOO_REPORTING: --configreport ConfigReport, --foreign,--ignorelockingfailure, --logonly, --readonly, --reportformat ReportFmt,--select String, --shared, --units UnitsOO_REPORT: OO_REPORTING, --all, --aligned, --binary,--headings HeadingsType, --nameprefixes, --noheadings,--nosuffix, --options String, --rows, --separator String,--sort String, --unbuffered, --unquotedOO_CONFIG: --atversion String, --typeconfig ConfigType, --file String, --ignoreadvanced,--ignoreunsupported, --ignorelocal, --list, --mergedconfig, --metadataprofile String,--sinceversion String, --showdeprecated, --showunsupported, --validate, --valuesonly,--withsummary, --withcomments, --withgeneralpreamble, --withlocalpreamble, --withspaces,--unconfigured, --withversionsOO_LVCHANGE: --autobackup Bool, --force, --ignoremonitoring,--noudevsync, --reportformat ReportFmt, --select StringOO_LVCHANGE_META: --addtag Tag, --deltag Tag,--alloc Alloc, --contiguous Bool,--compression Bool, --deduplication Bool,--detachprofile, --metadataprofile String,--permission Permission, --readahead Readahead, --setactivationskip Bool,--setautoactivation Bool, --errorwhenfull Bool, --discards Discards, --zero Bool,--cachemode CacheMode, --cachepolicy String, --cachesettings String,--minrecoveryrate SizeKB, --maxrecoveryrate SizeKB,--vdosettings String, --integritysettings String,--writebehind Number, --writemostly WriteMostlyPV, --persistent nlvchange OO_LVCHANGE_META VG|LV|Tag|Select ...OO: --activate Active, --poll Bool, --monitor Bool, OO_LVCHANGEIO: --ignoreskippedclusterID: lvchange_propertiesDESC: Change a general LV attribute.DESC: For options listed in parentheses, any one isDESC: required, after which the others are optional.RULE: all not lv_is_pvmove lv_is_mirror_log lv_is_mirror_imageRULE: all and lv_is_vg_writableRULE: --contiguous not --allocRULE: --profile not --detachprofileRULE: --metadataprofile not --detachprofileRULE: --minrecoveryrate --maxrecoveryrate and LV_raidRULE: --writebehind --writemostly and LV_raid1RULE: --cachemode --cachepolicy --cachesettings and LV_cache LV_cachepool LV_writecacheRULE: --errorwhenfull --discards --zero and LV_thinpoolRULE: --permission not lv_is_external_origin lv_is_raid_metadata lv_is_raid_image LV_thinpoolRULE: --alloc --contiguous --metadataprofile --persistent --profile --readahead not lv_is_thick_originRULE: --alloc --discards --zero --cachemode --cachepolicy --cachesettings not lv_is_partiallvchange --resync VG|LV_raid_mirror|Tag|Select ...OO: --activate Active, OO_LVCHANGEIO: --ignoreskippedclusterID: lvchange_resyncDESC: Resynchronize a mirror or raid LV.DESC: Use to reset 'R' attribute on a not initially synchronized LV.RULE: all not lv_is_pvmove lv_is_locked lv_is_raid_with_integrityRULE: all not LV_raid0lvchange --syncaction SyncAction VG|LV_raid|Tag|Select ...OO: OO_LVCHANGEIO: --ignoreskippedclusterID: lvchange_syncactionDESC: Resynchronize or check a raid LV.RULE: all not LV_raid0lvchange --rebuild PV VG|LV_raid|Tag|Select ...OO: OO_LVCHANGEIO: --ignoreskippedclusterID: lvchange_rebuildDESC: Reconstruct data on specific PVs of a raid LV.RULE: all not LV_raid0lvchange --activate Active VG|LV|Tag|Select ...OO: --activationmode ActivationMode, --partial, --poll Bool, --monitor Bool,--ignoreactivationskip, --ignorelockingfailure, --sysinit, --readonly, OO_LVCHANGEIO: --ignoreskippedclusterID: lvchange_activateDESC: Activate or deactivate an LV.lvchange --refresh VG|LV|Tag|Select ...OO: --activationmode ActivationMode, --partial, --poll Bool, --monitor Bool, OO_LVCHANGEIO: --ignoreskippedclusterID: lvchange_refreshDESC: Reactivate an LV using the latest metadata.lvchange --monitor Bool VG|LV|Tag|Select ...OO: OO_LVCHANGEIO: --ignoreskippedclusterID: lvchange_monitorDESC: Start or stop monitoring an LV from dmeventd.RULE: all not lv_is_pvmovelvchange --poll Bool VG|LV|Tag|Select ...OO: --monitor Bool, OO_LVCHANGEIO: --ignoreskippedclusterID: lvchange_pollDESC: Start or stop processing an LV conversion.lvchange --persistent y --minor Number LVOO: --major Number, --activate Active, --poll Bool, --monitor Bool, OO_LVCHANGEIO: --ignoreskippedclusterID: lvchange_persistentDESC: Make the minor device number persistent for an LV.RULE: all not LV_thinpool LV_cachepool LV_vdopoolOO_LVCONVERT_POOL: --chunksize SizeKB, --poolmetadata LV,--poolmetadatasize SizeMB, --poolmetadataspare Bool, --metadataprofile String,--readahead Readahead, --wipesignatures Bool, --zero BoolOO_LVCONVERT_CACHE: --cachemetadataformat CacheMetadataFormat,--cachemode CacheMode, --cachepolicy String,--cachesettings String, --zero BoolOO_LVCONVERT_VDO: --compression Bool, --deduplication Bool, --vdosettings StringOO_LVCONVERT_VDO_POOL: OO_LVCONVERT_VDO, --metadataprofile String,--readahead Readahead, --wipesignatures Bool, --zero BoolOO_LVCONVERT_THINPOOL: --discards Discards, --errorwhenfull Bool, --pooldatavdo Bool,OO_LVCONVERT_VDO, OO_LVCONVERT_POOLOO_LVCONVERT: --alloc Alloc, --background, --force, --noudevsynclvconvert --type linear LVOO: OO_LVCONVERTOP: PV ...ID: lvconvert_raid_typesDESC: Convert LV to linear.RULE: all not lv_is_locked lv_is_pvmovelvconvert --type striped LVOO: --stripes_long Number, --stripesize SizeKB, --regionsize RegionSize, --interval Number, OO_LVCONVERTOP: PV ...ID: lvconvert_raid_typesDESC: Convert LV to striped.RULE: all not lv_is_locked lv_is_pvmovelvconvert --type mirror LVOO: --mirrors SNumber, --stripes_long Number, --stripesize SizeKB, --regionsize RegionSize, --interval Number, --mirrorlog MirrorLog, OO_LVCONVERTOP: PV ...ID: lvconvert_raid_typesDESC: Convert LV to type mirror (also see type raid1),RULE: all not lv_is_locked lv_is_pvmovelvconvert --type raid LVOO: --mirrors SNumber, --stripes_long Number, --stripesize SizeKB, --regionsize RegionSize, --interval Number, OO_LVCONVERTOP: PV ...ID: lvconvert_raid_typesDESC: Convert LV to raid or change raid layoutDESC: (a specific raid level must be used, e.g. raid1).RULE: all not lv_is_locked lv_is_pvmoveRULE: lv_is_raid_with_integrity not --stripes_long --stripesize --regionsize --intervallvconvert --mirrors SNumber LVOO: --regionsize RegionSize, --interval Number, --mirrorlog MirrorLog, OO_LVCONVERTOP: PV ...ID: lvconvert_raid_typesDESC: Convert LV to raid1 or mirror, or change number of mirror images.RULE: all not lv_is_locked lv_is_pvmovelvconvert --stripes_long Number LV_raidOO: OO_LVCONVERT, --interval Number, --regionsize RegionSize, --stripesize SizeKBOP: PV ...ID: lvconvert_raid_typesDESC: Convert raid LV to change number of stripe images.RULE: all not lv_is_locked lv_is_pvmove lv_is_raid_with_integrityRULE: all not LV_raid0 LV_raid1lvconvert --stripesize SizeKB LV_raidOO: OO_LVCONVERT, --interval Number, --regionsize RegionSizeID: lvconvert_raid_typesDESC: Convert raid LV to change the stripe size.RULE: all not lv_is_locked lv_is_pvmove lv_is_raid_with_integrityRULE: all not LV_raid0 LV_raid1lvconvert --regionsize RegionSize LV_raidOO: OO_LVCONVERTID: lvconvert_change_region_sizeDESC: Change the region size of an LV.RULE: all not lv_is_locked lv_is_pvmove lv_is_raid_with_integrityRULE: all not LV_raid0FLAGS: SECONDARY_SYNTAXlvconvert --splitmirrors Number --name LV_new LV_raid1_mirror_cacheOO: OO_LVCONVERTOP: PV ...ID: lvconvert_split_mirror_imagesDESC: Split images from a raid1 or mirror LV and use them to create a new LV.RULE: all not lv_is_locked lv_is_pvmove lv_is_raid_with_integritylvconvert --splitmirrors Number --trackchanges LV_raid1_cacheOO: OO_LVCONVERTOP: PV ...ID: lvconvert_split_mirror_imagesDESC: Split images from a raid1 LV and track changes to origin for later merge.RULE: all not lv_is_locked lv_is_pvmove lv_is_raid_with_integritylvconvert --mergemirrors LV_linear_raid|VG|Tag ...OO: OO_LVCONVERTID: lvconvert_merge_mirror_imagesDESC: Merge LV images that were split from a raid1 LV.RULE: all not lv_is_locked lv_is_pvmove lv_is_merging_origin lv_is_virtual_origin lv_is_external_origin lv_is_merging_cow lv_is_raid_with_integritylvconvert --mirrorlog MirrorLog LV_mirrorOO: OO_LVCONVERTOP: PV ...ID: lvconvert_change_mirrorlogDESC: Change the type of mirror log used by a mirror LV.RULE: all not lv_is_locked lv_is_pvmoveFLAGS: SECONDARY_SYNTAXlvconvert --type thin --thinpool LV LV_linear_striped_raid_cache_thin_error_zeroOO: --thin, --originname LV_new, OO_LVCONVERT_POOL, OO_LVCONVERTOP: PV ...ID: lvconvert_to_thin_with_externalDESC: Convert LV to a thin LV, using the original LV as an external origin.RULE: all and lv_is_visibleRULE: all not lv_is_locked lv_is_raid_with_integrityRULE: --poolmetadata not --readahead --stripesize --stripes_longlvconvert --thin --thinpool LV LV_linear_striped_raid_cache_thin_error_zeroOO: --originname LV_new, OO_LVCONVERT_POOL, OO_LVCONVERTOP: PV ...ID: lvconvert_to_thin_with_externalDESC: Convert LV to a thin LV, using the original LV as an external origin.FLAGS: SECONDARY_SYNTAXAUTOTYPE: thinRULE: all and lv_is_visibleRULE: all not lv_is_locked lv_is_raid_with_integrityRULE: --poolmetadata not --readahead --stripesize --stripes_longlvconvert --type thin LV_linear_striped_raid_cache_writecache_vdo_error_zeroOO: --thin, OO_LVCONVERT_POOL, OO_LVCONVERTOP: PV ...ID: lvconvert_to_thin_with_dataDESC: Convert LV to a thin LV, using LV as thin-pool data volume.RULE: all and lv_is_visibleRULE: all not lv_is_locked lv_is_origin lv_is_merging_origin lv_is_external_origin lv_is_raid_with_integrityRULE: --poolmetadata not --readahead --stripesize --stripes_longlvconvert --thin LV_linear_striped_raid_cache_writecache_vdo_error_zeroOO: OO_LVCONVERT_POOL, OO_LVCONVERTOP: PV ...ID: lvconvert_to_thin_with_dataDESC: Convert LV to a thin LV, using LV as thin-pool data volume.FLAGS: SECONDARY_SYNTAXAUTOTYPE: thinRULE: all and lv_is_visibleRULE: all not lv_is_locked lv_is_origin lv_is_merging_origin lv_is_external_origin lv_is_raid_with_integrityRULE: --poolmetadata not --readahead --stripesize --stripes_longlvconvert --type cache --cachepool LV LV_linear_striped_raid_thinpool_thinpooldata_vdo_vdopool_vdopooldata_thin_error_zeroOO: --cache, OO_LVCONVERT_CACHE, OO_LVCONVERT_POOL, OO_LVCONVERTOP: PV ...ID: lvconvert_to_cache_with_cachepoolDESC: Attach a cache pool to an LV, converts the LV to type cache.RULE: all not lv_is_locked lv_is_merging_origin lv_is_merging_cow lv_is_cowRULE: --poolmetadata not --readahead --stripesize --stripes_longlvconvert --cache --cachepool LV LV_linear_striped_raid_thinpool_vdo_vdopool_vdopooldata_thin_error_zeroOO: OO_LVCONVERT_CACHE, OO_LVCONVERT_POOL, OO_LVCONVERTOP: PV ...ID: lvconvert_to_cache_with_cachepoolDESC: Attach a cache pool to an LV.RULE: all not lv_is_locked lv_is_merging_origin lv_is_merging_cow lv_is_cowRULE: --poolmetadata not --readahead --stripesize --stripes_longFLAGS: SECONDARY_SYNTAXAUTOTYPE: cachelvconvert --type writecache --cachevol LV LV_linear_striped_raid_thinpoolOO: OO_LVCONVERT, --cachesettings StringID: lvconvert_to_writecacheDESC: Attach a writecache to an LV, converts the LV to type writecache.RULE: all and lv_is_visiblelvconvert --type cache --cachevol LV LV_linear_striped_raid_thinpoolOO: --cache, OO_LVCONVERT_CACHE, OO_LVCONVERT, --poolmetadatasize SizeMB, --chunksize SizeKBID: lvconvert_to_cache_with_cachevolDESC: Attach a cache to an LV, converts the LV to type cache.RULE: all and lv_is_visiblelvconvert --cache --cachevol LV LV_linear_striped_raid_thinpoolOO: OO_LVCONVERT_CACHE, OO_LVCONVERT, --poolmetadatasize SizeMB, --chunksize SizeKBID: lvconvert_to_cache_with_cachevolDESC: Attach a cache to an LV, converts the LV to type cache.RULE: all and lv_is_visibleFLAGS: SECONDARY_SYNTAXlvconvert --type writecache --cachedevice PV LV_linear_striped_raid_thinpoolOO: OO_LVCONVERT, --cachesize SizeMB, --cachesettings StringID: lvconvert_to_writecache_with_deviceDESC: Add a writecache to an LV, using a specified cache device.RULE: all and lv_is_visiblelvconvert --type cache --cachedevice PV LV_linear_striped_raid_thinpoolOO: OO_LVCONVERT, --cachesize SizeMB, --cachesettings String, --chunksize SizeKBID: lvconvert_to_cache_with_deviceDESC: Add a cache to an LV, using a specified cache device.RULE: all and lv_is_visiblelvconvert --type thin-pool LV_linear_striped_raid_cache_writecache_vdo_error_zeroOO: --stripes_long Number, --stripesize SizeKB,OO_LVCONVERT_THINPOOL, OO_LVCONVERTOP: PV ...ID: lvconvert_to_thinpoolDESC: Convert LV to type thin-pool (existing data on LV will be erased).RULE: all and lv_is_visibleRULE: all not lv_is_locked lv_is_origin lv_is_merging_origin lv_is_external_origin lv_is_raid_with_integrityRULE: --poolmetadata not --readahead --stripesize --stripes_longlvconvert --thinpool LV_linear_striped_raid_cache_writecache_vdo_error_zero_thinpoolOO: --stripes_long Number, --stripesize SizeKB,OO_LVCONVERT_THINPOOL, OO_LVCONVERTOP: PV ...ID: lvconvert_to_thinpool_or_swap_metadataDESC: Convert LV to type thin-pool (variant, use --type thin-pool).DESC: Swap metadata LV in a thin pool (variant, use --swapmetadata).FLAGS: PREVIOUS_SYNTAXRULE: all and lv_is_visibleRULE: all not lv_is_raid_with_integrityRULE: --poolmetadata not --readahead --stripesize --stripes_longAUTOTYPE: thin-poollvconvert --type cache-pool LV_linear_striped_raid_error_zeroOO: OO_LVCONVERT_CACHE, OO_LVCONVERT_POOL, OO_LVCONVERTOP: PV ...ID: lvconvert_to_cachepoolDESC: Convert LV to type cache-pool (existing data on LV will be erased).RULE: --poolmetadata not --readahead --stripesize --stripes_longRULE: all not lv_is_raid_with_integritylvconvert --cachepool LV_linear_striped_raid_cachepool_error_zeroOO: --type cache-pool, OO_LVCONVERT_CACHE, OO_LVCONVERT_POOL, OO_LVCONVERTOP: PV ...ID: lvconvert_to_cachepool_or_swap_metadataDESC: Convert LV to type cache-pool (variant: use --type cache-pool,DESC: existing data on LV will be erased).DESC: Swap metadata LV in a cache pool (variant: use --swapmetadata).FLAGS: PREVIOUS_SYNTAXRULE: all and lv_is_visibleRULE: all not lv_is_raid_with_integrityRULE: --poolmetadata not --readahead --stripesize --stripes_longlvconvert --type vdo-pool LV_linear_striped_raid_cacheOO: --name LV_new, --virtualsize SizeMB, OO_LVCONVERT_VDO_POOL, OO_LVCONVERTID: lvconvert_to_vdopoolDESC: Convert LV to type vdopool (existing data on LV will be erased).RULE: all and lv_is_visible lv_is_writableRULE: all not lv_is_locked lv_is_origin lv_is_merging_origin lv_is_external_origin lv_is_virtual lv_is_raid_with_integritylvconvert --vdopool LV_linear_striped_raid_cacheOO: --name LV_new, --virtualsize SizeMB, OO_LVCONVERT_VDO_POOL, OO_LVCONVERTID: lvconvert_to_vdopool_paramDESC: Convert LV to type vdopool (variant: use --type vdo-pool,DESC: existing data on LV will be erased).RULE: all and lv_is_visible lv_is_writableRULE: all not lv_is_locked lv_is_origin lv_is_merging_origin lv_is_external_origin lv_is_virtual lv_is_raid_with_integrityFLAGS: SECONDARY_SYNTAXAUTOTYPE: vdo-poollvconvert --splitcache LV_cachepool_cache_thinpool_vdopool_writecacheOO: OO_LVCONVERT, --cachesettings StringID: lvconvert_split_and_keep_cacheDESC: Detach a cache from an LV.lvconvert --uncache LV_cache_thinpool_vdopool_writecacheOO: OO_LVCONVERT, --cachesettings StringID: lvconvert_split_and_remove_cacheDESC: Detach and delete a cache from an LV.FLAGS: SECONDARY_SYNTAXlvconvert --swapmetadata --poolmetadata LV LV_thinpool_cachepoolOO: --chunksize SizeKB, OO_LVCONVERTID: lvconvert_swap_pool_metadataDESC: Swap metadata LV in a thin pool or cache pool (for repair only).FLAGS: SECONDARY_SYNTAXlvconvert --merge LV_linear_striped_raid_thin_snapshot|VG|Tag ...OO: --background, --interval Number, OO_LVCONVERTID: lvconvert_mergeDESC: Merge LV that was split from a mirror (variant, use --mergemirrors).DESC: Merge thin LV into its origin LV (variant, use --mergethin).DESC: Merge COW snapshot LV into its origin (variant, use --mergesnapshot).RULE: all not lv_is_locked lv_is_pvmove lv_is_merging_origin lv_is_virtual_origin lv_is_external_origin lv_is_merging_cowFLAGS: SECONDARY_SYNTAXlvconvert --mergethin LV_thin ...OO: OO_LVCONVERTID: lvconvert_merge_thinDESC: Merge thin LV into its origin LV.RULE: all not lv_is_locked lv_is_pvmove lv_is_merging_origin lv_is_virtual_origin lv_is_external_origin lv_is_merging_cowRULE: all and lv_is_visiblelvconvert --mergesnapshot LV_snapshot ...OO: --background, --interval Number, OO_LVCONVERTID: lvconvert_merge_snapshotDESC: Merge COW snapshot LV into its origin.RULE: all not lv_is_locked lv_is_pvmove lv_is_merging_origin lv_is_virtual_origin lv_is_external_origin lv_is_merging_cowRULE: all and lv_is_visiblelvconvert --splitsnapshot LV_snapshotOO: OO_LVCONVERTID: lvconvert_split_cow_snapshotDESC: Separate a COW snapshot from its origin LV.RULE: all not lv_is_locked lv_is_pvmove lv_is_origin lv_is_external_origin lv_is_merging_cowFLAGS: SECONDARY_SYNTAXlvconvert --type snapshot LV LV_linear_stripedOO: --snapshot, --chunksize SizeKB, --zero Bool, OO_LVCONVERTID: lvconvert_combine_split_snapshotDESC: Combine a former COW snapshot (second arg) with a formerDESC: origin LV (first arg) to reverse a splitsnapshot command.RULE: all not lv_is_locked lv_is_pvmoveRULE: all and lv_is_visiblelvconvert --snapshot LV LV_linear_stripedOO: --chunksize SizeKB, --zero Bool, OO_LVCONVERTID: lvconvert_combine_split_snapshotDESC: Combine a former COW snapshot (second arg) with a formerDESC: origin LV (first arg) to reverse a splitsnapshot command.RULE: all not lv_is_locked lv_is_pvmoveRULE: all and lv_is_visibleFLAGS: SECONDARY_SYNTAXAUTOTYPE: snapshotlvconvert --repair LV_cache_cachepool_mirror_raid_thinpoolOO: --usepolicies, --interval Number, --setactivationskip Bool, --poolmetadataspare Bool, OO_LVCONVERTOP: PV ...ID: lvconvert_repairDESC: Replace failed PVs in a raid or mirror LV.DESC: Repair a thin pool.DESC: Repair a cache pool.RULE: all not lv_is_locked lv_is_pvmoveRULE: --poolmetadataspare and LV_cache LV_cachepool LV_thinpoolRULE: --setactivationskip and LV_cache LV_cachepool LV_thinpoollvconvert --replace PV LV_raidOO: OO_LVCONVERTOP: PV ...ID: lvconvert_replace_pvDESC: Replace specific PV(s) in a raid LV with another PV.RULE: all not lv_is_locked lv_is_pvmovelvconvert --startpoll LV_mirror_raidOO: OO_LVCONVERTID: lvconvert_start_pollDESC: Poll LV to continue conversion.RULE: all and lv_is_convertinglvconvert LV_mirror_raidOO: OO_LVCONVERTID: lvconvert_plainDESC: Poll LV to continue conversion (also see --startpoll)DESC: or waits till conversion/mirror syncing is finishedFLAGS: SECONDARY_SYNTAXlvconvert --raidintegrity Bool LV_raidOO: --raidintegritymode String, --raidintegrityblocksize Number, --integritysettings String, OO_LVCONVERTOP: PV ...ID: lvconvert_integrityDESC: Add or remove data integrity checksums to raid images.OO_LVCREATE: --addtag Tag, --alloc Alloc, --autobackup Bool, --activate Active,--contiguous Bool, --ignoreactivationskip, --ignoremonitoring, --major Number,--metadataprofile String, --minor Number, --monitor Bool, --name String, --nosync,--noudevsync, --permission Permission, --persistent Bool, --readahead Readahead,--reportformat ReportFmt, --setactivationskip Bool, --wipesignatures Bool,--zero Bool, --setautoactivation BoolOO_LVCREATE_CACHE: --cachemode CacheMode, --cachepolicy String, --cachesettings String,--chunksize SizeKB, --cachemetadataformat CacheMetadataFormatOO_LVCREATE_POOL: --poolmetadatasize SizeMB, --poolmetadataspare Bool, --chunksize SizeKBOO_LVCREATE_VDO: --compression Bool, --deduplication Bool, --vdosettings StringOO_LVCREATE_THINPOOL: --discards Discards, --errorwhenfull Bool, --pooldatavdo Bool, OO_LVCREATE_VDO, OO_LVCREATE_POOLOO_LVCREATE_RAID: --regionsize RegionSize, --minrecoveryrate SizeKB, --maxrecoveryrate SizeKB,--raidintegrity Bool, --raidintegritymode String, --raidintegrityblocksize Number, --integritysettings Stringlvcreate --type error --size SizeMB VGOO: OO_LVCREATEID: lvcreate_error_volDESC: Create an LV that returns errors when used.FLAGS: SECONDARY_SYNTAXlvcreate --type zero --size SizeMB VGOO: OO_LVCREATEID: lvcreate_zero_volDESC: Create an LV that returns zeros when read.FLAGS: SECONDARY_SYNTAXlvcreate --type linear --size SizeMB VGOO: OO_LVCREATEOP: PV ...IO: --mirrors 0, --stripes 1ID: lvcreate_linearDESC: Create a linear LV.FLAGS: SECONDARY_SYNTAXlvcreate --size SizeMB VGOO: OO_LVCREATEOP: PV ...IO: --mirrors 0, --stripes 1ID: lvcreate_linearDESC: Create a linear LV.AUTOTYPE: linearlvcreate --type striped --size SizeMB VGOO: --stripes Number, --stripesize SizeKB, OO_LVCREATEOP: PV ...ID: lvcreate_stripedDESC: Create a striped LV (also see lvcreate --stripes).FLAGS: SECONDARY_SYNTAXlvcreate --stripes Number --size SizeMB VGOO: --stripesize SizeKB, OO_LVCREATEOP: PV ...ID: lvcreate_stripedDESC: Create a striped LV.AUTOTYPE: stripedlvcreate --type mirror --size SizeMB VGOO: --stripes Number, --stripesize SizeKB,--mirrors PNumber, --mirrorlog MirrorLog, --regionsize RegionSize, OO_LVCREATEOP: PV ...ID: lvcreate_mirrorDESC: Create a mirror LV (also see --type raid1).FLAGS: SECONDARY_SYNTAXlvcreate --mirrors PNumber --size SizeMB VGOO: --stripesize SizeKB, --mirrorlog MirrorLog, OO_LVCREATE_RAID, OO_LVCREATEOP: PV ...IO: --stripes 1ID: lvcreate_mirror_or_raid1DESC: Create a raid1 or mirror LV.DESC: Implicit type is defined by lvm.conf global/mirror_segfault_default.AUTOTYPE: raid1AUTOTYPE: mirrorlvcreate --type raid --size SizeMB VGOO: --mirrors PNumber, --stripes Number, --stripesize SizeKB,OO_LVCREATE_RAID, OO_LVCREATEOP: PV ...ID: lvcreate_raid_anyDESC: Create a raid LV (a specific raid level must be used, e.g. raid1).lvcreate --mirrors PNumber --stripes Number --size SizeMB VGOO: --stripesize SizeKB, OO_LVCREATE_RAID, OO_LVCREATEOP: PV ...ID: lvcreate_raid_anyDESC: Create a raid10 LV.AUTOTYPE: raid10lvcreate --type snapshot --size SizeMB LVOO: --snapshot, --stripes Number, --stripesize SizeKB,--chunksize SizeKB, OO_LVCREATEOP: PV ...ID: lvcreate_cow_snapshotDESC: Create a COW snapshot LV of an origin LVDESC: (also see --snapshot).FLAGS: SECONDARY_SYNTAXlvcreate --snapshot --size SizeMB LVOO: --stripes Number, --stripesize SizeKB,--chunksize SizeKB, OO_LVCREATEOP: PV ...ID: lvcreate_cow_snapshotDESC: Create a COW snapshot LV of an origin LV.AUTOTYPE: snapshotlvcreate --type snapshot --size SizeMB --virtualsize SizeMB VGOO: --snapshot, --chunksize SizeKB, OO_LVCREATEOP: PV ...ID: lvcreate_cow_snapshot_with_virtual_originDESC: Create a sparse COW snapshot LV of a virtual origin LVDESC: (also see --snapshot).FLAGS: SECONDARY_SYNTAXlvcreate --type thin-pool --size SizeMB VGOO: --thinpool LV_new, --stripes Number, --stripesize SizeKB,--thin, OO_LVCREATE_THINPOOL, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_thinpoolDESC: Create a thin pool.lvcreate --thin --size SizeMB VGOO: --stripes Number, --stripesize SizeKB, OO_LVCREATE_THINPOOL, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_thinpoolDESC: Create a thin pool.FLAGS: SECONDARY_SYNTAXAUTOTYPE: thin-poollvcreate --size SizeMB --thinpool LV_new VGOO: --stripes Number, --stripesize SizeKB,--thin, OO_LVCREATE_THINPOOL, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_thinpoolDESC: Create a thin pool named in --thinpool.FLAGS: SECONDARY_SYNTAXAUTOTYPE: thin-poollvcreate --type cache-pool --size SizeMB VGOO: --stripes Number, --stripesize SizeKB,--cache, OO_LVCREATE_CACHE, OO_LVCREATE_POOL, OO_LVCREATEOP: PV ...ID: lvcreate_cachepoolDESC: Create a cache pool.lvcreate --type cache-pool --size SizeMB --cachepool LV_new VGOO: --stripes Number, --stripesize SizeKB,--cache, OO_LVCREATE_CACHE, OO_LVCREATE_POOL, OO_LVCREATEOP: PV ...ID: lvcreate_cachepoolDESC: Create a cache pool named by the --cachepool argDESC: (variant, uses --cachepool in place of --name).FLAGS: SECONDARY_SYNTAXlvcreate --type thin --virtualsize SizeMB --thinpool LV_thinpool VGOO: --thin, OO_LVCREATEIO: --mirrors 0ID: lvcreate_thin_volDESC: Create a thin LV in a thin pool.FLAGS: SECONDARY_SYNTAXlvcreate --type thin --virtualsize SizeMB LV_thinpoolOO: --thin, OO_LVCREATEIO: --mirrors 0ID: lvcreate_thin_volDESC: Create a thin LV in a thin pool named in the first argDESC: (variant, also see --thinpool for naming pool).FLAGS: SECONDARY_SYNTAXlvcreate --virtualsize SizeMB --thinpool LV_thinpool VGOO: --thin, OO_LVCREATEIO: --mirrors 0ID: lvcreate_thin_volDESC: Create a thin LV in a thin pool.AUTOTYPE: thinlvcreate --virtualsize SizeMB LV_thinpoolOO: --thin, OO_LVCREATEIO: --mirrors 0ID: lvcreate_thin_volDESC: Create a thin LV in the thin pool named in the first argDESC: (also see --thinpool for naming pool.)FLAGS: SECONDARY_SYNTAXAUTOTYPE: thinlvcreate --type thin LV_thinOO: --thin, --snapshot, OO_LVCREATEIO: --mirrors 0ID: lvcreate_thin_snapshotDESC: Create a thin LV that is a snapshot of an existing thin LV.FLAGS: SECONDARY_SYNTAXlvcreate --thin LV_thinOO: --snapshot, OO_LVCREATEIO: --mirrors 0ID: lvcreate_thin_snapshotDESC: Create a thin LV that is a snapshot of an existing thin LV.FLAGS: SECONDARY_SYNTAXAUTOTYPE: thinlvcreate --snapshot LV_thinOO: OO_LVCREATEIO: --mirrors 0ID: lvcreate_thin_snapshotDESC: Create a thin LV that is a snapshot of an existing thin LV.AUTOTYPE: thinlvcreate --type thin --thinpool LV_thinpool LVOO: --thin, OO_LVCREATEIO: --mirrors 0ID: lvcreate_thin_snapshot_of_externalDESC: Create a thin LV that is a snapshot of an external origin LV.lvcreate --snapshot --thinpool LV_thinpool LVOO: OO_LVCREATEIO: --mirrors 0ID: lvcreate_thin_snapshot_of_externalDESC: Create a thin LV that is a snapshot of an external origin LV.FLAGS: SECONDARY_SYNTAXAUTOTYPE: thinlvcreate --type vdo --size SizeMB VGOO: --stripes Number, --stripesize SizeKB,--vdo, --virtualsize SizeMB, --vdopool LV_new, OO_LVCREATE_VDO, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_vdo_volDESC: Create a LV that returns VDO when used.lvcreate --vdo --size SizeMB VGOO: --stripes Number, --stripesize SizeKB,--virtualsize SizeMB, --vdopool LV_new, OO_LVCREATE_VDO, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_vdo_volDESC: Create a VDO LV with VDO pool.FLAGS: SECONDARY_SYNTAXAUTOTYPE: vdolvcreate --vdopool LV_new --size SizeMB VGOO: --stripes Number, --stripesize SizeKB,--virtualsize SizeMB, OO_LVCREATE_VDO, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_vdo_volDESC: Create a VDO LV with VDO pool.FLAGS: SECONDARY_SYNTAXAUTOTYPE: vdolvcreate --type thin --virtualsize SizeMB --size SizeMB --thinpool LV_new VGOO: --stripes Number, --stripesize SizeKB,--thin, OO_LVCREATE_THINPOOL, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_thin_vol_and_thinpoolDESC: Create a thin LV, first creating a thin pool for it,DESC: where the new thin pool is named by the --thinpool arg.FLAGS: SECONDARY_SYNTAXlvcreate --virtualsize SizeMB --size SizeMB --thinpool LV_new VGOO: --stripes Number, --stripesize SizeKB,--thin, OO_LVCREATE_THINPOOL, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_thin_vol_and_thinpoolDESC: Create a thin LV, first creating a thin pool for it,DESC: where the new thin pool is named by --thinpool.FLAGS: SECONDARY_SYNTAXAUTOTYPE: thinlvcreate --type thin --virtualsize SizeMB --size SizeMB LV_new|VGOO: --stripes Number, --stripesize SizeKB,--thin, OO_LVCREATE_THINPOOL, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_thin_vol_and_thinpoolDESC: Create a thin LV, first creating a thin pool for it,DESC: where the new thin pool is named in the first arg,DESC: or the new thin pool name is generated when the firstDESC: arg is a VG name.FLAGS: SECONDARY_SYNTAXlvcreate --thin --virtualsize SizeMB --size SizeMB LV_new|VGOO: --stripes Number, --stripesize SizeKB,OO_LVCREATE_THINPOOL, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_thin_vol_and_thinpoolDESC: Create a thin LV, first creating a thin pool for it,DESC: where the new thin pool is named in the first arg,DESC: or the new thin pool name is generated when the firstDESC: arg is a VG name.FLAGS: SECONDARY_SYNTAXAUTOTYPE: thinlvcreate --size SizeMB --virtualsize SizeMB VGOO: --stripes Number, --stripesize SizeKB, --snapshot, --thin,OO_LVCREATE_THINPOOL, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_thin_vol_with_thinpool_or_sparse_snapshotDESC: Create a thin LV, first creating a thin pool for it.DESC: Create a sparse snapshot of a virtual origin LVDESC: Chooses type thin or snapshot according toDESC: config setting sparse_segtype_default.FLAGS: SECONDARY_SYNTAXAUTOTYPE: thinAUTOTYPE: snapshotlvcreate --type cache --size SizeMB --cachepool LV_cachepool VGOO: --stripes Number, --stripesize SizeKB,--cache, OO_LVCREATE_CACHE, OO_LVCREATE_POOL, OO_LVCREATEOP: PV ...ID: lvcreate_and_attach_cachepoolDESC: Create a new LV, then attach the specified cachepoolDESC: which converts the new LV to type cache.lvcreate --size SizeMB --cachepool LV_cachepool VGOO: --stripes Number, --stripesize SizeKB,--cache, OO_LVCREATE_CACHE, OO_LVCREATEOP: PV ...ID: lvcreate_and_attach_cachepool_v2DESC: Create a new LV, then attach the specified cachepoolDESC: which converts the new LV to type cache.FLAGS: SECONDARY_SYNTAXAUTOTYPE: cachelvcreate --type cache --size SizeMB LV_cachepoolOO: --stripes Number, --stripesize SizeKB,--cache, OO_LVCREATE_CACHE, OO_LVCREATE_POOL, OO_LVCREATEOP: PV ...ID: lvcreate_and_attach_cachepool_v3DESC: Create a new LV, then attach the specified cachepoolDESC: which converts the new LV to type cache.DESC: (variant, also use --cachepool).FLAGS: SECONDARY_SYNTAXlvcreate --cache --size SizeMB LVOO: OO_LVCREATE_CACHE, OO_LVCREATE_POOL, OO_LVCREATE,--stripes Number, --stripesize SizeKBOP: PV ...ID: lvcreate_new_plus_old_cachepool_or_lvconvert_old_plus_new_cachepoolDESC: When the LV arg is a cachepool, then create a new LV andDESC: attach the cachepool arg to it.DESC: (variant, use --type cache and --cachepool.)DESC: When the LV arg is not a cachepool, then create a new cachepoolDESC: and attach it to the LV arg (alternative, use lvconvert.)FLAGS: SECONDARY_SYNTAXAUTOTYPE: cachelvcreate --type cache --size SizeMB --cachevol LV VGOO: --stripes Number, --stripesize SizeKB, OO_LVCREATE_CACHE, OO_LVCREATEOP: PV ...ID: lvcreate_and_attach_cachevol_for_cacheDESC: Create a new LV, then attach the specified cachevolDESC: which converts the new LV to type cache.lvcreate --type cache --size SizeMB --cachedevice PV VGOO: --stripes Number, --stripesize SizeKB,--cachesize SizeMB, OO_LVCREATE_CACHE, OO_LVCREATEOP: PV ...ID: lvcreate_and_attach_cachedevice_for_cacheDESC: Create a new LV, then attach a cachevol created fromDESC: the specified cache device, which converts theDESC: new LV to type cache.lvcreate --type writecache --size SizeMB --cachevol LV VGOO: OO_LVCREATE, --cachesettings String, --stripes Number, --stripesize SizeKBOP: PV ...ID: lvcreate_and_attach_cachevol_for_writecacheDESC: Create a new LV, then attach the specified cachevolDESC: which converts the new LV to type writecache.lvcreate --type writecache --size SizeMB --cachedevice PV VGOO: OO_LVCREATE, --cachesize SizeMB, --cachesettings String, --stripes Number, --stripesize SizeKBOP: PV ...ID: lvcreate_and_attach_cachedevice_for_writecacheDESC: Create a new LV, then attach a cachevol created fromDESC: the specified cache device, which converts theDESC: new LV to type writecache.lvdisplayOO: OO_REPORTING, --all, --history, --segments, --mapsOP: VG|LV|Tag ...IO: --partial, --ignoreskippedclusterID: lvdisplay_generallvdisplay --columnsOO: OO_REPORT, --history, --segmentsOP: VG|LV|Tag ...IO: --partial, --ignoreskippedclusterRULE: --noheadings not --headingsID: lvdisplay_columnsDESC: Display output in columns like lvs.lvdisplay --colonOO: OO_REPORTING, --all, --history, --segmentsOP: VG|LV|Tag ...IO: --partial, --ignoreskippedclusterID: lvdisplay_colonDESC: Generate colon separated output.lvextend --size PSizeMB LVOO: --alloc Alloc, --autobackup Bool, --force, --mirrors Number,--nofsck, --nosync, --noudevsync, --reportformat ReportFmt, --resizefs,--stripes Number, --stripesize SizeKB, --poolmetadatasize PSizeMB,--type SegType, --fs String, --fsmode StringOP: PV ...ID: lvextend_sizeDESC: Extend an LV by a specified size.lvextend LV PV ...OO: --alloc Alloc, --autobackup Bool, --force, --mirrors Number,--nofsck, --nosync, --noudevsync,--reportformat ReportFmt, --resizefs, --stripes Number, --stripesize SizeKB,--type SegType, --fs String, --fsmode StringID: lvextend_pvDESC: Extend an LV by specified PV extents.lvextend --poolmetadatasize PSizeMB LV_thinpool_linearOO: --alloc Alloc, --autobackup Bool, --force, --mirrors Number,--nofsck, --nosync, --noudevsync,--reportformat ReportFmt, --stripes Number, --stripesize SizeKB,--type SegTypeOP: PV ...ID: lvextend_pool_metadataDESC: Extend a pool metadata SubLV by a specified size.lvextend --usepolicies LV_snapshot_thinpool_vdopoolOO: --alloc Alloc, --autobackup Bool, --force, --mirrors Number,--nofsck, --nosync, --noudevsync,--reportformat ReportFmt, --resizefs,--type SegType, --fs String, --fsmode StringOP: PV ...ID: lvextend_policyDESC: Extend an LV according to a predefined policy.lvmconfigOO: OO_CONFIGOP: String ...ID: lvmconfig_generallvmdevicesID: lvmdevices_listDESC: Print devices in the devices file.lvmdevices --checkID: lvmdevices_checkOO: --refreshDESC: Check the devices file and report incorrect values.lvmdevices --updateOO: --delnotfound, --refreshID: lvmdevices_updateDESC: Update the devices file to fix incorrect values.lvmdevices --adddev PVOO: --deviceidtype StringID: lvmdevices_editDESC: Add a device to the devices file.lvmdevices --deldev PV|StringOO: --deviceidtype StringID: lvmdevices_editDESC: Remove a device from the devices file.lvmdevices --addpvid StringOO: --deviceidtype StringID: lvmdevices_editDESC: Find the device with the given PVID and add it to the devices file.lvmdevices --delpvid StringID: lvmdevices_editDESC: Remove the devices file entry for the given PVID.lvreduce --size NSizeMB LVOO: --autobackup Bool, --force, --nofsck, --noudevsync,--reportformat ReportFmt, --resizefs, --fs String, --fsmode StringID: lvreduce_sizelvremove VG|LV|Tag|Select ...OO: --autobackup Bool, --force, --nohistory, --noudevsync,--reportformat ReportFmt, --select StringID: lvremove_generallvrename VG LV LV_newOO: --autobackup Bool, --noudevsync, --reportformat ReportFmtID: lvrename_vg_lv_lvlvrename LV LV_newOO: --autobackup Bool, --noudevsync, --reportformat ReportFmtID: lvrename_lv_lvlvresize --size SSizeMB LVOO: --alloc Alloc, --autobackup Bool, --force,--nofsck, --nosync, --noudevsync, --reportformat ReportFmt, --resizefs,--stripes Number, --stripesize SizeKB, --poolmetadatasize PSizeMB,--type SegType, --fs String, --fsmode StringOP: PV ...ID: lvresize_sizeDESC: Resize an LV by a specified size.lvresize LV PV ...OO: --alloc Alloc, --autobackup Bool, --force,--nofsck, --nosync, --noudevsync,--reportformat ReportFmt, --resizefs, --stripes Number, --stripesize SizeKB,--type SegType, --fs String, --fsmode StringID: lvresize_pvDESC: Resize an LV by specified PV extents.lvresize --poolmetadatasize PSizeMB LV_thinpoolOO: --alloc Alloc, --autobackup Bool, --force,--nofsck, --nosync, --noudevsync,--reportformat ReportFmt, --stripes Number, --stripesize SizeKB,--type SegTypeOP: PV ...ID: lvresize_pool_metadataDESC: Resize a pool metadata SubLV by a specified size.lvsOO: --history, --segments, OO_REPORTOP: VG|LV|Tag ...IO: --partial, --ignoreskippedcluster, --trustcacheID: lvs_generalRULE: --noheadings not --headingslvscanOO: --all, --blockdevice, --ignorelockingfailure,--readonly, --reportformat ReportFmtIO: --partial, --cache_longID: lvscan_generalOO_PVCHANGE: --autobackup Bool, --force, --reportformat ReportFmtOO_PVCHANGE_META: --allocatable Bool, --addtag Tag, --deltag Tag,--uuid, --metadataignore Boolpvchange --all OO_PVCHANGE_METAOO: OO_PVCHANGEIO: --ignoreskippedclusterID: pvchange_properties_allDESC: Change properties of all PVs.pvchange OO_PVCHANGE_META PV|Select ...OO: --select String, OO_PVCHANGEIO: --ignoreskippedclusterID: pvchange_properties_someDESC: Change properties of specified PVs.pvresize PV ...OO: --setphysicalvolumesize SizeMB, --reportformat ReportFmt, --autobackup BoolID: pvresize_generalpvck PV ...OO: --labelsector NumberID: pvck_generalDESC: Check for metadata on a devicepvck --dump DumpType PVOO: --settings String, --file String,--pvmetadatacopies MetadataCopiesPV, --labelsector NumberID: pvck_dumpDESC: Check and print LVM headers and metadata on a devicepvck --repairtype RepairType PVOO: --settings String, --file String, --labelsector NumberID: pvck_repair_typeDESC: Repair LVM headers or metadata on a devicepvck --repair --file String PVOO: --settings String, --labelsector NumberID: pvck_repairDESC: Repair LVM headers and metadata on a devicepvcreate PV ...OO: --dataalignment SizeKB, --dataalignmentoffset SizeKB, --bootloaderareasize SizeMB,--force, --labelsector Number, --metadatatype MetadataType,--pvmetadatacopies MetadataCopiesPV, --metadatasize SizeMB,--metadataignore Bool, --norestorefile, --setphysicalvolumesize SizeMB,--reportformat ReportFmt, --restorefile String, --uuidstr String, --zero BoolID: pvcreate_generalRULE: --norestorefile not --restorefileRULE: --bootloaderareasize not --restorefilepvdisplayOO: OO_REPORTING, --maps, --segments, --shortOP: PV|Tag ...IO: --partial, --ignoreskippedclusterID: pvdisplay_generalpvdisplay --columnsOO: OO_REPORT, --segmentsOP: PV|Tag ...IO: --partial, --ignoreskippedclusterRULE: --noheadings not --headingsID: pvdisplay_columnsDESC: Display output in columns like pvs.pvdisplay --colonOO: OO_REPORTING, --segmentsOP: PV|Tag ...IO: --partial, --ignoreskippedclusterID: pvdisplay_colonDESC: Generate colon separated output.pvmove PVOO: --abort, --alloc Alloc, --atomic, --autobackup Bool, --background,--interval Number, --name LV, --noudevsync, --reportformat ReportFmtOP: PV ...ID: pvmove_oneDESC: Move PV extents.pvmoveOO: --abort, --background, --interval NumberID: pvmove_anyDESC: Continue or abort existing pvmove operations.pvremove PV ...OO: --force, --reportformat ReportFmtID: pvremove_generalpvsOO: --segments, --allpvs, OO_REPORTOP: PV|Tag ...IO: --partial, --ignoreskippedcluster, --trustcacheID: pvs_generalRULE: --noheadings not --headingspvscanOO: --ignorelockingfailure, --reportformat ReportFmt, --exported, --novolumegroup,--short, --uuid, --allpvsID: pvscan_displayDESC: Display PV information.pvscan --cache_longOO: --ignorelockingfailure, --reportformat ReportFmt,--major Number, --minor Number, --noudevsyncOP: PV|String ...IO: --backgroundID: pvscan_cacheDESC: Record that a PV is online or offline.pvscan --cache_long --activate ayOO: --ignorelockingfailure, --reportformat ReportFmt,--major Number, --minor Number, --noudevsync, --autoactivation StringOP: PV|String ...IO: --backgroundID: pvscan_cacheDESC: Record that a PV is online and autoactivate the VG if complete.pvscan --cache_long --listvg PVOO: --ignorelockingfailure, --checkcomplete, --vgonline, --udevoutput,--autoactivation StringID: pvscan_cacheDESC: Record that a PV is online and list the VG using the PV.pvscan --cache_long --listlvs PVOO: --ignorelockingfailure, --checkcomplete, --vgonlineID: pvscan_cacheDESC: Record that a PV is online and list LVs using the PV.pvscan --listlvs PVID: pvscan_cacheDESC: List LVs using the PV.pvscan --listvg PVID: pvscan_cacheDESC: List the VG using the PV.vgcfgbackupOO: --file String, --foreign, --ignorelockingfailure, --readonly,--reportformat ReportFmtOP: VG ...IO: --partialID: vgcfgbackup_generalOO_VGCFGRESTORE: --force_long, --metadatatype MetadataTypevgcfgrestore VGOO: OO_VGCFGRESTOREID: vgcfgrestore_by_vgDESC: Restore VG metadata from last backup.vgcfgrestore --file String VGOO: OO_VGCFGRESTOREID: vgcfgrestore_by_fileDESC: Restore VG metadata from specified file.vgcfgrestore --list VGOO: OO_VGCFGRESTOREID: vgcfgrestore_list_by_vgDESC: List all VG metadata backups.vgcfgrestore --list --file StringOO: OO_VGCFGRESTOREOP: VGID: vgcfgrestore_list_by_fileDESC: List one VG metadata backup file.OO_VGCHANGE: --autobackup Bool, --ignoremonitoring,--noudevsync, --reportformat ReportFmt, --select String, --forceOO_VGCHANGE_META: --addtag Tag, --deltag Tag,--logicalvolume Uint32, --maxphysicalvolumes Uint32, --alloc Alloc, --uuid,--pvmetadatacopies MetadataCopiesPV, --vgmetadatacopies MetadataCopiesVG,--physicalextentsize SizeMB, --resizeable Bool,--detachprofile, --metadataprofile String,--setautoactivation Boolvgchange OO_VGCHANGE_METAOO: --poll Bool, OO_VGCHANGEOP: VG|Tag|Select ...IO: --ignoreskippedclusterID: vgchange_propertiesDESC: Change a general VG attribute.DESC: For options listed in parentheses, any one isDESC: required, after which the others are optional.vgchange --monitor BoolOO: --sysinit, --ignorelockingfailure, --poll Bool, OO_VGCHANGEOP: VG|Tag|Select ...IO: --ignoreskippedclusterID: vgchange_monitorDESC: Start or stop monitoring LVs from dmeventd.vgchange --poll BoolOO: --ignorelockingfailure, OO_VGCHANGEOP: VG|Tag|Select ...IO: --ignoreskippedclusterID: vgchange_pollDESC: Start or stop processing LV conversions.vgchange --activate ActiveOO: --activationmode ActivationMode, --ignoreactivationskip, --partial, --sysinit,--readonly, --ignorelockingfailure, --monitor Bool, --poll Bool,--autoactivation String, OO_VGCHANGEOP: VG|Tag|Select ...IO: --ignoreskippedclusterID: vgchange_activateDESC: Activate or deactivate LVs.vgchange --refreshOO: --sysinit, --ignorelockingfailure, --poll Bool, OO_VGCHANGEOP: VG|Tag|Select ...IO: --ignoreskippedclusterID: vgchange_refreshDESC: Reactivate LVs using the latest metadata.vgchange --systemid String VG|Tag|SelectOO: --select String, --majoritypvsID: vgchange_systemidDESC: Change the system ID of a VG.vgchange --lockstartOO: --select StringOP: VG|Tag|Select ...ID: vgchange_lockstartDESC: Start the lockspace of a shared VG in lvmlockd.vgchange --lockstopOO: --select StringOP: VG|Tag|Select ...ID: vgchange_lockstopDESC: Stop the lockspace of a shared VG in lvmlockd.vgchange --locktype LockType VGID: vgchange_locktypeDESC: Change the lock type for a shared VG.vgckOO: --reportformat ReportFmtOP: VG|Tag ...ID: vgck_generalDESC: Read and display information about a VG.vgck --updatemetadata VGID: vgck_update_metadataDESC: Rewrite VG metadata to correct problems.vgcreate VG_new PV ...OO: --addtag Tag, --alloc Alloc, --autobackup Bool, --clustered Bool, --maxlogicalvolumes Uint32,--maxphysicalvolumes Uint32, --metadataprofile String, --metadatatype MetadataType,--physicalextentsize SizeMB, --force, --zero Bool, --labelsector Number,--metadatasize SizeMB, --pvmetadatacopies MetadataCopiesPV, --vgmetadatacopies MetadataCopiesVG,--reportformat ReportFmt, --dataalignment SizeKB, --dataalignmentoffset SizeKB,--shared, --systemid String, --locktype LockType, --setautoactivation BoolID: vgcreate_generalvgdisplayOO: OO_REPORTING, --short, --activevolumegroupsOP: VG|Tag ...IO: --partial, --ignoreskippedclusterID: vgdisplay_generalvgdisplay --columnsOO: OO_REPORTOP: VG|Tag ...IO: --partial, --ignoreskippedclusterRULE: --noheadings not --headingsID: vgdisplay_columnsDESC: Display output in columns like vgs.vgdisplay --colonOO: OO_REPORTING, --activevolumegroupsOP: VG|Tag ...IO: --partial, --ignoreskippedclusterID: vgdisplay_colonDESC: Generate colon separated output.OO_VGEXPORT: --reportformat ReportFmtvgexport VG|Tag|Select ...OO: --select String, OO_VGEXPORTID: vgexport_someDESC: Export specified VGs.vgexport --allOO: OO_VGEXPORTID: vgexport_allDESC: Export all VGs.vgextend VG PV ...OO: --autobackup Bool,--force, --zero Bool, --labelsector Number, --metadatatype MetadataType,--metadatasize SizeMB, --pvmetadatacopies MetadataCopiesPV,--metadataignore Bool, --dataalignment SizeKB, --dataalignmentoffset SizeKB,--reportformat ReportFmt, --restoremissingID: vgextend_generalOO_VGIMPORT: --force, --reportformat ReportFmtvgimport VG|Tag|Select ...OO: --select String, OO_VGIMPORTID: vgimport_someDESC: Import specified VGs.vgimport --allOO: OO_VGIMPORTID: vgimport_allDESC: Import all VGs.vgimportclone PV ...OO: --basevgname VG, --import, --importdevicesID: vgimportclone_generalvgimportdevices VG|Tag|Select ...OO: --select String, --foreign, --reportformat ReportFmtID: vgimportdevices_someDESC: Add devices from specific VGs to the devices file.vgimportdevices --allOO: --foreign, --reportformat ReportFmtID: vgimportdevices_allDESC: Add devices from all accessible VGs to the devices file.vgimportdevices --rootvgOO: --auto, --reportformat ReportFmtID: vgimportdevices_rootDESC: Add devices from root VG to the devices file.vgmerge VG VGOO: --autobackup Bool, --list, --poolmetadataspare BoolID: vgmerge_generalvgmknodesOO: --ignorelockingfailure, --refresh, --reportformat ReportFmtOP: VG|LV|Tag ...ID: vgmknodes_generalOO_VGREDUCE: --autobackup Bool, --force, --reportformat ReportFmtvgreduce VG PV ...OO: OO_VGREDUCEID: vgreduce_by_pvDESC: Remove a PV from a VG.vgreduce --all VGOO: OO_VGREDUCEID: vgreduce_allDESC: Remove all unused PVs from a VG.vgreduce --removemissing VGOO: --mirrorsonly, OO_VGREDUCEID: vgreduce_missingDESC: Remove all missing PVs from a VG.vgremove VG|Tag|Select ...OO: --force, --noudevsync, --reportformat ReportFmt, --select StringID: vgremove_generalvgrename VG VG_newOO: --autobackup Bool, --force, --reportformat ReportFmtID: vgrename_by_nameDESC: Rename a VG.vgrename String VG_newOO: --autobackup Bool, --force, --reportformat ReportFmtID: vgrename_by_uuidDESC: Rename a VG by specifying the VG UUID.vgsOO: OO_REPORTOP: VG|Tag ...IO: --partial, --ignoreskippedcluster, --trustcacheID: vgs_generalRULE: --noheadings not --headingsvgscanOO: --ignorelockingfailure, --mknodes, --notifydbus, --refresh,--reportformat ReportFmtIO: --partial, --cache_longID: vgscan_generalOO_VGSPLIT: --autobackup Bool, --poolmetadataspare BoolOO_VGSPLIT_NEW: --alloc Alloc,--maxlogicalvolumes Uint32, --maxphysicalvolumes Uint32,--metadatatype MetadataType, --vgmetadatacopies MetadataCopiesVGvgsplit VG VG PV ...OO: OO_VGSPLIT, OO_VGSPLIT_NEWID: vgsplit_by_pvDESC: Split a VG by specified PVs.vgsplit --name LV VG VGOO: OO_VGSPLIT, OO_VGSPLIT_NEWID: vgsplit_by_lvDESC: Split a VG by PVs in a specified LV.configOO: OO_CONFIGOP: String ...ID: lvmconfig_generaldumpconfigOO: OO_CONFIGOP: String ...ID: lvmconfig_generaldevtypesOO: --aligned, --binary, --nameprefixes, --noheadings,--nosuffix, --options String, --reportformat ReportFmt, --rows,--select String, --separator String, --sort String, --unbuffered, --unquotedID: devtypes_generalfullreportOO: OO_REPORTOP: VG ...IO: --partial, --ignoreskippedcluster, --trustcacheID: fullreport_generalRULE: --noheadings not --headingslastlogOO: --reportformat ReportFmt, --select StringID: lastlog_generallvpoll --polloperation PollOp LV ...OO: --abort, --autobackup Bool, --handlemissingpvs, --interval NumberID: lvpoll_generalformatsID: formats_generalhelpOP: String ...ID: help_generalversionID: version_generalpvdataID: pvdata_generalsegtypesID: segtypes_generalsystemidID: systemid_generaltagsID: tags_generallvmchangeID: lvmchange_generallvmdiskscanOO: --lvmpartition, --readonlyID: lvmdiskscan_generallvmsadcID: lvmsadc_generallvmsarOO: --full, --stdinID: lvmsar_generalvgconvert VG ...OO: --force, --labelsector Number, --bootloaderareasize SizeMB,--metadatatype MetadataType, --pvmetadatacopies MetadataCopiesPV,--metadatasize SizeMB, --reportformat ReportFmtID: vgconvert_generallv_is_lockedlv_is_partiallv_is_virtuallv_is_merginglv_is_merging_originlv_is_convertinglv_is_external_originlv_is_virtual_originlv_is_not_synced lv_is_pending_delete lv_is_error_when_full lv_is_pvmove lv_is_removed lv_is_vg_writablelv_is_writablelv_is_thinpool_datalv_is_thinpool_metadatalv_is_cachepool_datalv_is_cachepool_metadatalv_is_mirror_imagelv_is_mirror_loglv_is_raid_imagelv_is_raid_metadatalv_is_originlv_is_thick_originlv_is_thick_snapshotlv_is_thin_originlv_is_thin_snapshotlv_is_errorlv_is_zerolv_is_cache_originlv_is_cow lv_is_merging_cow!lv_is_cow_covering_origin"lv_is_visible#lv_is_historical$lv_is_raid_with_tracking%lv_is_raid_with_integrity&dkmgtpebs`CCreating directory %s.Failed to add sublv %s.raid5_nimagesrebuildExtracting %u %s from %s.Failed to extract %s from %s.Shifting images in %s.Shifting %s and %s by %u.Post callout function failed.lvs list alloc failed.Extending %u mirror images.Using default stripesize %sNew size of 0 not permitted.%s_imetacrc32cLV update and reload failedFailed to add integrity.pipePiping:%sSTDOUT/dev/nullpipe[0]pipe[1]lockd query LV %s/%squery_lock_lv by historical LVCreating logical volume %ssnapshot%dCan't move snapshot segment.sigfillsetcmd = %smode = %slockd %s %s result %d %xRetrying metadata scan.Couldn't find uuid.Invalid uuid.gethostnamenohostname%s/.lvm_%s_%d_%d# Hint only%s = [%s]Failed to open crypt path %s.cryptDevice %s: %s is %lu%s.LV %s has to be of type raid4 or raid5_n to allow for this conversion.Are you sure you want to convert %s%s LV %s to %s%s type? [y/n]: Converting LV %s from %s to %s.Failed to rename %s LV %s MetaLVs.Unable to remove primary RAID image while array resyncing.Unable to remove RAID image while array is performing "%s"Internal error: RAID LV area_count differs from number of health charactersUnable to remove all primary source devicesUnable to remove %d images: Only %d device%s given.%s has components with error targets that must be removed first: %s.Try removing the PV list and rerun. the command.LVs with error segments to be removed: %s %sInternal error: Metadata segment area. #%d should be AREA_UNASSIGNED.Failed to shift and rename image components.Unable to extract enough images to satisfy request.Internal error: Bad type provided to %s.Extracting image component %s from %s.Internal error: Pre callout function failed.Clearing any flags for %s passed to the kernel.Updating metadata mappings for %s.Direct conversion of %s LV %s is not possible.Converting %s from %s%s is directly possible to the following layout%s:Logical volumes in "%s" must be inactiveExtent sizes differ: %d (%s) and %d (%s)Maximum number of physical volumes (%d) exceeded for "%s" and "%s"Maximum number of logical volumes (%d) exceeded for "%s" and "%s"Metadata types differ for "%s" and "%s"Duplicate logical volume name "%s" in "%s" and "%s"Physical volume %s might be constructed from same volume group %s.pv->vg_name allocation failed for '%s'Rounding size to boundary between physical extents: %s.VolumeType does not match (%s).Logical volume %s is using mixing segment types %s and %s.Cannot vary number of mirrors in LV yet.Internal error: Missing mirror segments for %s.Please specify number of stripes (-i) and stripesize (-I)Unable to extend "%s" segment type with different number of stripes.Using stripesize of last segment %sStripesize for striped segment should not be 0!Increasing incremental size from %s to %s to fit new VDO slab.Unable to extend %s by %u logical extents: exceeds limit (%u).Reached maximum COW size %s (%u extents).Reached maximum pool metadata size %s (%u extents).Thin pool will use metadata without cropping.Unable to reduce %s below 1 extent.New size (%d extents) matches existing size (%d extents).Rounding size (%d extents) up to stripe boundary size for segment (%d extents).Rounding size (%d extents) down to stripe boundary size for segment (%d extents)New size given (%d extents) not larger than existing size (%d extents)New size given (%d extents) not less than existing size (%d extents)New size (%d extents) matches existing size (%d extents)New size for %s: %u. Existing logical extents: %u / physical extents: %u.Integrity can only be added to top level raid LV.Integrity can only be added to raid1,4,5,6,10.raid image must be linear to add integrityFailed to create metadata LV name.Round integrity meta size up to one extent.Creating integrity metadata LV %s with size %s.Failed to create integrity metadata LVIntegrity metadata uses more than one segment.Failed to activate LV %s to zeroFailed to zero LV for integrity metadata %sFailed to deactivate LV %s after zeroIntegrity requires consistent logical block size for LV devices.Invalid integrity block size, possible values are 512, 1024, 2048, 4096Integrity block size %u not allowed with device logical block size 4096.Using integrity block size %u with unknown device logical block size.Cannot use integrity block size %u with unknown file system block size, logical block size %u, physical block size %u.Using integrity block size %u for unknown file system block size, logical block size %u, physical block size %u.Limiting integrity block size to 512 because the LV is active.Using integrity block size %u for file system block size %u.Integrity block size %u cannot be larger than file system block size %u.Adding integrity to raid image %sWriting VG and updating LV with new integrity LV %sWriting VG with new integrity LV %sActivating to start integrity initialization for LV %sFailed to activate integrity LV to initialize.Writing VG with initialized integrity LV %sNew integrity metadata LV may require manual removal.Can't convert non-striped segment to mirrored.Can't convert striped segment with multiple areas to mirrored.Couldn't allocate converted LV segment.Failed to generate unique name for unused logical volume.Missing segtype in lv_add_segment().lv_add_segment cannot handle virtual segmentsLog segments can only be added to an empty LVCouldn't allocate new LV segment.Couldn't merge segments after extending logical volume.Failed to generate new unique name for unused LV %sLock query failed for LV %s/%squery_lock_lv lvmlockd result %dquery_lock_lv mode not returnedlockd_free_lv_queue: unknown lock_type.Failed to generate unique name for the new logical volumeUnable to create LV %s in Volume Group %s: name already in use%s.'%s' is already in use as a snapshot.Snapshot and origin LVs must differ.Failed to find snapshot segtypeCouldn't allocate new snapshot segment.Couldn't allocate new %s segment.Using %s chunk size instead of default %s, so cache pool has less than %lu chunks.Chunk size %s is less than required minimal chunk size %s for a cache pool of %s size and limit %lu chunks.To allow use of more chunks, see setting allocation/cache_pool_max_chunks.Internal error: Cache mode is not determined.Internal error: Resource name %s is too long.Operation prohibited while --readonly is set.Allowing activation with --readonly --sysinit.Operation prohibited while global/metadata_read_only is set.lvmlockd %s %s failed no resultWARNING: bad metadata header on %s at %llu.Ignoring mda on device %s at offset %luMetadata location on %s at %llu has offset 0.Skipping read of already known VG metadata with matching mda checksum on %s.Reading metadata summary from %s at %llu size %d (+%d)WARNING: invalid metadata text from %s at %llu.WARNING: invalid metadata text from file.WARNING: metadata on %s at %llu has invalid summary for VG.WARNING: metadata on %s at %llu has invalid VG name.WARNING: bad metadata text on %s in mda%dFound metadata summary on %s at %llu size %llu for VG %sReading mda header sector from %s at %lluFailed to read metadata area header on %s at %lluWARNING: wrong checksum %x in mda header on %s at %lluWARNING: wrong magic number in mda header on %s at %lluWARNING: wrong version %u in mda header on %s at %lluWARNING: wrong start sector %llu in mda header on %s at %lluFailed to write mda header to %s.Not enough space to build temporary file string.Internal error: Metadata inconsistency: Not all flags successfully exported.Could not allocate memory for string list buffer.Failed to duplicate directory path %s.No file system info from blkid for %sCannot find active LUKS dm-crypt device using %s.Checking crypt device %s on LV %s.Failed to get crypt device size %s.No file system info from blkid for dm-crypt device %s on LV %s.Failed to get crypt data offset.fs_get_info %s is mounted "%s"WARNING: Device %s: %s is %lu and is unexpectedly less than sector.WARNING: Ignoring %s = %lu for device %s (not divisible by 4KiB).Ignoring unknown multipath_wwids_file.multipath wwids file not foundmultipath wwids read %d from %s_extract_image_component_error_seg%s/block/bdiremovableslavetraceuevent%sblock/%s/%s/devclustered-userspace %u %s clustered-%s%s %u nosync block_on_error 1 handle_errors%s %s %c %d%u %u %s%s%s%s%s %s %lu %s %d %u rebuild %u min_recovery_rate %u max_recovery_rate %u write_mostly %u max_write_behind %u region_size %u raid10_copies %u delta_disks %d data_offset %d%s %d%s metadata2 passthrough writeback writethrough migration_threshold %u %s %lu%s %s %s %u %d high_watermark %llu low_watermark %llu writeback_jobs %llu autocommit_blocks %llu autocommit_time %llu fua nofua cleaner max_age %u metadata_only pause_writeback %u meta_device:%s recalculate journal_sectors:%u interleave_sectors:%u buffer_sectors:%u journal_watermark:%u commit_time:%u bitmap_flush_interval:%u sectors_per_bit:%llu allow_discardsmissing deviceDevice not added.No devno %u:%u in dev cache.deviceiddeviceid filter initialised.Sysfs filter initialised.mpath filter initialised.md filter allocation failedsignature filter initialised.MD filter initialised.compositeComposite filter initialised.LVM type filter initialised.dev_iter allocation failed.Reading hint filehints_version:%d.%dglobal_filter:scan_lvs:devices_file:devs_hash:scan:pvid:devn:%d:%dadd hint %s %s %d:%d %saccept hints found %dread_hint_file close errno %dFound PVID %s on %sAdding pvid to hash failed %sDestroy lvmcache content O_EXCLRWRO%s: Not using O_NOATIME%s: Not using O_DIRECTOpened %s %s%s%sLeaving section (%s).Skipping: Deactivating %s.deactivatingdeactivated (reverting) pool only thin onlySkipping: Resuming %s%s%s.Resuming LV %s%s%s%s. if activeresumed origin without snapshotsSkipping: Suspending %s%s.already suspendedRequiring flush for LV %s.suspend_lvsfailed suspendMonitoredUnmonitored%s %s for events%s[%d]Pool %s is unlocked.Pool %s is locked.Creating %sFailed to set uuid for %sLoading table for %s.Unable to resume %s. (Ignoring.)Couldn't create path for %s/%s.WARNING: Ignoring RAID1 stripe sizeFailed to get %s target versions%s 0 %u %s %d fix_padding block_size:%u internal_hash:%sNo parameters supplied for %s target %u:%u.Adding target to (%u:%u): %lu %lu %s %sThe specified --deviceidtype %s is unknown.WARNING: ignoring unknown device_id type %s.The specified --deviceidtype %s is not available for %s.WARNING: ignoring deviceidtype %s which is not available for device.Replacing device id %s old %s new %sdevice_id_add %s pvid %s matches entry %p dev %s with same pvid %sdevice_id_add %s pvid %s matches entry %p dev %s with same device_id %d %sdevice_id_add %s pvid %s matches entry %p dev %s with same devname %sWARNING: adding device %s with PVID %s which is already used for %s device_id %s.WARNING: adding device %s with idname %s which is already used for missing device.Using separate entries for partitions of same device %s part %d %s part %d.WARNING: adding device %s with idname %s which is already used for %s.Add device with duplicate PV to devices file?Adding new entry to devices file for %s PVID %s %s %s.Updating existing entry in devices file for %s that matches %s %s.device_id_add %s pvid %s matches entry %p dev %sstr_list_to_str: string allocation failed.Internal error: connections must be initialized before filtersFailed to create global regex device filterFailed to create regex device filterLVM type filter allocation failedFailed to create lvm type filterdeviceid filter allocation failedFailed to create deviceid device filterNo proc filesystem found: skipping sysfs filterUsable device filter allocation failedUsable device filter mode allocation failedUsable device filter initialised (scan_lvs %d).Failed to create usable device filterNo proc filesystem found: skipping multipath filtermpath filter allocation failedPartitioned filter allocation failedFailed to create partitioned device filterFailed to create signature device filterFirmware RAID filter allocation failedFirmware RAID filter initialised.Composite filters allocation failed.Allocation of persistent filter failed.Allocation of device filter for persistent filter failed.Persistent filter initialised.Failed to create persistent device filter.Couldn't create hash table for persistent filter.Partitioned filter initialised.Internal error: Unable to attach pool to %s/%s that is not cache or thin volume.WARNING: sysfs path for %s attribute is too long.Skipping "%s" (symbolic link to directory).Skipping "%s" (different filesystem in directory).Checking fd limit for num_devs %u failed %dChecking fd limit for num_devs %u want %u soft %lld hard %lldSetting fd limit for num_devs %u soft %lld hard %lldWARNING: permission error setting open file limit for scanning %u devices.WARNING: cannot set open file limit for scanning %u devices.dev_iter values allocation failed.ignore hints with unknown version %d.%dignore hints with version %d.%d current %d.%dignore hints with different global_filterignore hints with different filterignore hints with different or unreadable scan_lvsignore hints with different devices_file: not enabled vs %signore hints with different devices_file: %s vs %signore hints with invalid devs_hashignore hints with read_hash %u count %u calc_hash %u count %uignore hints: no device matches devices file entry for %signore hints: devno %u:%u does not match %u:%u for %signore hints: no devices file entry for %sIgnoring lvmcache info for dev %s because dev %s was requested for PVID %s.lvmcache_info allocation failedSaving initial duplicate device %s previously seen on %s with PVID %s.Initial duplicate already in list %sChanging pvid on dev %s from %s to %sChanging labeller on dev %s from %s to %sInternal error: vginfos list should be emptyCannot open device %u:%u with no valid paths.%s: Already opened read-only. Upgrading to read-write.dev_open(%s) called while suspendedFailed to open device path %s (%d).%s: fstat failed: Has device name changed?Leaving critical section (%s).LV %s has open %d snapshot(s), not deactivating.Deactivated volume is still %s present.Not using origin only for suspend of %s.Internal error: LV %s missing from preload metadata.Internal error: LV %s (%s) missing from preload metadata.Checking VDO pool status for LV %s.WARNING: Failed to get uuid for dtree node %s._sysfs_get_kernel_name: failed to allocate temporary buffers_sysfs_get_kernel_name: dm_snprintf failedCould not locate device kernel name in sysfs path %s_sysfs_get_kernel_name: output buffer too smallCouldn't find snapshot COW device uuid %s.Couldn't find merging snapshot uuid %s.Using udev_flags 0x%x for activation of %s._deps: task run failed for (%u:%u)_deps: failed to get info for (%u:%u)Inconsistent dtree major number: %u != %uInconsistent dtree minor number: %u != %uInternal error: Pool %s is already unlocked.Internal error: Pool %s is already locked.Create dm_task creation failed for %sFailed to set device name for %sInternal error: Unable to get DM task info for %s.Reload dm_task creation failed for %s.Insufficient space for target parameters.Insufficient space in params[%zu] for target parameters.Target parameter size too big. Aborting.Suppressed %s identical table reload.Resume of table of extended device %s delayed.Table size changed from %lu to %lu for %s.%s~hyhy~8y8yHzhyz{|(}}(v(v(v(v(v(v(v(v(v(v(v(v(v(v(v(v(v(v #L$tIV2 %s %lu %u %lu %u %s %s %s read_only error_if_no_space no_discard_passdown ignore_discard skip_block_zeroing%s %s %d %lu %d%s%s%s%s%s%s%s %lucompression oncompression offindex-enableindex-disableParsing VDO status: %sRenaming %s (%u:%u) to %sName "%s" too longFailed to suspend %s (%u:%u) boolean array with values of type:Failed to duplicate filename.config_tree allocation failedLoading config file: %sFailed to load config file %s%H:%M:%S.%06d some losing %s resilienceCan't convert %s LV %s to %s.Adding metadata LVs to %s._extractedCan't convert %s to %s.Sending daemon %s: helloDaemon %s returned error %dprotocoldaemon_opensanlock lvmlock LV removedseqno = description = creation_time = -- Check confirm arg %s no info.Checking %s to confirm %.32s.Incomplete rangespecificationFailed to create config node.Removed %sRenamed %s to %sSELinux context resetselabel_open failed: %ssetfscreatecon%s: mknod for %s failed: %schownCreated %sUnstackingStackingdaemon_close in VG sub %s lockd %s result: bad responselockd %s result: no op_resultresult_flagsNO_LOCKSPACESNO_GL_LSNO_LMDUP_GL_LSWARN_GL_REMOVEDSH_EXISTSlockd %s result: %dlockd_vg_update %svg_updatestart_waitLock start failedFailed to format %s device number for %s as dm target (%u,%u)Can create VDO data volume path for %s.Correcting VDO virtual volume size from %lu to %lu.V4 %s %lu %u %lu %u deduplication %s compression %s maxDiscard %u ack %u bio %u bioRotationInterval %u cpu %u hash %u logical %u physical %uExpected vdo target for %s and got %s.VDO needs message for compression %u(%u) and deduplication %u(%u).semid %d: sem_ctl GETVAL failed for cookie 0x%x: %sFailed to set a proper state for notification semaphore identified by cookie value %u (0x%x) to initialize waiting for incoming notifications.Udev cookie 0x%x (semid %d) waiting for zeroCould not set wait state for notification semaphore identified by cookie value %u (0x%x): %sRename dm_task creation failed for %sFailed to set name for %s rename.Non empty new name is required.Failed to mangle new device name "%s"New device name mangled [%s]: %s --> %sdm_task_set_newname: strdup(%s) failedFailed to rename %s (%u:%u) to %sFailed to build dev path for "%s".build_dm_name: Allocation failed for %zu %s %s.%s not found in config: defaulting to %dFailed to allocate config file.Internal error: config_file_read_fd: expected file, special file or profile config source, found %s config source.Failed to allocate circular buffer.WARNING: Metadata location on %s at offset %llu begins with invalid name.WARNING: Checksum error on %s at offset %llu.Internal error: _cmp_field_string_list: unknown list typeFailed to create bitset for regex match counter.Internal error: _cmp_field_string_list: unsupported string list type found, expecting either AND or OR list for selection field %sstruct mda_list allocation failedInvalid directory value, %s: not an absolute name.Invalid directory value, %s: name too long.Can't convert %s LV %s to %s with odd number of stripes.Can't convert %s LV %s to %s with != 2 legs.Internal error: Bogus new_image_count converting %s LV %s to %s.Can't convert %s LV %s to %s with < 3 legs.Reordering areas for raid10 -> raid0 takeover.Removing %u component LV pair(s) to %s.N number of data_copies "--mirrors N-1" may not be larger than number of stripes.Minimum of %u stripes needed for conversion from %s to %s.Adding %u component LV pair(s) to %s.Extracting last image component pair of %s temporarily.Adding extracted last image component pair back to %s to convert to %s.Reordering areas for raid0 -> raid10_near takeover.Updating VG metadata and reloading %s LV %s.%s: Opening daemon socket to %s for protocol %s version %d.%s: Daemon socket path too long.socket connect error %d for %sDaemon %s: requested protocol %s != %sDaemon %s: requested protocol version %d != %dFailed to remove sanlock LV %s/%sskip invalid metadata with len %llu at %llumetadata at %llu length %llu crc %08x vg %s seqno %u id %sWARNING: parse error for metadata at %lluWARNING: unexpected terminating bytes for metadata at %lluWARNING: metadata from multiple VGs was found.Failed to extract full metadata text at %llu, skipping.Check confirm arg %s no PVID foundCannot use device %s: it changed during prompt.Badly quoted character at end of expressiondm_report_field_uint64: dm_pool_alloc faileddm_report_field_uint64: uint64 too big: %ludm_report_field_int32: dm_pool_alloc faileddm_report_field_int32: int32 too big: %ddm_report_field_uint32: dm_pool_alloc faileddm_report_field_uint32: uint32 too big: %udm_report_field_int: dm_pool_alloc faileddm_report_field_int: int too big: %dFailed to allocate target segment area.Internal error: %s cfg tree element not declared as array.Failed to create default array node for %s.Node %s was not removed by udev. Falling back to direct node removal.A non-block device file at '%s' is already presentThe node %s should have been renamed to %s by udev but old node is still present. Falling back to direct old node removal.Unable to unlink device node for '%s'The node %s should have been renamed to %s by udev but new node is not present. Falling back to direct node rename.Unable to rename device node from '%s' to '%s'selabel_lookup failed for %s: %sPreparing SELinux context for %s to %s.Resetting SELinux context to default value.%s not set up by udev: Falling back to direct node creation.Insufficient memory to stack mknod operationCould not signal waiting process using notification semaphore identified by cookie value %u (0x%x)Closing daemon socket (fd %d).Can't report LV and PV fields at the same time in %sreport type "%s"%s%s.Subreport of type "%s" for VG %s contains columns which lead to change of report type. Add these columns to proper subreport type.Converting thin%s segment type for %s to %s is not supported.For pool data volume conversion use %s.For pool metadata volume conversion use %s.lockd %s result: reply error %dMissing global lock: global lock was lost by removing a previous VG.To enable the global lock in another VG, see lvmlockctl --gl-enable.gee0fXfffe`g`gg8hhi@gxgommmpnpnpnpnmmIommmmmmmmmmmmmmmmpnmmmmmmmmmmmmmmmmmmmmmmmmmmmn1nm|nԏtdTD4$ ԎĎtdDD$ԍtČd4ԋȒpXH8ȑxhXH8((_free_vgblocked_mirrors%d:%d %d:%d%s: %s device %s not usable.invalid snapshotsfrozen raidunusable_thins%sblock/dm-%d/vdo/%sFailed to build kvdo path.%skvdo/%s/%sstrtool_mlog_LV %s in not partial.%s has enough space for %s.%s_iorigraid5_lsraid6_zrraid5raid6raid10_near (same as %s%s)Failed to hash mda.Livelvfullname snprintf failedWriting hint file %d# info: duplicate_pvs # info: duplicate_vgnames # Created by %s pid %d %shints_version: %d.%d global_filter:%s scan_lvs:%d devices_file:%s devices_file:. devs_hash: %u %u unlink_newhints errno %d %sclose %s errno %dInterrupted initialization ofFailed to wipe signatures onInterrupted initializationFailed to initializeclose and reopen rw %s%s logical volume %s.BLKZEROOUTScan failed to open %u:%u %s.Scanning submitted %d readsScan failed to read %s.Scan failed to process %s%s: No lvm label detectedFailed to read vg %s from %sVG %s not found on %sFailed to parse %s '%s'.%sdev/block/%u:%u/slaves%sblock/%s/device/wwidscsi_debugpvids: devs: differdevice is an md componentdevice is partitioneddevice has a signaturedevice is missing sysfs infodevice type is unknowndevice is not in devices filedevice is not in devices listdevice is an LVdevice is filteredlvmpolld failed to process a request. The reason was: %s.lvmpolld couldn't handle a request. It might be due to daemon internal state. The reason was: %s.Unexpected response %s. The reason: %s.%s: Empty device %s not usable.%s: Suspended device %s not usable.%s: Scanning mirror devices is disabled.%s: Mirror image %d marked as failed.%s: Mirror log device marked as failed.%s: Mirror device %s not usable.WARNING: Incorrect snapshot table found for %u:%u.WARNING: Incorrect snapshot-origin table found for %u:%u.%s: Invalid %s device %s not usable.%s: Frozen %s device %s not usable.WARNING: Cannot get thin-pool major:minor for thin device %u:%u.WARNING: %s: Thin's thin-pool needs inspection.%s: Error device %s not usable.WARNING: %s frozen raid device (%u:%u) needs inspection.%s: I/O blocked to mirror device._get_glv_str: dm_snprintf failedFailed to allocate string for new LV name.Can't rebuild raid with integrity.Can't replace any devices in %s LV %s.Unable to replace devices in %s while it is not in-sync.Unable to repair %s/%s. Source devices failed before the RAID could synchronize.You should choose one of the following: 1) deactivate %s/%s, revive failed device, re-activate LV, and proceed. 2) remove the LV (all data is lost). 3) Seek expert advice to attempt to salvage any data from remaining devices.Unable to replace RAID images while the array has unassigned areas.Logical volume %s does not contain devices specified to %s.%s does not contain devices specified to %s.Unable to %s all PVs from %s at once.Unable to %s more than %u PVs from (%s) %s.Unable to %s all the devices in a RAID10 mirror group.Failed to prevent PVs holding image components from being used for allocation.Failed to replace %u devices. Attempting to replace %u instead.%u extents needed to repair %s.Not enough space on %s for %s.Failed to allocate replacement images for %s.Failed to remove the specified images from %s.%s not allowed when converting %s LV %s.%s not allowed for LV %s when converting from %s to %s.Internal error: New segtype is not defined.Internal error: %s logical volume %s is not a user of %s.Removing historical connection between %s and %s.Internal error: historical_glv_remove: historical LV %s/-%s not found Historical LV %s/-%s already on removed list WARNING: Ignoring invalid string in config file entry allocation/cling_tag_listWARNING: Ignoring empty string in config file entry allocation/cling_tag_listWARNING: Ignoring string not starting with @ in config file entry allocation/cling_tag_list: %sWARNING: Ignoring empty tag in config file entry allocation/cling_tag_listNot using free space on %s: Matched allocation PV tag %s on existing parallel PV %s.Matched allocation PV tag %s on existing %s with free space on %s.Eliminating allocation area %u at PV %s start PE %u from consideration: PV tag %s already used.skip hint hash but found label %sexclude md component from hints %sscan:%s pvid:%s devn:%d:%d vg:%s Wrote hint file with devs_hash %u count %uwrite_hint_file close errno %dscan_dev_close %s no DEV_IN_BCACHE setscan_dev_close %s already closedVolume %s is not active locally (volume_list activation filter?).Name too long - device not cleared (%s)%s: not found: device not clearedFailed to open %s for wiping and zeroing.Wiping known signatures on logical volume %s.Metadata logical volume %s will be fully zeroed.Initializing %s of logical volume %s with value %d.Falling back to direct zeroing.%s logical volume %s with value %d and size %s.Metadata logical volume %s not fully zeroed and may contain stale data.Scanning %d devices for VG infoProcessing data from device %s %u:%u di %d.Ignoring additional label on %s at sector %llu%s: Label for sector %llu found at sector %llu - ignoring.Label checksum incorrect on %s - ignoringClear pvid and info for no lvm header %slabel scan found duplicate PVID %s on %sWARNING: scan failed to get metadata summary from %s PVID %sScanned devices: read errors %d process errors %d failed %dFound label at sector %llu on %sZero areas not allowed for segment %sMissing offset in areas array for segment %s.Bad offset in areas array for segment %s.Internal error: Cannot find pv name %s outside of _read_vg()WARNING: Failed to read metadata text at %llu off %llu size %llu VG %s on %sFound metadata text at %llu off %llu size %llu VG %s on %sFailed to generate backup filename (for removal).%sdev/block/%u:%u/loop/partscanSysfs path for partscan is too long.Sysfs path to check mpath components is too long.WARNING: Path %s is not a directory.Failed to create sysfs wwid path for %ssearched_devnames %s file pvids %d %u devs %d %u search pvids %d %u devs %d %udev_cache_index_devs: dm_snprintf failed._dev_cache_iterate_sysfs_for_index: %s: failed to get major and minor numberWARNING: Configuration setting %s is disabled. Using default value.device is rejected by filter configdevice is restricted internallydevice is a multipath componentdevice is too small (pv_min_size)device is not in a usable stateVG info not dropped before rescan of %sVG info not found after rescan of %sChecking transient status for LV %s.;dKk PKK4OʩQR[[&k/9D|۪`l</hBU_h rP|H|<ƫH ٫,t d=`PZD"O:Y;bEl(GyG8H\IDJȭJҭJܭ4M NOO dPQ!R@hXIhYR@Z\@[f[ol^^_abc%c=eGLeQe[0fefoh|x4@4`C@5D5E5F5G6pH<6J6 K60M6 iX9m:pnX:nl:@o:o:p:q;0t;pu;0x<x@<|<}=~D=@=@=>`@> >04??`@@@TAХA BpEEFpFPFFHG0GXHlHP |IpIJdJJ`JdK`KKP"L$L&TM),N*xN+Np,O 1O4P@5P5P78QCQDRHR`LpSNSQTUTPUT VTVUZdU[U]U@_PV`hVPaVpeWgXh(Xi|XjXjYkYlYPmY@nTZpZ`r`[s[w\z\}l]~]]]^^p^``__`h````a0b0cplccpdd ede@e`Lf`f`fpfffg$g8gLg`gtggg g0g@gPg`hph(h,xp?hxC y@HypIzPJLzK|zKzL {`N|{X|Z|_l}``}e~f(~f<~gp~h~i~i~ij\lmpnqpsu0{8{x\ă`, @PThĄ0<`dp@ H`p` D``ȋpp`pp <`0 x4`ܑ`0Dx0ВDppܓ 0  $ ȕPh@ 8pܗ0 $H`x0  ̘p!""  #8$X%x%&'ؙ@($(p)* +\,-.H/014p2`3Н35T6789`@::̟ =8P?h@@AAA0BDBxCC DDPpEJ`M`NP0Q Q 0RHSSSԤSTTHU| VW̥`XpYDZgH`iħk$lh@nnܨo(@p@q`qxr0stЩu@v8 wtwpxԪy yTPz{ԫ{ }x,pH08TppЎį`4P̰ dPЖ$8L``tpIJ ز`0(dx ܳ@,@`t@ $`p`е`$LxPФж(d`PԷ0, xĸ\@@`lеĺܺ @tܻм,@T h0|@̼нP,п\ܽP 4H\PpPԾ$LtĿ<d0`pl 4``p,`@pp`` X t0P` @$DPP\p`0< xp 04p 0< d "P##@p$T)@/(2<,`=X?BDCpCD,PF0H IPI|JLRWXX@b@0d0glhk<`nuly~@0pPPX@`0,\pPl<Pd`(p<Pd|@pPd 4!p&0'|@'p''p(`)H== =pK$O0RSpW_hhkmxpnoprx@stu(wxyzP|x}PtPTPгP$\x @P4Pl@PP@D$@d`p|p(x`0 P0|0 L @!p+`4@`;YP Z [ p^T ^p ^ _ 0_ `_ _ `X `t a Pc dd @f h oqyX~0T$@px`d ,`Hd @\P`H d`0``T\8P | $\ P  @   @ l  D    `D!@!p!!! "8" X"@l""" "" #,#@#@`####@#$4$ `$Pt$!$",%$% %%p&%@(4&(H&0)h&-&@2'p4T'@VH)W) Y)0Z8*Z\*[*[*@\*\*]+]4+_`+_+a+d+fX,m,o0-w-`x-8.@T.P.к2`T220 3|3 3x44 5H5P6|66 7`77888 9pp99::`;'h<0(<(<)<@*8=*T=/=1,>2> 5> :0?CD@Cd@E@H(AHl0AlA$m0BPmB|mCmDmE@n`Fn MnMoN4o@Po`PoPoQoR,pSdpWpXqpoqvr`xs|ssp@tu@uЈu$vvxww0,xPx`yyzxz04{{ 4|||}}`}pL~P~|0 pP `%&P'`(K؅`LL(MdM`N@Q<`T؇ V8W@XXЈ Z [``[tp[[[\ȉБĊ,`d@,П\@0Č،ptХȍ@0ppĎP, pTlpX$x@Tpp(X`@̙p4 d xȚ8hP(P\ 0@P!L!h"ȝp$< %-0/ 01p02Ԡ34L46ܡ>ܢ?0@LPAABȣ0CD(E`FGԤ`HKpKpS@VXZd@[\]PP^l0_ ąabHc g<ipH vx yt{0|`d$PدГ @0P `p00`8P@d<`Ph`Ķ,`h`зp0DX|@ȹ` 'l.Ժp0$p6 709P??м@ABXBlPCC̽`D0E 0Fl0HHо@IIpJl MNpR@WX,]`^_LPe0h ii<jxn `}l@~~ЂD@pЌHp@0@L@p@|p@ p` ( \а0 @< @$Ptp@@px PpT@  p l@8@DDdPEEpZb@ z|<~Ё4p` 0|0h$`0$00h0p$0p(( 0 4 T@ !@""Xp%`&'h)+0,D485`6@8H>ix@yxz@@P(`8`T@вX`tp(@pL`H`p@  ` ,  ` ` 4   pt XP4 @L LP$$2  3H:P@;|E`Hl0JNHOPUl V0W$@XPYY(Z|0[[]0]D`_b@`eh(llmn pt`x z {x|~ P Ѓ !h!p!!@h"`#0$P$ $Х%`%о%`%@&&&l''@T(((P)))P*+,`P,,p,4-P-` .l. .0.`d/0/@/00` t11p1pH2`\22zRx $@FJ w?:*3$"D`OL\oBBB B(A0A8G 8A0A(B BBBG HraQAA N ABD _FBAH EABH  P 8BHB B(H0G8G MO  MP M\A} 8D0A(B BBBC _MYAM MP O MT j MJ <+FHB B(F0D8N ML `M\AX 8D0A(B BBBA  MQ ` MS X PP EPYAQ PP ,!dA FHB B(H0I8G MM _MZEX 8D0A(B BBBH  MQ _ ML X PP   PP |MYAyPYAi MJ _ MJ E MJ _ MJ _ MJ x ME d DJ Z JE ^ JE S QE YJ"JBBB B(D0D8DpZ 8D0A(B BBBE xK[xAp@xFIxAprxM_xFpWxMYxBpT#M#h#M.FBB B(A0A8G~ 8A0A(B BBBC H_aA^LBbKEFN^TUD MS %O\Aj LL HRCVT<$([BBB E(A0A8D@ 8D0A(B BBBF HLP[HA@$`\ZtQ K IL$\9BBD H(D0u (M HGIJ y (A ABBI %`FBB B(D0I8JO]A^ 8D0A(B BBBG M]DlQVIoNgBbMRJMuBPH8%hFBA A(D0y (D ABBH X%|jFBB B(A0A8DpE 8D0A(B BBBA lxMMxApT& l FIB B(A0A8G 8A0A(B BBBC LCaAP]A.MMPK|&8uFIB B(A0D8D@ 8C0A(B BBBC [ 8A0A(B BBBK K 8F0A(B BBBF 4\'xwEKD M DAJ n CAF L'xTFQB J(D0A8GB 8A0A(B BBBA ' {FIA D(G0 (D ABBD k (D ABBD h (D ABBG S (G DBBF h (D ABBG 4h(|FAG k DBA z DBH H($}FIA A(D0] (D ABBE D(G DBB4(x}aFHD } ABF l CBG 8$)~FBA D(D0u (D ABBA H`)4FFA A(D0U (D ABBH D(D DBBH)xFBF A(A0` (D BBBF G(A EBB\)FIB B(A0H8G 8D0A(B BBBI EBAPX*FBA D(G?MTTK^ (D ABBF P*FBA  BBA Q BBK e BBG h BBD +~K V H+x FBB A(D0 (A BBBE 8F@a8A0\h+FBB B(G0D8D` 8D0A(B BBBD ,>\EW D }l GAM E h> BBB E(A0C8D 8D0A(B BBBA N\A NJ $?+TVLExH0BBB B(A0A8G L@LI*INJQIBID 8A0A(B BBBF SICJPJPJIIdITJOIAIITJPIBIFIMJiIEIpHT6^BBB B(A0A8G I!z!K!o!A! 8A0A(B BBBH _!T!O!A!($I@8BFH AB@PI8BBA G L""E"j"b  ABBJ I@:MtI;lFBB H(A0A8Dpr 8D0A(B BBBI BxJKBNp:xhGVHDSp(J@( MYA} 8D0A(B BBBD  FV K[AbV[IaMaHBZnCx[[I[NBPFCO9FUBGJBImLTF|HoAcRIERGIIpA vN4@vdEFD  AAE J CAA 8xvLFBA A(DP@ (A ABBD HvFID D(D0i (G DBBE }(D ABBwD w@EP(0wDFDD ~ DBN \wMEP K h|w؈MEP K hwMEP K hw8MEP K hwhMEP K hwMEP K hxȉNEY J 8xMEP K hXx,MEP K hxx\F^ A \x̊EFPD E(A0A8NP 8F0A(B BBBA c8C0A(B BBBx` yȋFEE E(A0A8G@ 8D0A(B BBBA ~HRP^HA@kHRPTHA@\pyDFBB A(A0H (A BBBE Q (A BBBA `(F BBB,yԍFBA D BBO z4FBB E(D0D8D@Z 8A0A(B BBBI aH~PIHB@D 8D0A(B BBBE hHNPYHA@HLP^HB@ z8AD  AH HzԑFBB B(A0A8D@ 8A0A(B BBBE ,zKEAG L! AAK 8,{ȔBEG A(G0P (D ABBA Ph{\aAD v ABA z(C0n(B _(R0b(A p(P0R(A D{YAG ^ FAJ I AAE (R0T(A H|И FBG D(J@@ (D ABBJ HOPDXC`U@DP|ZAA  ABJ h(R0T(A G ABG 4|FAG@ DBG HRP[HA@$|AG I  AC |% } HW,$} BOP F ABA (T}FAG n DBF @} FEE D(D0D@ 0A(A BBBG (}FIG@t DBH }ZFf D i4~ԢFAD O DBH v(g0H(A |H~,FHB A(G0W8G@G8B0U (D BBBB I8E@i8A0 (A BBBH T 8H@L T8L@h8C0~\5K` I~FDD D(L0f (A ABBF D8M@c8B0g8F@P8A0D (A ABBB D (M FGKG X 8M@c8F0]8F@O LpĦFBB B(A0A8G 8A0A(B BBBB HTFBJ B(D0A8Np 8D0A(B BBBD $ (EG L!v AA L4FBB B(A0D8J 8D0A(B BBBD |bFBB A(A0G I!!N!B!B!B!B!B!B!I! 0A(A BBBC D!C!e!A!Dp>FBB A(A0G I o 0A(A BBBE <LhFBB A(G L! (D BBBI H8FEE E(D0D8D@f 8D0A(B BBBD L؁ FBE D(D0e (D BBBD X (A BBBI 8(̹QFED A(Dp (D ABBD TduFEB B(A0A8DpxMcxAp` 8D0A(B BBBB <FBB A(G I p (A BBBF PFNI B(A0D8Dw` 8D0A(B BBBE 4PD>BBA G I   DBBG @LfBAD  DBA z DBH k DBG ̃xgEJ A D L 8FBA D(J (A ABBE 8,HFBD D(J (A ABBA HhBBB A(D@B (G EBBC u(D BBB0FAD J  AABA ,,8QAC DKF C D,hBBB B(A0G I  0D(B BBBH HtoBBB A(A0G I  0D(A BBBF T}BBB B(A0A8G L@I@p 8D0A(B BBBA P BBB B(A0A8G L1 8D0A(B BBBI Ll FBB B(A0I8GC 8D0A(B BBBC (E^ E S(܆FHG` ABI ,BBB B(A0A8G L@L`Lb&bOb`bBbO bNbYbAbwbGbO R 8D0A(B BBBA NbIbHbFb[bibTbObAbrbTbObBbbGbHbAbKb@ bGbHbFbL wbCbPbAbbIbLbLbKbDBAA ([0U(F W ABF p ABE 0\FAG s DBI KDBDDFAA G I >  AABF H k J `؈ FNE B(A0A8G@-HFPWHA@D 8D0A(B BBBH  HFPE d< FBI B(A0D8F`  8C0A(B BBBJ 8A0A(B BBBP(l ̉h |dBBL B(A0A8D` hOpMxJMD\`mhFpHxFFIP` 8D0A(B BBBE `t tplN8FGD A(G@ (D ABBE ؊<FBB B(A0A8G L@I@@N@g@E@S@C@p@A@\ 8D0A(B BBBA @G@H@AAK@G@B@H@FAK@y@A@H@BAS@a@Q@K@A@I@M@F@KAO@o@G@H@AAxċ FHA W(M0c(B [ ABJ D(P0Y(F0m(A a(P0K(D A ABK `(J0H8F@K DAB(@d vFAL s DBD l | FBB B(A0A8G I | 8D0A(B BBBI O I g a N J D X L a A LD_EGP AC uGHFWB GHFB (PTFAA ABl|FIB B(D0D8GDMHRBA 8D0A(B BBBG 4hvUAA uABAP t$ FPJ B(H0A8JgHAEL]AbKcAJO_BLOCIRPC^ 8A0A(B BBBI ]MVBMVBLXA}]dBSKBN`BhNVB} fmFDMH NYAJYAF[ND($3YUL$(E^tԏ`$&FBB B(D0D8Gp 8D0A(B BBBK xMYxDpXxbPxApZxN[xApL( FEE B(A0C8JT NN HTDNPYD^ 8D0A(B BBBJ .IaB^PWDqP^B$0H@c E fHPPYHC@L(1FEB B(A0D8G- 8D0A(B BBBK Xxl3`FBB L(A0A8LPz 8D0A(B BBBE 4XK`YXAP0ԑp9FNA G`  DABG X ;|BFB G(D0D8D 8D0A(B BBBJ ]JVA@d0<BHL A(D0Gp 0D(A BBBF H|=FBE B(D0D8N` 8A0A(B BBBG L > FJB E(D0A8D 8A0A(B BBBG \DAFJB B(D0A8G 8D0A(B BBBA tLcA` FFBB E(A0D8NOLHIi 8D0A(B BBBK IFJE I(A0A8G 8D0A(B BBBE MeAPMeBhIlA NN K MV K MV DUHK\@ MV D UHKJ \OBBE A(D0 (D BBBG b (D BBBD G(A EBBl@4PDFEB E(D0A8G 8D0A(B BBBD TjAMYA|XMFBB H(D0A8J 8D0A(B BBBC MZAgMZDHcB0^Q FBB B(A0A8GHBBBADBBB] 8D0A(B BBBD DYZA YK  MR b SJ ; ti FBB E(A0A8GRaAENIASaNIASJNIASJNIASJNIAS 8D0A(B BBBH RR`BFgBFdAssFNB B(A0A8GKADDAGDDABGALGGBBGBNGBBAAGGGBLn 8A0A(B BBBF ܘw` FIB B(A0A8GzDGAwZGBr 8A0A(B BBBH kPYBHK\AK\A8oFGA I(DP (D ABBA l؇!FEE E(D0D8DPXe`EhFpIXI`EhBpHxGaP 8D0A(B BBBC ,QBJH A(F0GPVXF`BhBpBxBBBIPkXK`^XAPX 0D(A BBBE TXI`aXAPMXM`\XBPt4ĚJFDG ^ ABF GDBHFED D(D0 (D ABBH (D ABBLH FEB B(A0A8JfFDIHPiDDDAKHSNGFKPOIAPrYIDPcJbAOy 8D0A(B BBBG gPLBDAXQQHK]QKCXTVLAXWiGGBIlVDDDAKJSPJIK`wLMADFFVRANDUl NGBDHE QQEDHPp QAAJ Z^XAOgM_A_NcEBIH_(\bFHH zAIĝFBB B(A0A8J 8A0A(B BBBD XKUCYNUBLWAL `t BBB B(A0A8G L))B)B)I)A)E*N) 8A0A(B BBBE x)J)N)B))V)W)B).)W)M)A) ) 8EG AB 0\FAC GPm  AABF D$FBB B(A0A8D@8A0A(B BBB(؟HPr F IXH`DhBpIP(`$EAG AAB D0dFBB B(A0A8DP8A0A(B BBBXx SFJB A(A0G 0D(A BBBK z 0A(A BBBF ԠYEy B XPK A (eFFL b DBA <(FFBB B(A0A8GFU[KlwID^ 8A0A(B BBBE dFHD@OSDMODM'POAHFBB B(A0A8DP} 8A0A(B BBBG lD`FBB B(A0A8DFUEL 8D0A(B BBBE FFA4FAA G I   DABD dȽNFBB A(A0D` 0D(A BBBD ThRpWhN` hRpK hOpWhA`HTfEDG0h 8O@I W8M@V8F0j AAD P8O@T8A0~FBB A(A0GHeA 0D(A BBBF DN\BM AJ LaC,$uFAA  AWT hT QFEE A(D0Gp 0D(A BBBE xOWxApQxRWxNpd xRJ t@ D 8ܤBGQJ DBF DJYA EN E C <hFo K f A L`FHN ` DBF I(H0^(A G ABA U(M0M(A (DRET G IH ^AA\ܥxFLH D(D@ (D ABBC IHIP^HA@PHIP^HA@HHNPYHB@p<)FBG A(D0[ (D ABBH h (D ABBG X 8H@P I8H@a8A0G(A ABB dk A o A @ԦP FSI J(A0A8G 8D0A(B BBBD MXA5JDGNsHPNIKUAIKYAIN\_bIVZZS|PBW IXUJ LqB4\FL[ C ABE d MLK $QFBB B(A0A8G L@I@ 8D0A(B BBBG t@MA\@B@@DAQ@A@@DAQ@G@B@AAU@A@Y@_AI@A@R@MA]@B@ بZTzH0hHI G r F h H j F g40TuFIA S BBI c EBF hFBE B(A0A8G@zHQPYHA@T 8F0A(B BBBH h 8C0A(B BBBD oHKPRXH`W@F 8A0A(B BBBE qHNPOXF`K@CHNPOXF`K@@HNPOXF`K@~HGPHXD`<%FBG E(H0D8G 8A0A(B BBBD WOTCl PQaRK WTOA4BBB B(A0C8GPjXb`UXAPIXm``XAPNXG`XAPGX\`UXDPI 8A0A(B BBBD HXi`RXAPIXk`LXAPBXB`kXEPmXf`yXBPF8A0A(B BBB P,g~ExDܫhFAH K ALI O ABF B ALI $fF_@@dEDQ Y AAK ^ FAK ^ FAK @FAG ` DBD A DBA sDBHȬEDD _ AAB p CAD i(M0\(A FAAL0FAG (N0\(A D DBK s DBG f DBD dб  |x%lFJA C(G0V (A ABBI D8`@8A0B8B@h8D0N8`@u8A0F(A ABBLFBB B(D0D8G  8D0A(B BBBF Ppab E (&FHG0 DBF LFBB B(D0D8GM 8D0A(B BBBK pdFEE G(A0C8G` 8D0A(B BBBB hmpPhA`LhppLhA`BhBpfhB`|֯`\ ?FBA u(L0I(A o BBI V BBF c BBI s(H0^(A s \ D A K F8 ^XL( FNE B(D0D8J 8A0A(B BBBB LM^A\ TFBB B(A0A8D= 8D0A(B BBBD G^D{ \(FBB B(A0A8D 8D0A(B BBBD GaA \^(VeQ M(C0NE A |<FJB B(A0C8J  H g B ] J X D [ H ^ E  8D0A(B BBBA h/ 8FAD f ABD Y JBC IJزجhtgHFIB B(A0A8DP 8A0A(B BBBI drP\p FBB B(D0A8L 8D0A(B BBBF CRAT %FBE D(A0Dp 0A(A BBBH xHGBIp< pP\X'PHA H ABD (e0Z(A G(J0\(F C  <̴,1FAD GPXk`LXAPT  AABJ ( -FDG  DBJ 8,.oTZTP.c]BA { BBI D EBE Q BED `C T  ĵ/wLص/lFBD A(D0 (D ABBE \ (D ABBK (( 1FAG0 DBG <T1FAA G0  DABI X8`@O8A08p3"FEA D(G0Q (F ABBE \жd4-FBA D(G0c (C ABBA m (A ABBE l(C ABB<045sFBA A(G I  (A ABBD Hpt6FBB E(A0D8F@ 8D0A(B BBBF ,8FDK  ABB   t\:FBB I(A0D8GpxKWxAp;xCIxBpQxLVxAp 8D0A(B BBBI `>FBB B(A0D8DHJJIa 8D0A(B BBBD ,E <,E5PAA G0S  DABE |8G@h8A0XlGFBA D(I0g (G DBBD h (D ABBG e(D ABBXȹLHRFBB B(I0D8Gpc 8A0A(B BBBC xeHxBp$ pD0fTX lhftff(f^pfFIB B(A0D8DPXJ`JXAP@ 8F0A(B BBBG x 8C0A(B BBBA (0hWBGG M DBE \h1HV D(B0L|hBEE E(D0C8GPI 8C0A(B BBBD PXM`PhApAxFFITPa 8A0A(B BBBE  8C0A(B BBBF 4\kFDG h DBA W DBC XPk3BBB B(A0A8DPXK`DhBpIPs 8D0A(B BBBB (lAK F AE m AJ ؼx  l4mNBKB B(A0C8DP 8F0A(B BBBJ jXK`^XAPF 8A0A(B BBBA l`nPBB B(A0A8DP{XO`^XAPX 8D0A(B BBBF XN`]XAP XI`U LнpBBB B(A0A8G L" 8A0A(B BBBA l saBBB B(A0A8G I  8D0A(B BBBE g n [ A l A H O PuBBA D(G@HMP\HA@X (D ABBF  HKPP v@(yABAD0 DBG P,{}ZBD A(D0c (F ABBE  (K DBBN L~nFEB A(A0 (A BBBB p (F BBBD Xп$,FBD H(G0p (A ABBG j8D@H8K0U (F ABBG p,FIA D(D0p8L@^8A0F (A ABBA R (F ABBC W8I@l8F0D(A ABBd3FBA A(D0t (A ABBH g8M@\8A0F (A ABBC \8M@LHNPI0\pBp F w(H<hFBB B(A0A8D` 8D0A(B BBBH dpFLE I(D0D8I@IHEPFXI`K@S 8D0A(B BBBG xHUPHHA@,FEG C ABH 4PaN A bA\ẊFBB A(G0[ (D BBBI  (D BBBG s(D BBB(F] M Z F f J lt FBB B(A0A8DpjxdPxBpx_RxBp 8D0A(B BBBD xM`xBpL\ؒFIA D(D0U (D ABBJ e (D ABBB 4FDN R LBH g CBD FBB B(A0A8D 8D0A(B BBBG P`BMYAMZBK[EIPFA8FGE B(A0t (E BBBD .BEE E(D0A8GOJVA2HPAD 8D0A(B BBBG n[OB\SB\SBp^Ц.FBB B(A0A8J)CNBWiLBLTIBbLHBI 8D0A(B BBBA IrHHAAFPLTESHlDsLFBIMHA[KJA[VWFBxUFAvZHEBBI^MBaM\AJDH`xPEEMbPZHEM\AAIEIMdAx MR  MbAXAFBE B(A0K8DPh 8D0A(B BBBD QXL``XAPH FBB B(A0A8DP 8D0A(B BBBF @XLFUB A(GXr`KXAP} (D BBBF (FBE J(D0D8GO[AuGHDBBNRKANRBKQI 8J0A(B BBBG uKJBBBBGBEQV 8D0A(B BBBD DKPBVGANINA ,+BBB B(D0D8D`mhupYhL`ohHpGxHN`ehUpQhA`chMpDxAI`J 8D0A(B BBBH DhEpJhD`JhIpchH`zhBpGxAM` `X FEB E(A0D8F 8D0A(B BBBF RInA 0$8FPI A(D0T8D@R8B0f (A BBBC 8N@KHNPK0F (A BBBF  (C BBBA 8j@}8G0@;FBB B(A0A8H Q GeBm 8D0A(B BBBE IqcCP\A]IBBBBNdrIFF\ATTYA%H_AGN[AkcADeMBKGHKAKAN[BS]IBGNFA"KGHKDHANRINXAHU^B 08$`1FDD n ABA I JBK \`1BKB B(A0D8K6 8D0A(B BBBD CMA8t4BBD D(F0t (A ABBD Ց0H5/FME E(D0A8Dp 8D0A(B BBBA Ld6:EDL w FAE i FAH h FAA p CAA 0  7F H lx8,FBB E(H0A8DPrXK`AhBpBxBIPXM`aXAPD 8D0A(B BBBF (\8;WEM F Mb MAA(l;WEM F Mb MAA(;FIB E(D0D8GChB 8D0A(B BBBG ]NECUEELLaChE4PTB\ZAPTD|CZBEVAOTBOlAa EE ($RFBE E(D0D8DH 8D0A(B BBBE K^AHqDHGBIHLZ:BBE E(D0H8FPq 8D0A(B BBBB h@[MFBB D(A0FppxWYxEpmxI\xAp 0D(A BBBE Ix^RxDp`$^FPI D(A0GXS`RXEP^XE`hXAPX 0D(A BBBD XL`]XAPr XK`M D XJ`Z L XV`V Y XI`F aFEB B(A0D8J\WD 8D0A(B BBBE PH`EtGEBBBABBBNZUA` ZE (f:EC M D jkdc UT 9FBB A(D08B@I8A0A (D BBBJ @>;!ECG Q(C0J(A v AAJ KHH$?pERD  DAA W(g0L(G f GAA h GAH H(g0u(D P(g0[(A Hd@@/FBB B(A0A8G` 8D0A(B BBBA X@GgFBB D(A0m (A BBBE {8L@^8C0t (C BBBC ( AHHg A ]R YCv G @8AIEG W AD P(M0T8T@K X(M0T8P@I 4|AJEFG w AAE D FAE |APKBGJ G(D0A8GxB!vvA`edCr 8D0A(B BBBE d4BPFBE B(A0K8G`hmpvhD`X 8D0A(B BBBF hypWhG`B# `\BHU FGB B(A0D8J  8D0A(B BBBK \ P N A pCZyFAG DBN cGHFW| GHFH zNOFKn OBE DC]FDD O ABH y(N0O8F@K FABTC]qFNQ RU  AABH mROA`POAx0D^FBI B(H0D8DPXP`OXAPaXR`OXAPL 8C0A(B BBBH D8F0A(B BBBdD`FBB A(A0G 0A(A BBBC TROAqNKA(Eade G PM T(T0K@E$bFFB B(A0A8G% 8A0A(B BBBH TOAdTPBhRPByTOAEDdFLB E(I0C8QlGQBTOA 8A0A(B BBBC TOAwNOFK}NOFM(xF|gEDJ DAA 8FPhNAD u AAF d FAA N0FhEIN K AAG kCAGPiWEy R F44GiVFDG0\ DBE [ DBG plGj+FBB E(D0D8G`hQp_hH`L 8I0G(B BBBL c 8C0A(B BBBA (GtqEAJ DAA < HXrFKG B ABC i CBB DCB(LHr|EAD k AAA (xH sFAD T DBK HtFDK A(I0z (D ABBF W8M@PHTPK0r (D ABBJ S8M@THTPK0G (A ABBH e(D ABBp0IuqLNT L(G0G8G@Q V BBF  LNK (M0P(A c (K0Q A LPO ALNI wbEVpItwFAA { ABJ [(T0O(B A ABD T(O0Y(A A ABG L(F0`(A AAB,4J xLDA Q HBD (dJxE{ P PF `AKpJTyFPR G0\8G@GHGPQ0j  AABA d8P@S8A0%8L@V8A0\8T@P8B0I8M@X8A0K{9Ha G D$K{FBB B(A0A8G L@I@L 8D0A(B BBBE [@GA^@B@{@HAY@A@|@MAPAPAI@I@MAU@A@i@FAKAFAN@K~AFBA A(Dpg (A ABBE xROxApuxKO[PpxPOxAp_xPWxBpQxP]xBp\LHZ F xL,TuLTuL\u LHT D m C UL0TuLTuM Tu ,MH G t D PMdTu hM܇H\ D u C MxTtMTuMhTuMDF F tMDE G tNd{ A t4N@d{ A tTNd{ A tHtNFBA D(G0z (F ABBG i(C ABBHNFHA D(G0t (F ABBG i(C ABBH OhFBA D(G0S (F ABBF q(C ABBLXO܎FBA A(G0[ (D ABBK @ (D ABBG LO=FEA A(G0k (D ABBH J (D ABBE LO|FBA A(G0Q (D ABBE E (D ABBB HHPFBA D(G0C (F ABBF A(C ABBLPFBA A(G0W (D ABBG D (D ABBK LP@FBA A(G0W (D ABBG D (D ABBK L4QZFBA D(G0d (F ABBE  (C ABBG HQFBD A(G0J (F ABBG y(C ABBHQtFBA D(G0C (F ABBF A(C ABBLRFBA A(G0Q (D ABBE E (D ABBB 0lRETG p FAI iCALRFBA D(G0q (F ABBH i (C ABBG 8RFGH  FBI  CBD L,S8FBA D(G0q (F ABBH i (C ABBG 0|SFGG H DBF fDBHStFBA D(G0 (D ABBC k(D ABB0SEDG v FAC ]DA40TFAD g UBG IDBLhT,FBD A(G0[ (D ABBH  (D ABBK T  0,T*FDA  ABH 0UFDG ^ DBK xDB8UlEa J bHXUFBA D(G0t (D ABBG H(D ABBU#UU0UĠ{FJN N JLN eCB0V{FJQ N JLK eCB0HV\{FJQ N JLK eCB4|VFIJ u GEF bCB4VFIJ x GEK bCB@VXFBD G EBF h BBD eBBd0WԢiFBB E(D0D8Gp 8A0A(B BBBK  8A0A(B BBBG `WܧyFEE E(A0A8Dp 8D0A(B BBBK y 8A0A(B BBBE HWSBBB B(A0A8D` 8D0A(B BBBA HHX FBE E(A0D8D`O 8D0A(B BBBI XFXDXXX `XMFBE E(I0G8DP 8C0A(B BBBF _ 8A0A(B BBBG HY̮%\Y%pYYHYFBD A(G0W (F ABBJ y(C ABB0YFAD D0[  DABG (Z FAG0W ABH DZpkEG S FK (hZJDI l FBE HZ`EDG Q FAH r FAG d FAE ZFAHZ$EDG Q FAH r FAG d FAE ZFA,[ FJB E(D0A8Dp 8A0A(B BBBD xL[xApxFCGNpZ xIL L xHH AxOSCNp[ px[0FBE E(D0D8G@ 8F0A(B BBBH e 8C0A(B BBBG L 8D0A(B BBBG \`\FED D(G0 (C ABBK  (F ABBA [ (F ABBI @\EGG H FAF r FAG c FAF D](FLD  FBE c FBE n CBE (L]yEDG x FAA Hx]EDG F FAC c FAF Z FAG SFA]p\k]E H d]lk^@E C r4^]kL^xE G rl^(Mk^Z ^ #Eu F S E ^@ ^E} F K^" _Tk(_ 0<_(FDG P DBI fDBHp_FED G(G0Q (J DBBH @(F ABB0_FGG H DBF fDB0_TFDG P DBI fDBH$`FED G(G0c (J DBBN P(F ABB4p`4EGG G FAG [ CAI H`BEB E(A0D8J 8D0A(B BBBF `: LapBEB E(A0A8G 8D0A(B BBBE da @a qFBE D(G0GP 0D(A BBBG @a\qFBE D(G0GP 0D(A BBBD @ bqFBE D(G0GP 0D(A BBBG @PbqFBE D(G0GP 0D(A BBBD LbFBJ A(I0J (D ABBA E (D ABBB LbFBJ A(L0N (D ABBJ E (D ABBB 4c`FBB B(D0D8DHYP]HA@{ 8F0A(B BBBG e 8C0A(B BBBG h 8C0A(B BBBD clH ^ J cH S E cdNH @ A  dQH C A (dQH C A Dd H  B `dH  H |dZH L A dZH L A d@NH @ A HdtFEE E(A0A8D` 8A0A(B BBBA HeFEE E(A0A8D` 8A0A(B BBBF Hhe|FEE E(A0A8D` 8A0A(B BBBF HeFEE E(A0D8D` 8A0A(B BBBF fSFEB B(D0D8DHYP]HA@n 8F0A(B BBBA e 8C0A(B BBBG h 8C0A(B BBBD f`4f-ffffpf5g$$g 8gLg;`gRtg@9gl<gFg<8g^FEE D(H0m(D EEBh$0h@U(h]#T0># FBB B(A0A8D3R]BV 8D0A(B BBBG DV[Fq RR NfAN_AkXHFFBB B(A0A8G`I 8D0A(B BBBE lhQp`hH`4pMEFD  AAE J CAA $|N\t H QN YJ8ЀNNAG h AAH L AAJ XL xOFJG (A0G8A@I P DBJ N DBD iDB<\P]BB A(A0(A BBBF 0Q|Ev$؁QOH I i G [HRFBE B(A0D8D@U 8F0A(B BBBD 4LSFIA M<  ABBB (THH H n J F J j(4UFAL e DBB ܂U\VFEE E(A0D8I 8D0A(B BBBH NeApPTZ'BBB B(D0D8NHHBNKLBO 8D0A(B BBBA ă`FBB B(D0G8DuJIBI5K[AR 8D0A(B BBBG |M`A|Hc BEE E(D0A8GXLGKQOWA} 8D0A(B BBBI I SE (Ȅ|lHP]XD`GhBpLPh J mRFBE B(A0D8Dm]BNjKBEXH 8D0A(B BBBE tLBEX`|nFHE E(G0A8JMMDIq 8D0A(B BBBF (4qvFEJ e BBB H qFKA D(D0p (D ABBE f (D DBBF lXq0FBB D(D0z (A BBBE D8M@OHGPI0^ (A BBBC D (C BBBC \Ȇr^FBA D(D0F (G DDBH  (C ABBH E(C ABB(sFBB E(D0D8DpUxKBBIpC 8A0A(B BBBK MxHBGSpWxTBGSp<uFJE A(A0e (D BBBJ (uEpe FAA F d(,vEADM AAG HD w4FEE E(D0C8GPk 8A0A(E BBBE  PwFBB B(A0A8G L""I"G"A"N"k 8D0A(B BBBC ["T"O"A""["M"G"["#"c"K"A""M"n"B""M"K"N"K"t0}FBB B(D0D8JUCDI@ 8D0A(B BBBI TLJGINKPRCIDIdfNBHEJNebMDLe8`DBGD o(I0Q8A@J D ABH ؂Z FBB B(A0A8JAHHgJ 8D0A(B BBBE zPVEGHASJ[HBADQI\AV BHFOpKHAI [HBADQ|MDRKFAH h܋BEA D(G0 (A ABBH 8I@^8A0I (A ABBE h (C ABBH HH0d`BBB G(A0H8JLGFIv 8D0A(B BBBF KeDbMD 8BGD } FBF b CBA pDPBEB B(D0D8JDTHWXxJ\A 8D0A(B BBBI d؍bBMH H(Og (D ABBB rQHHKNHAK@RBEL H(A0A8QK\Is 8D0A(B BBBK  JOAK+TPAqTOBbMQBlNHAKO`LBBB E(D0D8GR 8D0A(B BBBG /GHAOl؞BBE L(D0A8JsDOOAFDDRqKKDIULKDITDDFFFSMaAFLNDIANdAT 8D0A(B BBBH tODDILl FBE E(D0A8D 8D0A(B BBBG ܐH FBB E(A0A8G 8D0A(B BBBG zLGFNJEBNgeMAh\6 FBE J(A0D8GsLcA 8D0A(B BBBF KABNPUATN]BFP\AP\AN\AHIBXsHIBXPJFV NM [dD`FBD D(D` (D ABBH ohRpZhA`?FJE E(A0K8MONANz 8D0A(B BBBF \PRDIcPWA|tpFBE E(D0D8Dp 8A0A(B BBBH W 8A0A(B BBBO  8C0A(B BBBD D?FSF H(G@yHXPhHD@c (A ABBD <P FEB E(D0G8Dv\XAw 8D0A(B BBBH YKBoFAcGBrVGBmNGB? ($(ED0t AB  YG tP}FBA B(G0o(D N BBI j(M0Y(D q DBE D(M0Y(E N BBO (M0Y(D ,ȕ FBB B(A0A8GhCfEIIMDInKKDIeDDFFFX[PAKKDI]IcA3 8D0A(B BBBG 2[QAVMdA[QA[PAMcB\FBB D(D0GQDDIZDDFFFMY 0D(A BBBE DODDIrHDDIllFMB B(A0A8DPXK`hXAPP 8A0A(B BBBA a 8O0A(B BBBE CFBB B(A0A8G L"y 8D0A(B BBBI "K"_"A""B"M"W#P""K"D"G#e"g"E"K"C""e"F"D"x"T"b"B"Q"M"Y"B"ؘ\7 FBB B(G0D8G 8D0A(B BBBH  8G0A(B BBBI AMRHIHLAHQYNKGoN[A\OA\ mFII B(D0H8DP 8D0A(B BBBE KXT``XAP[XT` 9FEE A(D0Fp| 0D(A BBBF  0D(A BBBM zxHMRABXpx`OxAp4x`OxAp,FFB B(G0A8GMbBBHKANFIHIHIAM^ 8D0A(B BBBJ BGKANFMHIHGHIjFQASFaAR KJ  PT l PT [\PBě0 ؛, ($2Dm4LeFBA E(D0G(F ABBP!HUh!HUEP8BHG D(GpT (D ABBG h@t FHI D(D0Ip 0D(A BBBF DD@FAA g ABF e ABH k ABJ lFEB D(A0 (A EBBA b (D BBBD b (D BBBD e(D BBBQ 0<FII H(D0R8u@e8C0N8b@R8H08J@B8B0J8h@`8C0N8h@S8H0i8O@G8D0b8h@T8D0I (A BBBK D8N@Z8B0Z(D DINdО!FHB B(H0G8I 8D0A(B BBBB  8D0A(B BBBE D8'7FAK  ABH h ABE - ABH .FBB B(D0D8J 8D0A(B BBBF LHJKNJGBNVOuAf MO B 4P6rFBB B(A0A8Dpj 8D0A(B BBBG x[WxBp xOVxAp^x[[xBpdxTOxBpYx_CFKpH̠8:FID D(D0i (G DBBE }(D ABB:",:'@:$0T:BKA G  AABA X|;BBA A(D0v (G CBBJ e (D ABBJ D(G DBB`<FBB B(A0A8J 8D0A(B BBBE MMDKHLO \HO ,pDOCEG BQ" G  D]<FBB B(A0A8G 8D0A(B BBBE wL`DuEJIAIHQAIAHQLbAM JI p`uFBB E(A0A8DOXDFkSAMMHMHIABAD[vSSAs 8D0A(B BBBK ` LT DPTBJMYA`@bhFBJ E(A0D8J 8D0A(B BBBK lMUGIcFBE B(A0D8JjAMK^ 8D0A(B BBBE R[Av RN  RR d,fFBB E(A0A8Gp 8D0A(B BBBK xJHGABIpnrFBB H(D0D8GPRXM``XAPoXB`MXBPG 8D0A(B BBBK DXM`eXBP* XH`V  XX XC`aXEPq X[`H  XP`MXAPhXT`PXAP[XC`^XDPT@vLhvFBB B(A0A8G L! 8A0A(B BBBE X|yFIB B(A0A8DRcCX 8A0A(B BBBK H@{FED H(I0z (A ABBH q(C ABBH`{4BIB B(A0A8G 8D0A(B BBBB d|BBB H(A0D8G 8A0A(B BBBH  8J0H(G IBBE ~D EL0FBH B(A0D8G 8A0A(B BBBD @FLB A(A0G 0A(A BBBA LĨFEE D(I0f (A ZBBF  (A BBBG 8 TFFD A(G` (A ABBH XPDFBB B(A0A8D`r 8A0A(B BBBB ^hRpJxGR`d؅ZFHE B(A0A8J 8D0A(B BBBE N 8A0A(B BBBH LІFBB B(A0A8D 8A0A(B BBBA DdmFSI B(H0A8 0A(B BBBA `8FEE E(G0C8IP 8A0A(B BBBG t8O0A(B BBBHdFBE I(A0A8Gp 8F0A(B BBBK L\(FAD Y(O0^(A W FBG L(G0^(C A ABH @FGD GPv  DBBJ GXH`HhBpIP@FHA ` BBE { BBI vBB$4pqFV D U K \ȕ pĕRHy PF%FBB B(A0A8GHhAK\B 8A0A(B BBBA JJgBI`AHcBH_D0 HO HJINhIBL`Bm MM { XE g XE HBBIpHBBIK^Aq MJ  IJ n jM [N]BMn(<uFDD l ABC 8htFEA D(G0H (D ABBH 3 04$nFJD O ABJ zAB\EM`EM0dEMLhEM4hlnFJD O ABJ zAB,FEG0_8u@IBBE0Я)HP P()HP P,<FEG0_8h@IBBJ0<8FBD D(G (A ABBH pxlFBB E(D0D8D@qH`PFHA@M 8A0A(B BBBF [ 8J0A(B BBBJ X<FBA k(m0F(A F BBF } DBE ~ BBN T BBE @HFMR G(A0F(A F BBB ~BBPFED \(m0F(A F BBG V BBF T BBH 8FID  BBA \ GBK 0hODG ~ABEP lPFEB B(A0D8Dp{ 8A0A(B BBBC kxEDJUpjxNTxAp<TFDG T FBC \ ABA eFBxmFBB B(A0A8DP 8A0A(B BBBE $XJ`GhBpIP=XJ`IhBpIP?XN`iXAP|e P|>FBB B(A0D8Dp 8A0A(B BBBA  8F0A(B BBBE e 8F0A(B BBBA hA\ C ]X<BIB A(A0q (A EBBF E8O@W8D0A (A BBBI S 0\<FBE A(A0G@`HNPZHA@  0D(A BBBK HSPZHB@X FBB B(A0A8J 8D0A(B BBBH Matv8 cFIE A(J (D BBBI Lĵ@FIE A(A0X (D BBBH w(A EBB,]DA  ABH D 8X;FJA A(D0 (D ABBA WdFBE E(D0A8G` 8D0A(B BBBG , 8M0H(E BBBL $`dDFBE H(A0D8D@' 8D0A(B BBBF s 8G0C(G BBBN  @H̷FBB B(A0D8GR 8D0A(B BBBI p,OBBE H(A0A8GP 8D0A(B BBBK }XK`HXAPXD`nXBPaXi`OXDPP(BBE E(A0H8GIDEM 8D0A(B BBBA %NRACVAEMXHAG\B`GTANoBKNB; mFIB E(D0D8DP= 8D0A(E BBBA X 8A0A(B BBBF c 8F0A(B BBBA  8F0A(B BBBA H?P\htFBB B(A0A8GbIaD| 8D0A(B BBBB Ⱥݮ xFIB B(A0A8D@`HMP`HB@D 8D0A(B BBBG a HMPR sHFPTHA@#HFPTHA@dJ @H` A 4$ FBB B(A0A8G L@LB 8D0A(B BBBF BNB_BBB'BRB\BAB@BNBUBICKB 0(BdT#BBB B(A0A8G L@LB+ 8D0A(B BBBG BLBaBAB$(B\ܼ,BJB B(A0D8JKGTA\ 8D0A(B BBBA <2HBFL I(D0D8J [ 8D0A(B BBBI I Q S D M E S F s [ W E 3 i R A } U V B { R U A  J D B I I B I V  J K H \ d b W D  O F H \  K d H  G F A V K L B  F T A  F K B m F L A Y F L B ̾<  DXO%FBD D(D0E (A ABBA `8J@R8F0<4@PFDG W(M0T(F I ABE {FBxtPFBB B(A0A8Gp 8A0A(B BBBE e 8F0A(B BBBA h 8F0A(B BBBA S.H\ I (S.H\ I(pFEE B(H0A8GZDiAJY_D 8A0A(B BBBA t@YFBB B(D0D8G 8A0A(B BBBH \ADTL^DEPHRA+PtBPeGodPAO[VGZeFy[xAdG  RHy PRHy PSEMTSEMSEM8SEMT SEMpdLJ eHHPFDD J ABE  ABI k ABB m ABH 4LFBD k BBE RGB40FBD k BBE RGB0hmFJG M DBF vDBDX{FGA  ABG Z(K0^(C A ABF 2H` I7He I2H` I$8H s(\0F(A T F `d"HM L|x"HM LTFLB A(A0GvcRD| 0D(A BBBE @TFIA JrcIAe  DBBJ @4 AFIA Jr_IAe  DBBF <x,FHA G@qHiPOHA@Y  DBBG <FHA G@qHiPOHA@Y  DBBG @lFDA Q(n0O(A I BBI nBB<SHY G j\Hg A N J T|QFDB B(A0D8D`hhpFhA` 8D0A(B BBBB DJFEA D(D0k (D ABBH 8L@^8A0BBB B(A0A8G I!!T!_!B!I 8D0A(B BBBG "!W!M!A!!R!Y!A!p BBB B(A0A8G L! 8A0A(B BBBB !V!{!A!B!A!Y!A! FGB B(D0D8GC 8A0A(B BBBC IKAMOBSWA#|FHA A(D0J (D ABBI U8D@U8A0v (D ABBB Z (D ABBE (D ABBH<8FAA D08H@^8A0m  AABG V8M@c8A0 ED b AD h[4 EAG q AAH k FAF 4EHG E AAE mCA04s(DsFDD ~ ABA $ppFGD XDB<=Ew$`]FGD EDB(El G M K R F L$,FGD DB$0]FGD EDB$X,FGD ~DBHFKA JZEB\C  DBBJ DDFKA JZEB\  DBBA D(FKA JZEB\  DBBA lpFAA GPxXB`AhHpDxNIBACCANPX  FABJ GXH`GhBpIPXFBB B(A0D8G@?HIPOHA@A 8F0A(B BBBH <*P (dFAG0E DBG (FAG0E DBG xHRXE` K gXEe F g( <XE` K g\XXE` K g(|Er I g I m C lXE` K g PE[ H gPE[ H g$BEAG rAAD0,Ef`D%HY<x\EAG y AAH ^ AAH KFAHR(,EOZ[ FAH 'LFGE B(D0L8N 8D0A(B BBBD d`$FEE A(G0q (G EBBG Z8M@\8A0G (A BBBF e(D BBBXFBA D(D0 (D ABBF  (D ABBI X8M@X8A0D$~KAD b ABK D(K0^(C AABD(lHLKR_FW H 4lEJgNdFW AA i`{J} I j\_FGD D(GHZBFTF^ (A ABBE <dFFB D(G (A BBBK H0 (BAA GDICO  AABE  !FBB B(D0D8DSPAg 8D0A(B BBBC V_B$SYBPELFBAR|hBJVADHFHFKx~B!BFA{[EKEHIAIIaA_H|EicCISBXeMHnCmBFkAGABBkBh IV  L,eFBE D(D0K (D BBBF n (A EBBH L4.eFBE D(D0K (D BBBF n (A EBBH L0/ FBD A(G0~ (C ABBF { (A ABBG /ZEJ D AA ,0EN A AK 0mEJ W AA @D1NH @ A \x1EJ F AJ (1EAG0Y AAH h2eEJ O AA (2FAG0r DBJ (3FNG ` DBG ( 4fSL@d5FQI H(D0A8G 8A0A(B BBBA `8FDB B(A0A8D@f 8A0A(B BBBD | 8A0D(B BBBG lP:FHE B(A0K8KDdACPG 8A0A(B BBBA ddAFBB A(A0D@P 0D(A BBBE i 0D(A BBBD HgPQHA@XBFBB B(A0A8G L@LE8EKE^EDE{ 8D0A(B BBBA vE\EVEAE}EHEFEAE\EA EHEFEFEB lIRGHlJy FBB B(A0D8D@ 8D0A(B BBBF SRHy PlS BBB B(A0A8S 8A0A(B BBBK MaAMgA<`Xy3FBB B(A0A8JKXARCFZ 8A0A(B BBBA \FHGADPCGIAIBAKePMFN~FCIIeMCFUHKADANPMFNKCFS<CFAHDBBPMJADCFNLHIBAKHCCGBPFDAIBIH\AKBANMGADAPMFCPkJFCIBIZESBcLFDAIIMHFKEWBJGBPoHCGADP[HJGBAKsEWAWMWBQWBPZHLĈBBA D(G0@ (A ABBJ H (A ABBB TFBB B(H0A8G`h[pVhB`ZhRpOxCN`Xh[p\hB`RhRpOxCN`hCpxhF`X 8A0A(B BBBD hCpxhA`(čpH} K DM IADXFBE E(A0D8Db]TAq 8A0A(B BBBF t|FBB B(A0D8DpxHGFKp] 8A0A(B BBBF t xNV xN`xFp$FFB B(D0D8DpxWKBSpo 8A0A(B BBBE \ xNN xO[xFp@ xOM HPBBB B(D0A8GP 8D0A(B BBBH D`FHA D(G|_Hh (D ABBB 8lFDD  ABG  FBA <FBB B(D0D8D 8A0A(B BBBG LHJIIDAJNNOGSM\Acp@FBB G(D0GRNQA 0D(A BBBG RJGQAH[l x,hFBB A(D0GpxbWxAppxBJACBIpX 0F(A BBBK exHJBIpP|[FBA A(D@HSPKHA@Y (A ABBH UHOPTHA@HBEB B(D0D8GP 8D0A(B BBBA dH\BGG D(A0GH]PLHB@[HLPdHA@ 0D(A BBBG HiPHHB@tIJBEB E(A0A8Gp}xLTxBpxFZxBp2 8D0A(B BBBH xP]xBpD(<FBB A(A0G 0A(A BBBK HpiBBB B(A0D8L@5 8D0A(B BBBE LؾnFBB B(A0A8Do 8A0A(B BBBE T FBB B(H0A8DpxJLxAp_ 8A0A(B BBBE d@FBB B(D0A8JUMhAMdB 8A0A(B BBBA  TZ \VBMlDtK_EmeMBP(|FBB B(D0G@HNPXXF`K@c 0D(B BBBK |FBB B(A0K8DPXK`nXAPXD`xXBPXE`wXAP] 8D0A(B BBBF XK`_XAPXK`iXAPRXP`\XBP"XM``XAPZ XO`L D XK`Z K XM`Q <FEE E(A0D8J 8D0A(B BBBK H^B.TADI3_BBI5THHNoTOA@PHHK(EDG G AAG 0EG U AF T0EG U AF XxFED D(D0z (A ABBI D (C ABBD D(J ABBRHy PTD^BBB B(A0A8G L@IA< 8A0A(B BBBD |HLBHB E(I0D8I\ADXH_AW 8A0A(B BBBH DMWC`|2BBB E(D0D8GP 8F0A(B BBBI t 8C0A(B BBBH D,X/FBB A(A0G! 0D(A BBBA Tt@FBB D(D0I 0A(A BBBG KcAg FBB B(A0D8G^{AX 8F0A(B BBBD r^FBLIOCDBBBBIjF^BGpLV[VAQWABrZQD?KHAPYLAD$HME IDTFBB A(GPXH`DXAPc (D BBBG xHFME E(A0D8DBIAP[ABAPc 8D0A(B BBBF p#@FAA \ ABI O ABF uFBXJFY A i@<EFG } AAG p CAD k CAA <4 #FBB B(A0A8J 8A0A(B BBBA 1 HFI`IAKQNL MIBLBHCFXGHHQENBBBABBBQ_KFI]RAJTAFFA;s*bFBB B(D0D8D%E|BQYA 8D0A(B BBBA C QJ FMFJAJKIUMFKr T2 FBB B(A0A8DN[BQMZI 8A0A(B BBBG ygxAaTWBVHANYBXKXA^YA`AHA KS TVBMYAN[A SE ^ LL m SE qMWAh0? FBE B(A0A8D 8F0A(B BBBI AOHCIIHOCCIIoNIACFIdAODAIIwiXIbHOFCFIuVHFIdB\APJTNAFImB]DhOVKI[IOFIDptG FBA A(D@R (F ABBE HMPXHA@ 8A0A(B BBBE D 8I0H(G IBBO pLFFB E(D0D8F 8A0A(B BBBF BFDGFDJFBB B(A0A8G L!w"L!I!A!S"G!B!s!R"O!A!W 8A0A(B BBBH W!T"O!A!|PćFBB B(A0A8G I k Q c B ` Q H D z 8A0A(B BBBH W T O A ԈFBB B(A0A8G I!!N![!B!A 8A0A(B BBBD G!J!\!A!_!K!_!D!K!K!^!C!W!`!I!D!a!P!O!A!DFFB H(A0D` 0A(A BBBA RHy P4̋eFBA H(D0D(F ABB4 eFBA H(D0D(F ABBHX<BIB B(A0D8D 8D0A(B BBBK HSBLB B(A0A8DP 8D0A(B BBBA @PBBB B(A0A8G L$$K$Y$E$[$z$r$B$U 8D0A(B BBBD Q$K$D$A$a$J $L$D$A$K v$S$`$A$` $S$G$A$E A$I$T$A$I$N$P$N$N$A$A$I$0Te!FBB E(D0D8G 8D0A(B BBBH GTAGUB,WOBWMNEIMWBPN^B`YJGIYERAKHAEEPACGUBGUB~ILAGTAKRALLBPWA~L\A[ EB WLRBLLB(vETJ IAR A u(\HWK LFI K z(D{DQJ NFI D z0p BAD G0p  DABK 0QDJ J(H0^(A DAA4\WFED g BBF MGB4WFED g BBF MGB4HWFED g BBF MGB4ԵWFED g BBF MGB<GF K \ L OI IAD A p I N R @ ]JAG f AAF  DAA ZF d иBBB B(A0D8D@} 8F0A(B BBBC ` 8F0A(B BBBA k 8C0A(B BBBI | 8C0A(B BBBH H8F0A(B BBB BBB E(D0A8JRiGHEEEEM 8D0A(B BBBE gTVH:LFBjLQBQJBMHLEI@ I < |FEE A(D0D (D BBBE l(  BBD C(G0R (A ABBF U (A ABBE z (F ABBK T8M@GHBPI0\ BLG B(D0D8J ] K O A x 8D0A(B BBBJ    4 PH  BJG D(A0JJIA{ 0D(A BBBF  ^     P 7BJG D(A0JJOAu 0D(A BBBA ` t    ,HcH  BGB I(A0K8G@r 8D0A(B BBBJ FBB B(A0A8G L##D#d#B##O#d#A#z#M#_#E#e 8A0A(B BBBE D#M#m#A#^#G#L#G#F#A#I#[#N#M#K#K#G #M#R LFEB E(A0D8G< 8D0A(B BBBI `47FBB B(A0E8DP 8A0A(B BBBD u 8C0A(B BBBA LBEE B(A0A8J 8D0A(B BBBA 0<FAA D0a  AABG \\FJE E(A0D8G 8D0A(B BBBJ D[EBI|*^LHDiFIB B(A0A8JGGEEEEEc 8D0A(B BBBF PFAHd0 FLB H(A0H8Gpq 8D0A(B BBBF vFEE B(D0D8F@ 8F0A(B BBBI  8A0A(B BBBH HMPMXF`N@HNP[HF@H4QFBE G(D0A8D@ 8D0A(B BBBI 4FAA k DBG kAE4FDD s DBI D ABI p$FBE B(A0D8G`hNpahB` 8D0A(B BBBC hMp\hA`hMp\hA`dW+`\PFBB A(D0 (I BBBI i (A BBBH q(H GGPD9FEA T EBI U BBG F(G0V(A H,zFBB B(D0D8D@ 8D0A(B BBBC Xx FEB E(F0D8LPgXX`rXCP 8D0A(B BBBF x` 4FAD G ABK D(a0_(A Y CBE E(P0X(D A ABC \(c0P(F n(P0k(M XP$FEE B(D0D8GPEXY`rXCPX 8D0A(B BBBG L FBB B(D0D8D` 8D0A(B BBBJ XxBEE E(A0I8QP` 8D0A(B BBBG {XJ`iXAP4X%FDD N FBD FB%BIB E(A0D8G`PhNp_hJ`GhVpdhA`LhNpehB` 8A0A(B BBBE hLp[hA`= 8A0A(B BBBA [hNpNhJ`WhGpihB`vhFpihC`ahNp]hH`L`+^FBE E(D0A8K 8D0A(B BBBK L/FFB B(A0A8G= 8A0A(B BBBH x3FFB B(A0A8DpUxCexHpa 8D0A(B BBBG nxIcxHpm xZG G xZE D|X7]FBA A(D@ (A ABBG DHLP^HC@4p8FAG g DBE h DBB ,8&FAI  ABE P,9FJE A(A0G@mHLPRXA`I@k 0D(A BBBG 0;NDG AAKH L<FBB B(A0A8G 8A0A(B BBBA \>FBE E(A0A8G 8A0A(B BBBH HpAd`BfFEB I(F0F8Q~PdBhRgALI[Bm 8D0A(B BBBK 4TIB 8F0A(B BBBG m 8F0A(B BBBD DXL`YXAPI 8A0A(B BBBK pD'FBE E(A0o8M@NHEPI0O (E BBBK o (E BBBF u (E BBBH x'<rFBH A(A0Dp 0D(A BBBG HxMzxBpBxI]xEpxxN`xApx\OxApP4(@ FFB B(A0D`hWpHxBI`A 0D(B BBBI P( BPJ J(A0H8D@HKPTHA@D8A0A(B BBB(( !FEB B(D0A8DnCAH^ZKAr 8D0A(B BBBE D FF }OFISd OFIB ^ OFIE MFFOR,)EU F e K R F F|)H=FBB D(D08M@U8O@e8A0M8Z@H8D0E (A BBBF ^ (F BBBF x(F BBB`\*FEB B(D0D8I]EBSg 8A0A(B BBBG *FFEB B(A0A8GsfEEEDBEEEHAFBIW 8F0A(B BBBK L+XrFBB B(D0D8D_lVPX 8F0A(B BBBE PCFOzIA$lLHahLDJxBJFC,(, FBB H(A0D8GP 8A0A(B BBBG e 8F0A(B BBBD k 8F0A(B BBBF D 8F0A(B BBBE MXM``XFP, FBB B(A0A8DPXG`cXAPg 8F0A(B BBBF d XJ`S b 8F0A(B BBBA p8F0A(B BBB\X-"FBA A(D0 (F ABBF u (F ABBH k (F ABBJ l-<$2FBE F(A0Gp 0D(A BBBE VxY[xGpZxN\xFpxJYxAp(. ,pFBB B(A0A8G 8A0A(B BBBH j|JBDbApJNBABIX.:FEE B(A0D8GPF 8D0A(B BBBG |Xe`HXAP/p=2 FBB B(A0A8G L"( 8A0A(B BBBE "S"Z"B""F"T"A""G"t"B"^"I"L"B"]"P"\"A"X"M"^"D"X/E}FEE B(A0A8DP< 8A0A(B BBBB XI`KXAP,0IfFFE E(A0D8G 8D0A(B BBBE 6KbB WL ]TBOUHO_E\0`FFB E(D0A8Dl 8F0A(B BBBI rHA$01cAG I n AH DX1cFED B(m0B8B@I A BBH p GBG 1d"FFE E(A0D8G, 8D0A(B BBBE `qBBIAOWAaPOAL(2L^A 6X% FBB B(A0A8G L@LB/BRCJCICACIC^BBcCIBBB 8D0A(B BBBE BQC_BABmBbCRBBBBRCHCMCCCIC^BBCCJBBBBCCJCPCQBBOCUBABBeCIBABX7xFFB A(A0DZGBI 0D(A BBBB $X8̡fEAC MDKx8GFBE D(G0x (D BBBF u (D BBBA D8M@KHEPI0w (A BEBE l(D BBBT8wBBB E(A0D8DP 8D0A(B BBBG hXM`\XAPT9#FBB B(I0D8NUQBM]KA 8D0A(B BBBB  GSAyHBMXAgAXB AI GhAEcA AE p AE T:1Ot:l8:lAAG R AAA p(N0O8F@M 8:BBD A(J0b (A ABBA ;9ES H P4 ;4BEA A(D0(A ABB|X;BBE B(D0D8GJ 8D0A(B BBBG YM_DpSKDYNSA;BBE B(A0A8GDP_C^ 8A0A(B BBBF HGHFHtGHFH|MMDJ\t<BDD I  AABI xJ`CRVNOFJ<<oDEE A(D0 (A BBBC =.04=K A P=K A @l=)FBA A(G L@LD (A ABBA H=BAA G I \  DABI x N O F G =4>$> 8>cHZP>4 d>05FBB B(D0A8Gh 8D0A(B BBBC "M^BHRAOeBiECFIKXDSPOLHIA KIHAKL?H`?FBI I(A0D8GP 8A0A(B BBBH ? K A 4?l FAG u DBG f DBD L@ FBB B(A0A8G 8A0A(B BBBA (P@FED r SBJ H|@FEB B(A0A8Dp 8D0A(B BBBH ,@KTGGIW A 0@lmECP A DAB DGA,A`@AEv E `AdLtA jFEH A(D0[ (D BBBC l (D BBBA HA`+gaBB A(A08F@a8A0w (K BBBA BFG EA ,4B@\G  BE @ EK dBeE@ K QBPBBB A(A0G I  M ] F  0D(A BBBI  G H F H a G H F `  C4Hk$$Cp+EW A q A KLCjd`CaFBE A(D0J 0A(A BBBA HMdChOyACFBB B(A0A8G L@LDb 8D0A(B BBBD DTDLDADDMDMDPDMDnDRDQDAD\TD`#OFBA D(J (A ABBE \OyAMdCDP%0&FEB B(A0A8N LEHDGGGGGGGGALGBBNABAGHBApMTT^DIEFDLBIBK&TSF  8D0A(B BBBJ DIEFGLBIBKMMaBBAFFAGHAA[\FMQAHQONAINBAEIiHKBABIkGKEABIACLFRKYwWRAGLFTNQNRMBJCLFTNYLGQFLILGACDTI LGACDB iKFAMDMOLGHFFA A(Gk (D ABBG HIAG$J4T_HHLJ;BBB B(G0C8J` 8D0A(B BBBG (TH@K FFK  DBD pH$LYBBD A(Lp?xAFDHAGHIALpc (D ABBG xKbxApHO FBI E(A0A8Gu 8D0A(B BBBG v\TAmPLAXHB[nTMBJGHFTtPLBSJHDMpITR@HFH F(F0\D F IH F(I0D8C@ZD C AM I(D0D8D@DHCPZD H AM H(A04J S>FIB B(H0A8DL_GXj 8A0A(B BBBF \GJEPN_ETMBnTMANOFNWTRAENOFN$KXKR S zT LAPNDB B(A0A8D8A0A(B BBBAL$b[d^ X Mhb Mb4Mb @HMbAAJS DAD gNOFK4McmBAD n ABH iAB,McBp F G^ YHY I 4MdzBAH A ABA fAB8,NdBFD B ABG Z AEH @hNle!BBA A(G L"e (D ABBI NXgAI Fq G ,NjAC M G OrLOrBDA F(M0 (A ABBA  (A ABBA ldOuBAD D08Q@c8A0X  DABH { 8Q@T n 8Q@Q K 8Q@T  8Q@Q x 8P@P ,O@yBAD [ ABK P0zBBB B(D0A8DpxKGxAplx]LHUp^xOKFEAJpc 8A0A(B BBBJ 4PX}ADG y FAD g CAA 0P}gAHG g AAG aDAHP}BBB B(A0A8D`^ 8D0A(B BBBG HDQpBEB E(I0C8FP 8D0A(B BBBJ Q4@Q0FAA DP|  AABD   LFNF Q[H_ I \R@ECI K(K0_(C D AAA J(F0Q(A F AAF D (N0N D(N0pdRFMD A(J@SHOPNHF@X (A ABBJ bHOPUHC@l HQPWHB@LHLPY U HGPE HR,EGL M(K0_(A I AAE c(O0H(A FAA$SFEB B(A0D8FS[L 8A0A(B BBBF KBA@NdEOrA| Uo REBBBDDDDDGBBKFDFFCBV!MXBA GT l8TFHE E(D0D8GOFFRV 8A0A(B BBBE {LFFN\FDDBJW FDAF H܅hFJD F(D@ (A ABBE U(A ABB(-FFE H(A0D8J  M F F ]  L [ A   \ F B  _ q A M K ^ A h 8D0A(B BBBE D  K Q  F H A f B B B M  P Z B H&FJB B(A0A8L@U 8D0A(B BBBA `T(FBB B(G0D8GP}XM`QhOpIPFXO`PXBPBXB`bXBP^XD`GXAPYXI`]XAP 8F0A(B BBBH AXM`QhLpIPFXO`TXAPBXB`eXBPbXD`GXBPXXN`SXAPJXN`\XBPXXG`]XAPUXL`TXAPOXK`[XAP(\(+]EAG0L AAE d\-FBB E(A0A8L`hJp_hA`] 8D0A(B BBBD [h^pOhA`x1FBE E(A0A8G@F 8D0A(B BBBB HNPYHB@7HQPYHA@HGPkHA@]HOP@lh4FAA JS_G|  DABA T5FBB D(A0GRcA~ 0D(A BBBA t6+FEI B(D0C8GMULEEBBBEEEEEEBBEEBBBBBEBBEEEEBBELqMULEEEEEEEBEEEEEEEBBEEBBBBBEBBEEELQULEIySRLEEEEBBBEEBBBEEBEEEEEEBBEEBBBBBEBBEEELjMULEEEEEEBBBBEEEEEEEBBEEBBBBBEBBEEEEBBELI 8D0A(B BBBE DSRLEEEBEEBBEEEEEEEBBEEBBBBBEBBEEELkMUIBBIdSZHMULEEEBIJSRLI/MULEEEBEEBBEEBBEEEEBBBBEEEEEEEBBEEBBBBBEBBEEELSRLBBEEEEBBBEEEEEEBBEEBBBBBEBBEEEL&IbBdSRLEEBBEEEEEBEEEEEEEBBEEBBBBBEBBEEELgUIBEEEEILRBULEEEILgA HH KGfAJ DJ  GL \ HH B\ITHTA|T\qFIE H(D0D8Dp`xVQIIp 8D0A(B BBBE xMLxApxHBGIp p 4d1FBB D(D0o (D BBBE l (A DIBD V8V@H8C0b (A EBBE [ (D BBBC p (D BBBF DfFBB B(A0D8DP8A0A(B BBBDDgFEE B(D0H8I@h8A0A(B BBB4HgFDD h ABG YCBhFBB B(A0A8G L* 8A0A(B BBBE '*P*^*A**R*M*D*Q* *[*M*K*\**R*M*D*L*({`FBB B(A0A8GpLxMYxGpUxMVxBpDxDJLABIpt 8D0A(B BBBE xMUxAp, xMJ DxNZxApm xNL ܓJFDE B(A0A8J 8A0A(B BBBD I[BlLwAIIZArPUAQsAT4FHA JEmAO  AABG lFfC`ؔFBA A(DpcxBMPHFNpg (D ABBD JxTaxAp4<XFJ[GGUb EA @t0FFB D(D0O 0A(A BBBG n\ЕFBE A(A0d (A BBBF _ (C BBBH Z(A BBB0Hl D t D @PFAG M DBG b DBH QDB`FFBB B(A0A8G L@LFFBFTFAFFGFHFAFXFcFTFMFAFJ 8D0A(B BBBD JFbFOFBF| FGFHFAFO 4D FBA L@j  DBBI L|ئVBNP G(OJHFKZ (D ABBD H̗FEB B(D0A8G@ 8D0A(B BBBH |FIB B(A0A8D`hNpchA` 8D0A(B BBBE hMp\hB`hKpWhA`A hKpI C `| FBB B(D0A8GJOfB J_A H]AOZBg 8A0A(B BBBA MZAM]HptpFDE E(D0A8Dp 8A0A(B BBBE QxIhxAp 8A0A(B BBBC LrFBB B(A0D8G 8D0A(B BBBG hTFIB B(H0D8DPXK`MhNpMPB 8C0A(B BBBA BXM`YXAP8TFEA I(D0 (D ABBA 8 <$FAG w DBE H IBM eDBHd`FBB B(A0D8G` 8D0A(B BBBJ FBB B(A0D8G`hYpFhB`D 8D0A(B BBBH [hWpUhB` hMpQ DhFpMxTN`khFplhA` hWpS  hMpJ lP$FBB B(D0A8GPXM`jXAP 8C0A(B BBBD T 8F0A(B BBBE XFBB E(A0A8DZLfB;bEIIX 8D0A(B BBBA -hTMJSBUnTMdI\AhqA[ NH JWBKk[AbNVAXoEBYWAI YB wjVHrM X<X&FGE B(D0D8GM^Aj 8A0A(B BBBH ,FBB B(A0A8G L**l*Q*B**J*P*A*m 8A0A(B BBBE *P*`*B**b*U*A**T*]*A* *I*V*A**I*`**4JtE KP_ C DE ^COpFSB B(A0A8D`ohEpJxBGEEDBEQ`a 8D0A(B BBBB H,FBB E(D0D8G 8D0A(B BBBG xLFJE B(A0A8D` 8D0A(B BBBH ehJpJxJGKQ`hPpLxBBBI`hMpahA`FBB B(A0A8G L@I@ 8D0A(B BBBF S@MATAPAI@e@IASAOAO@i@GAP@A@U@KA^ADAM@r @MAE R@TAO@B@@IAOAOAS@\@HAHAHAS@| @IAOAOAE R @IAOAHAE d@RAHADAM@`@TAHADAI@e@DAHAAAS@s @FAHAAAB b @FAKAFAE J @KATAHAE \@FAHAHAnFBB B(A0A8DpxHBFBBAHBEVp 8D0A(B BBBA xHBBBBABBEVp<<:FIA D(G, (A ABBC @|HFBB A(A0D@ 0A(A BBBG FII B(D0D8LoXHhCOUFMHNABAIAB[ 8D0A(B BBBG lM`A`h FBB E(D0D8Gb 8A0A(B BBBF \ 8M0H(G IBBK \̤x FBB L(A0D8J 8D0A(B BBBA |HFA,8 FEB D(C08H@GHBPBXB`AhBpBxBI0 (A BBBI w (C BBBH u (C BBBJ b (C BBBA ĥ@FIB D(D0w8K@JHBPBXB`AhBpBxBI0] (D BBBF M8K@JHBPBXB`AhBpBxBI0+ (D BBBK r (D BBBD l 04FDD N CBG LjTĦPFEB E(D0C8KJTAPTrCh 8D0A(B BBBD nBVASB[AdIGEs[@EUcBI@FMQ A(A0G 0A(A BBBH ЧYEs H Xt4LFBB E(A0C8T  8D0A(B BBBG MTTJkMTTKh FBB B(A0D8GaLHAHAKAHDIAIAIAK^U 8A0A(B BBBD waAHAHDIAIAKXOLcAuVHIAIAKeWWLDI,@ FEE B(A0A8DJhFIHLJEAbNOJSj 8A0A(B BBBI RM_BM^CD 8A0A(B BBBF ` 8F0A(B BBBI OTAL`Bg OL MoBhMgA(&FAQ0N DBD ܪx'\FBB E(D0D8GPhXM`gXFPXM`XXBPy 8D0A(B BBBK eXN`VXGPiXL`WXAPnXK`\XFPLXM`YXDPDpD*NDH z ABI K LLE ~ CBE 8+FEA D(G0t (D ABBD +FFH B(A0I8GJSALHFKn 8A0A(B BBBF xMRRI8|-FBA A(J (A ABBA H<.dFEI B(D0A8D` 8D0A(B BBBI H`/FBB B(A0A8Dpr 8D0A(B BBBG @P41FBB D(A0G 0D(A BBBG H2FED G(G0k (C ABBH D(F ABB2kFBB B(A0A8H Q GЄ؄Dz؄AЄX 8D0A(B BBBC c؄HU؄AЄ؄KGAIЄ؄GHAUЄg؄TN؄BЄ؄I^؄BЄ؄TM؄AЄLԮ`:#FAD G0E8O@QHIPN0d  AABJ j8O@P8F0@$@;EDG S AAK ^(I0](A I AAH xh;FBB B(A0A8GZ 8C0A(B BBBE LZAZ 8A0A(B BBBF  FJD D(D0z (A ABBD i (C ABBG l(C ABBX> FJD D(D0{ (A ABBC i (C ABBG l(C ABBHxl?FHA D(G0s (F ABBH i(C ABBP?OEE D(C0O (F BBBE Q(C BBBA8 @FDD O ABH f CBA (Tp@wFDJ o DBG H@FLB B(A0I8M 8D0A(B BBBF xBLBFAA G L!j  AABG !G!H!F!I!0CUFBB B(A0A8G L@LBs 8A0A(B BBBF BLC[BABBNC[BDBcBMCZBABBNCVBBBABNCOCFCHBXxFFDA G0g8P@`8A0}8I@PHJPP0^  AABD 8G@[8A08HMFBB B(A0A8G L!| 8A0A(B BBBI !G"H"F"P!d!O"R!C!J !G"H"F"E `KFBB B(A0D8Ip 8A0A(B BBBN 8M0F(G IBB(N\SQA k,H2DX>3q$h@4hD A5KDF6IDHE7UDE8UDXF9HDH:F@K;"@MDK<UDN=&iD7O>QiDQ?HUUDpU@RDUAVjDWBj qDDo!PWCDWD Do!@XE pDxYFD0ZGFDZHpjD@[IpD0]J]YD^K FP^LcD_M, cD!_N? eD[`Oc FbPqpcDXbQpDcRFdSFdTFF eUFXfVFfW F?gX!FFiY;FXiZPFi[iFj\zFj]F`k^F@l_F m`FmaFnbFpc FFqd Fte FwfD`wg. D?P{hK D{x|i\ D}0}j1f xkrbDly xm; @ n" Fo p ȃq xr sr 8t– u H v"cDHw"Fx"FPy'  z  ` {| x|   ؉} 0~ X d* ?0 05 X;6DȋO ،– V Fe Fg"@ Fx"@ F  uD F2D*DF *DF$ 0>Q4Dh @ Xt F9DP`DDKDx WDF cD/6O pDfXYDF]DFDFD|D}D|DP F  F8 ^DNcPt dD dD F."`DxA"dDUX"FUm"BcD0"BD lDp lD lD/FY Fr"lDx"lDU0"FUh F"FU*"B FX@ DQaHn uDZ  @uD'VD xDDF p3D9DVDYD  ˀ"YD84 @C S Pt"B d"BaD"BYD cDHcDsD   YD 9D@6 $P& $9D36@AKDd_KDhYDd{YDFd@F("D>Dh>D?D?D@cD! lD1h?"B|Dp:"B|D OD` eD xD   EDX @  ED {Y @ "D F  F F F& F@ H F  D P sD  D8  3   ;   D   W q  M lDj  a$D( j'D` q  lD  {D  eDp!  eD!("  eD!"  (#  #$  x$@% ' 0% 8 (&h& A &0' R [' c (H( l ((  }h)   )(*   **   "x+   ",x+   "H,,  DX-  D-  DH.  D'.  DAH/ Q D0/ _ D[H0 m D0 { DH1 } D1 Dp2 D2  $3@3  WDh4  $44  YD55 e D6 4 F@8  | F9! g ID^q8:"  `:# J :$#"B `=%  uD@>& "BuD?' |DXA( 0 @ 0 p @ @ p `0 ^ P+ ? H E 0d pb E `R - `P P Q `b%thin-pool@a%thin fb *@rp@F*fP`*m@F*@ P P @ @  @ 0 P  @ )8)`,JCpEp*)@>*RPGDF*IILLLMMIIsd-ide@7md@loop\ramdiskhdevice-mapperqmdpdasddac960nbdidaccissubdataraiddrbdrbdHemcpowerpower2i2o_blockiseries/vdgnbdaoexvd(vdiskxps3diskAvirtblk]mmciblkextzfiomtip32xxvtmsskdscmbcachenvme@zvolVxDMPzramnoneQQudevQR&2;;@2C NUZ `m| UZ `@ N@f m+;K@Y@ @ @ @@   `@` `p0`3p8 00`0@``66Pp  0/ @`6P    P P @  `     P @ @    p     Ќ  p   `    P 0 0 0  @   ` p p 0 P      p 0      p 0 0                 agoDtodayhyesterdaytSundaySunMondayMonTuesdayTueWednesdayWedThursdayThuFridayȆFriȆSaturdayԆSatԆnoonmidnightsecond4sec4s4minuteLminLmLhourdhrdhdAM|PMdayweekmonthyearyrJanuaryJanFebruaryFebMarch Mar AprilAprMay$June0Jun0July<Jul<AugustHAugHSeptemberTSepTOctober`Oct`NovemberlNovlDecemberxDecx|drƃ΃փ &4DQ\my„τل". 5 `1 @2 ` 9 @7 N PQ p- 0P P P XW;@x :@x 00ˀӚˀۑ CۑXY Cёp8 CёYY}}iGiG&F&F/:E/:E u!D u!D[[ZZt!t!?t!F?t!Ft!&t!&t!t!}O}Ok`9 k`9 ` `       M[M[bXY ёp8 ё[[>>BB ~ ~vvuu6t6t\ U1iyi ?DM! @ 0 P Ю 0  @  Л p P @ Ш  @% %%%Е%%%%p%`%@%0%%%%%%%`%P%0% %%%Г%%%%p%`%@%0%%%%В%%%%p%P%@% %%%%%%%`%@% %%%%%%p%P%@% %%%%%%%`%@% %%%Ў%%%%`%P% %%%Ѝ%%%`%P% %%%%%%`%@% %%%%%%%p%@%0%%%%%%p%P%@% %%%%%%p%`%@% %%%%%%%`%P%0% %%%Ї%%%%p%`%@% %%%%%%%`%@% %%%%Ѕ%%%%p%`%@%0%%%%&lv_uuidLV UUID  [lv_nameLVP+ lv_full_nameLV; Plv_pathPath< lv_dm_pathDMPath= lv_parentParent@<  lv_layoutLayoutr n lv_roleRoles y lv_initial_image_syncInitImgSync 8 lv_image_syncedImgSynced` x lv_mergingMerging  lv_convertingConverting@  lv_allocation_policyAllocPol  lv_allocation_lockedAllocLock ظ lv_fixed_minorFixMin`  lv_skip_activationSkipActz 8 lv_autoactivationAutoActP{ `lv_when_fullWhenFull@  lv_activeActive0  lv_active_locallyActLocal@  lv_active_remotelyActRemote2 ع lv_active_exclusivelyActExclt  |lv_majorMaj ( lv_minorMin `@lv_read_aheadRahead Z @lv_sizeLSize`P Λ@lv_metadata_sizeMSize n  seg_count#Seg`^ originOrigin > &origin_uuidOrigin UUID> @@origin_sizeOSize`S  lv_ancestorsAncestorsF  lv_full_ancestorsFAncestors`H  lv_descendantsDescendantsI @ lv_full_descendantsFDescendants`K  raid_mismatch_countMismatches` ȼ raid_sync_actionSyncAction  raid_write_behindWBehind^ @ raid_min_recovery_rateMinSyncP_  raid_max_recovery_rateMaxSync_ н raidintegritymodeIntegModePj  raidintegrityblocksizeIntegBlkSizepl  integritymismatchesIntegMismatches0m move_pvMoveL 8&move_pv_uuidMove UUIDM xconvert_lvConvert: &convert_lv_uuidConvert UUID: mirror_logLogp3 @&mirror_log_uuidLog UUID4 xdata_lvData4 &data_lv_uuidData UUID5 metadata_lvMeta`6 P&metadata_lv_uuidMeta UUID7 pool_lvPool7 &pool_lv_uuidPool UUID8 (lv_tagsLV Tags 1lv_profileLProfile  lv_lockargsLLockArgs lv_timeCTimeo lv_time_removedRTimeo  lv_hostHost (lv_modulesModules P lv_historicalHistorical{ ? writecache_block_sizeWCacheBlkSize` \ lv_kernel_majorKMajP  lv_kernel_minorKMin @lv_kernel_read_aheadKRahead`Z lv_permissionsLPerms v lv_suspendedSuspended  lv_live_tableLiveTable @ lv_inactive_tableInactiveTable h lv_device_openDevOpenw data_percentData%g snap_percentSnap%`g metadata_percentMeta% h copy_percentCpy%Synch psync_percentCpy%Synch p cache_total_blocksCacheTotalBlocks  cache_used_blocksCacheUsedBlocks` ̜ cache_dirty_blocksCacheDirtyBlocks ߜ cache_read_hitsCacheReadHits  cache_read_missesCacheReadMisses  cache_write_hitsCacheWriteHits`  cache_write_missesCacheWriteMisses )kernel_cache_settingsKCacheSettings kernel_cache_policyKCachePolicyp = kernel_metadata_formatKMFmt lv_health_statusHealth` Z kernel_discardsKDiscards @ lv_check_neededCheckNeededy x lv_merge_failedMergeFailed l lv_snapshot_invalidSnapInvalid vdo_operating_modeVDOOperatingModeP vdo_compression_stateVDOCompressionState  vdo_index_stateVDOIndexState` @ vdo_used_sizeVDOUsedSizeQ x vdo_saving_percentVDOSaving%0a  writecache_total_blocksWCacheTotalBlocks  writecache_free_blocksWCacheFreeBlocks  writecache_writeback_blocksWCacheWritebackBlocks`  writecache_errorWCacheErrors  lv_attrAttrP pv_fmtFmt` ڝ&pv_uuidPV UUID [@dev_sizeDevSize0f  pv_namePV  pv_majorMaj  pv_minorMinp @ pv_mda_freePMdaFreeU P@ pv_mda_sizePMdaSizePV  pv_ext_vsnPExtVsn] @@pe_start1st PEN @@pv_sizePSizeT 9@@pv_freePFree@e @@pv_usedUsedpT @@pv_attrAttr0- @ pv_allocatableAllocatable x@ pv_exportedExportedp @ pv_missingMissing @ pv_pe_countPEZ @ pv_pe_alloc_countAllocZ @pv_tagsPV Tags 1@ pv_mda_count#PMdaf P@ pv_mda_used_count#PMdaUse0g @@pv_ba_startBA StartN @@pv_ba_sizeBA SizeN @ pv_in_usePInUse. V@ pv_duplicateDuplicate 8@pv_device_idDeviceIDp i@ pv_device_id_typeDeviceIDTypeq `vg_fmtFmt` ڝ&vg_uuidVG UUID [vg_nameVGp vg_attrAttr/  vg_permissionsVPerms0  vg_extendableExtendableP  vg_exportedExported  vg_autoactivationAutoActp  vg_partialPartial Ş vg_allocation_policyAllocPol ۞ vg_clusteredClustered  vg_sharedShared2 @vg_sizeVSizeQ @vg_freeVFree0U vg_sysidSYS ID  vg_systemidSystem ID vg_lock_typeLockType 8 vg_lock_argsVLockArgs `@vg_extent_sizeExtX  vg_extent_count#ExtZ  vg_free_countFreeZ  max_lvMaxLVZ  max_pvMaxPVZ  pv_count#PVZ  vg_missing_pv_count#PV Missingp] X lv_count#LV^ 3 snap_count#SN^ B (vg_seqnoSeqZ  vg_tagsVG Tags 1vg_profileVProfile@  vg_mda_count#VMda\  vg_mda_used_count#VMdaUse\ @ vg_mda_freeVMdaFreeW P@ vg_mda_sizeVMdaSize W  vg_mda_copies#VMdaCps0] segtypeType` W stripes#StrZ  data_stripes#DStrZ (@reshape_lenRSizeb X reshape_len_leRSizeb  data_copies#Cpy0[ k data_offsetDOffd  new_data_offsetNOffpc  parity_chunks#Parp[ (@8stripe_sizeStripeX P@region_sizeRegionX @chunk_sizeChunkR  thin_count#Thins`` (discardsDiscards h cache_metadata_formatCMFmtP  cache_modeCacheMode`  zeroZero0x  transaction_idTransId  thin_idThIdP\ p@seg_startStartQ  seg_start_peStartZ @seg_sizeSSize@R (@seg_size_peSSize@\ Pseg_tagsSeg Tags 1 seg_pe_rangesPE Ranges x seg_le_rangesLE Ranges` seg_metadata_le_rangesMetadata LE Ranges @devicesDevices  metadata_devicesMetadata Devs` seg_monitorMonitora  cache_policyCachePolicyp @ cache_settingsCacheSettings@ p integrity_settingsIntegSettings  vdo_compressionVDOCompressionp|  vdo_deduplicationVDODeduplicationp}  vdo_minimum_io_sizeVDOMinimumIOSize` @vdo_block_map_cache_sizeVDOBlockMapCacheSize  vdo_block_map_era_lengthVDOBlockMapEraLength H vdo_use_sparse_indexVDOSparseIndexp @vdo_index_memory_sizeVDOIndexMemorySize p@ vdo_slab_sizeVDOSlabSize  vdo_ack_threadsVDOAckThreads`  vdo_bio_threadsVDOBioThreads  vdo_bio_rotationVDOBioRotation`  vdo_cpu_threadsVDOCPUThreads  vdo_hash_zone_threadsVDOHashZoneThreads` H vdo_logical_threadsVDOLogicalThreads p vdo_physical_threadsVDOPhysicalThreads`  vdo_max_discardVDOMaxDiscard @ vdo_header_sizeVDOHeaderSize  vdo_use_metadata_hintsVDOMetadataHintsp~ 0vdo_write_policyVDOWritePolicy` h pvseg_startStartZ  pvseg_sizeSSizeZ ǟdevtype_nameDevType  devtype_max_partitionsMaxParts  devtype_descriptionDescriptionp  log_seq_numSeqZ log_typeLogTypep log_contextContextp log_object_typeObjTypep 1 log_object_nameObjNamep F(log_object_idObjIDp [0log_object_groupObjGrpp n8log_object_group_idObjGrpIDp @log_messageMsgp  Hlog_errnoErrno  Llog_ret_codeRetCode 6 p  Ѡ ՠѠ Ѡ `Ѡ @  ! 7hЀ Nf mz Ʃ! ¸,B@,PB ,0 Bp, B'@&;@1BZ,` Bt,pQ@šbp@ ,К&` b@@ -P ,B ! KX-0 0  3 -: -@-@C L @kd E@a|(.&`| X.& . .  . / @/*ix/ /   /.!  ""  B# 0`B$P0`B%^p0B&" 0p&'. 00 (; 0@)D 1$*I @1+S pi,i h10&-s 1.| 1L/ 1P0  1 2p2   3 H2P4 2p5 `6  7- 2&81 8 &9U 2:] NonePa BoolNumbere SNumber q PNumberPt Uint32PStringPVGPLVPPV `Tag Select P{ ActivationMode  Active ` CacheMetadataFormatP 3CacheMode  Discards MirrorLog  SizeKB SSizeKB SizeMBp SSizeMB PSizeMB NSizeMBP RegionSize P& Extents SExtents# PExtents6 NExtentsI Permission pMetadataType PH3Units x3SegType 3Alloc!N LockType"_ Readahead # p MetadataCopiesVG$P! MetadataCopiesPV%!sunused&4PollOp'` WriteMostlyPV ( SyncAction )P ReportFmt * ConfigReport +p04ConfigType ,`4RepairType -4DumpType. HeadingsType /] ConstString 0] ConstNumber 12``` 2P2 ` 2 helpHelpP} ?HelpP}sd-ide@7md@loop\ramdiskhdevice-mapperqmdpdasddac960nbdidaccissubdataraiddrbdrbdHemcpowerpower2i2o_blockiseries/vdgnbdaoexvd(vdiskxps3diskAvirtblk]mmciblkextzfiomtip32xxvtmsskdscmbcachenvme@zvolVxDMPzram`p"0P pKg#.O Ђ  { P{  z{ {`:}@~@` HGI0jp i`k``Z%$@" 'P3(((p"$p"'"&#"#!",- 0#)`#%`#$NN`0p*0+p3.4`/`r` qJK \ L ] M X ^ (  @`!& selectedSelectedH> helpHelpP} ?HelpP} o jo  : |! l+! u! ! > ! `> ! (? o_ `? ! ? 8 ? ! ? 9(@ ! X@ z @ H c x        P t % %o8  ((&(3-  o*ooo+oo(o %&0P@PPP`PpPPPPPPPPPQQ Q0Q@QPQ`QpQQQQQQQQQRR R0R@RPR`RpRRRRRRRRRSS S0S@SPS`SpSSSSSSSSSTT T0T@TPT`TpTTTTTTTTTUU U0U@UPU`UpUUUUUUUUUVV V0V@VPV`VpVVVVVVVVVWW W0W@WPW`WpWWWWWWWWWXX X0X@XPX`XpXXXXXXXXXYY Y0Y@YPY`YpYYYYYYYYYZZ Z0Z@ZPZ`ZpZZZZZZZZZ[[ [0[@[P[`[p[[[[[[[[[\\ \0\@\P\`\p\\\\\\\\\]] ]0]@]P]`]p]]]]]]]]]^^ ^0^@^P^`^p^^^^^^^/sys/@@&@@&P@&P@&`@&`@&` @&@& LVM-/dev/mappernone SIGINTSIGTERM8V&8V&HV&HV& V&`W&`W&W&W&W&W&W&W& X& X&X&X&Y&Y&Y&Y& Y& Y&0Y&0Y&`&`͖`\&Y&XZ&XZ&Z&Z&\&\& ]& ]&0]&0]&@]&@]&P]&P]&]&]& V&^&^&^&^&^&^&^&^&liblvm2cmd.so.2.03-2.03.32-2.el9_7.1.x86_64.debugw7zXZִF!t/oI]?Eh=ڊ2NrU,`>D|pzBp̘x? 7q,EagtjC [VZbLR6>fXR^0P|1T e;n Jq]nC1#vL"dEmRC S|b{Ŝ,\R;lK_״$%~)K^ 'P,e )ڃVL)i>2Ԓ::-xzdj7˛Xo&a:,g`x6H?Us8wεO~ DNL MX;z$rԁMU1ueUE4һ.-{xy!@RހS :߀O!_&/}Y7ḙNq҉8m\|\Ikjb,kVM=]< E3B',X ۵lGu7ރ <DVނ1Mϳ7:Xx2݄$D-@0qnUښṗo8c WMVXn&~1qfz3@@V2r@ ='o aOJAAV8 B;YeӜ|>@i^y }p a6ҝ GyKP,ed- b=fg$q*ܓ&`HfMR *M4 Y#S5&rAQ<x!i\d^@F+GPl`,zI%ӧ26Ls&d| %qƩlMĀ B(oZu3}r.R*Jm^lᷳ\?GX@!p%VJ-l-{:uq`/WG0 z/߯PalB 0;!b%jLAj`ӫjLZmw _ل} Y)4E'vx lweH𿔹(d -g{86=7YGnxH6^+ 0L}!|E(/9Aa~MX ,HbAV "(_QQz^ sf(bCf6; K#)r!; 7q94)9IPyz;> )x1_ Dc\>V@>IAoiLt)qnuִ#87 FK`0d+c$-n `l X&5Ƥt QOK?CY,1T\k$,vD#_Dc_Oppvo/{j%f \cfV47~%`o#EI>Ѹ Q" iw_>ә`F΂ {V@~6t94;vY(Pu}%A_P)-ݣHG#X]ׂN?|L$eݜ,#=QޙXu1Z9XRPLTA"xIl͊KdE `4s3x~;#) LW⤯ǵK;ٲ` ۔>l,+[5mF>YHGC{ۗV|aݱdOɋGP, E2zWy!{"]og2LH4DXI!CCbҊVeH:C9FgC].&ɺ`rҏE]NM>-GаT(|{M Z,{SYt3Q+,L2)lzz26ʌj/c¼,^?IG_]FxF4oYR? @f’YeBħ:1UߤC)vo8N"A> n*!XXR2[eTENB>B)TM1o)xD .E%nWARl|o%{r-փs__+ܞǻ?܃ y0`$"r^ml)h^-'+Ws?%M6BCa\ڣX,*Õ$|w5TT'eJNx`} IF\ $,^4)[w{6G[\jkL%f0RJ?aĭ@C(H]Z 67̈*pEzַrGkޓ!PԫBSԸTq\G%#LtJ}Q]48B{7ɽ]`G &f 4<(MX";0fSh9X>Wu0SlcJ/k<ʍfM@yB,Oz<ڶZh'{:U[^ F\Lb|I_wpQȄ*xfSgDLa V~4`~ zo=MgK>a(!pt.o{E-G~O#2l"Vbƴp[:QI8D[s81U+kDvmZ8NFKqx3@ce#Qf=["*5Ԫ'SmVn7/A1r6|mA0B29ya2$m7o82kP0“VF)N  /`JR:mS˩&`P]6wdVAXjmrGf }/v^2z 1L%qk5a! | Eanl.#NF%+pc$˥l"(UKD< ,`T97a SYC~'{mbPd i;r4c;aE՜iµE#|~~~:Dfnb?~S)vХ &aYP0Goћ㟶V۸voOB1=: A.Xy*ZĨ @_,iCc B ۳3Q}vlKck/7kԉt"Š:[n;>3i_z?Df=;"/ܖ&GOIbm3*"+[h;mSזߗXggw@ףe}ݢEԭ&`X?(q: 'ǯq)_ފ;,JEZQr,(mq~Hÿ8f>e|jvThn ߁+ ߷' O,tܕxT6 ~(Ї/)-J°ܵpO\y;Vz[֓-S}Nax\vɖUoPd)9 lPr+lِ_p$CLJPUDG#@~}Q Q8dK}Yg{AV$X h<hje@Ok-|jc r.\ |bTw%A|O@ͫ+i6:j9'`0셳aIm뜶U t+Y~2-ɝy ÐtND />n-pQGa@GGg0'o8TK?p;N%PAYߊwŗ:"]$TSc|BRZ嚾I3K.N=۸(#܌nK?n8XCĐ`5t@W>Ͳgs=5>ZW?DaG!3}> z%;\0KMR GA9;Y",E޽`XSn*P;31M Uޔ$D8m4b9ՑR݈ /5{T",na-&jqW;0i8i"e<)sR^O{R u "L#,ǀ_[09_ ;gWjl}Z*8꤅W|ExG"'Y>:ȥS:)lws$OlLH<JF&T,͏C`̏8FZ}};<'Z~vtd)b3]PٕRn55PrZo Y_P\la%cf/mǩP% 2L䅎CAC쵑rz(N[ =L; ێe~' +as*[CD=!w 0+X.rE^4N2uGcbZ kaZ\|neгnua1@ a  mߚ4=o!Q,ԅܤoi N@K qrD*Z:ǐYRmo }!Sȶ>n}Ra?u !k-a^T[AShÀ~ch]%)ralKe 9rgef'+@u^-ڇsܓop|fGqW]s'$7=ʼlhPy@t<Ňu<@hZ4C]P np]e:c;a{DA_b0\Dk'kͽj(z]Nq\*B+ncV䃤&vaU V;u]kRX|n1$W W](W)A}4@^LO.\: ?M"E_Z݇||L7u-AZ^ݮw8gA(F2l3 )'\<acJC>[Bn{dqxX&2?`ɅjAA]د]Gݑ |9-+U?^9[VUv`LNZJo͖ȭ>-l"k^o-.,kS` x(\hA;0ԳMg֘bkZuލS5Ϧ<*@ٞs#x3/%ؠ'ډ;M!V:"uWdF^~) '-TL)7,O6Zϯm]B /z( jޱ"6A|CsEդv5QZvKTGdO4o)@y/iꃂٺ&Zw֒?i=: (wR$DWlz&fm,,8Lv@ghI)k& lw)'찓3Iyq I/<_VA63~^V%d XFב5AX,ZJpO0)l]]ypiubzc@Қk>EjLZU,nnm P)VLDzMM;,yIr苝%p60_rkGV4ޖimf f2\j20UKQwWϮΜ#z ̭O7F? F.V0S~i&ڮ.wh-tUc=|+7&,OpM><<°]4 hfP~K7ª=@Y)ҐZHPR5xT]NWy2CB*\2 ]1Xk3I<נ;uB̫$V(m*\5EYL9Ȫf"Bjhi߂,~ikS>j5:yd~8,6UUbmxV|Z4B-П6jTj,&5|9cmo !|2f5gC~};U5o p 3?i#"rb{MWTLv,z"+i4Œ(6k\d'ۅ'KpHYE;פ;.mmwh\ۧe{H ЈB0wmx&A]E7y \WEXwPxn`^!>Wx궃CHi,Mv/l@t#q{Fl WRtg{ƀmĦjB<}0𺤄pxZOB?7l2H,|1IT)_S- 갆QUDi==L4#}O;H2r`7uU$-6,-n"D1 B-xU?CDYi"eu(YFGR9,c3l\um,s)/X{  ]> 'nCzQ*4BݼRftj^)vq0 6͜Hk35̧d]^m@Frw/3\<+GrS (Л "4 RgD ƪ/.ÀdUs+S oM!m+uc[F+T+DPd9 >g\0 Kevw`Bͦ jQ֕bϻ9p\j-gW &ۤ>3˦ٌ3ą)(/TA:0˱3]JM a7 fwC ᣘ왽#:Gt>@Dvm= ?Q h$h`~k(}q\ʪVsze<(ql=$ &eNUȅÊ֌oT=12<ʜ;) Ӊ^\$d6Xu3?ѡB\QàNåzXq-='m&+=}pA]]`S8b}#W{T<#Mf,Wh ,j@M,#'K)[h|؄k⟂̩{sԏʦTY4sUXH@؏c ku&#g +ߍXIX\)oFjl788gW{8O)H\:wrq4NYzORu3hq8aȐ* s/6aZG@\e9J `rvy_V0t<ژĒId{))!7L nk-y6kcɵܵ^cD/q쥭WAMKBqR͛+sYPv)t9&V~a7,iy{>u1 " Zs٥)wKp6f!Nӫ) (%E[X RˆM6< u7 dSJAWd;ItB4uW1;x GhI_;uʯ=d:CUe*>HYu5q!H~p9?mС p.D]@ݓt5aM֠5>V;k QZX2E@Rbs| 8cHe6Yp8>UL>_/L܁/4 ^;jeEh8ׅ _ޯS_4it1Z˾`wf嫒NrbV)^|D^@ \yZߚL,ҋ9Dc$bqoŸ, Ҫj뢽;,"p:΂{Mټd񉶰*DٳO)Lfs&ե({-[ u Gu&EaL۞C`<(âL ^.J4F5[9xXvC~1I9];Fqֳcy#֕}!cYKt`DS.ka &1+;Qk):11ɋ:pL>#(H.L;aƸ{t BVLJn$jع}JCzq^_g_jmaVg:*LZnFU#3p\ \J퍩=/C37`EJIgg|,k!#0t=c} 4`sieHpJpcv pZL1wrl(nZ"3"$<6 ^\wV/ _Ha_gWEvCDI gUZ03X<$YʄW :fQdR47 LI 6K}/ %W肱w(˓1j}nϨyaO쿉bNMj*-STr=َ7^nAѫ}}9! ˢ% Ј#,UƝ倒\9~L͹?:Dh)P e ㋑erԮ͋MeD>'(I!͒sSSkwy(ƦW˓Fa[ܬvhh QxonI[*hDL =OG Sę$34/MȀ_)[]FJrk>^4>A7åy-w447O"m!-(2vT:rQBuGB/%4_բqLa@}B6poK#=Q T8tm?5|$:DXa*Tom{bev`% fgǣW[]u#HV9P$]4gWoJw/hʊ&1*L#jgLQ ث#8^%gHN-V`JZ۽|k W/M6jai/nE4| .<5Zɵ24?ȩ[t+J'e͖ON ➽TW)nˏ" }sގc \ ?`+ԪL r S .\~\p౐K`0R#B‹{/|9K!M૫ R湩hoT^1s&RKhK+~wH|EYl{̲reX/ީ7th5ynkvFh<ơP h8;ikY jAb(^ǸP{ǂb-ęR4q&E˿Eud ٽ2|?_1]$(C:Ăqc4yYχ22H;gVy]a}qs \O&7mG@ʯHZ@` 97Nof/yk1v) ?s눱yD'`AkC8B҉2%g,JBxGI+SiJ#e2SP0 }- w@S] \.C;1,IydxR"ȊJBɁz<5BtiFH7T!FRCRF\DhT{m5arO p 0Agmݡ rrw9F씝A>D>%0I*F+ҙ6?1k Љ<ͤ;- `(DlDpX TFPqrU7¡nAEn'-A]lY^Y1jA'cD󀦄#H'tJ~n݃<ƯŅbJ=xa׍\^kۯvS&lPZE4<`@){$ƈVCn߿n-ǵZl1w~s/V~yD|g}h8 ;Wt" 1B ͏@e; DS јq@ .L'QDVEKI~DB<h2Uo@DE"#aKVZwi\^Oe!|#[HoOsY9;^2s0<`≠KtN\eH[1M|%i&Orf PZ%Zvkؙ7"y?ҋeh*/km7/;5wa}Q,N ؼ27*lATEեpDɌq1Ͽg=7$Wɹ;skjвk) \_^@$GtP0, 8ÅS0 b=o|=c0ҭH`Jʮysϣ>:%"S&㋓-P=9z)t@{@~^9\wo7Xl5AҼqO QbI2aq!bU]N_Sf%SnQ%$&M8Tv^e(J_=MNHEa{tE^l"LDlB&vV^6J>ynQ8кJ׳›1tP0Uk \[뭐}tw t% og2tanY#SCj߭tލ\+)L|} U /f{ƞ1\+fi't|J| K/N|6TvCP"H i|HMxDcyg?>CqHtbʽc(y;U퉼imY zQܱ4jdvf/+85vҿ,zGS-7AYa7ʑRK b!|^*H9?H[\1y^˵ ק L<}NL v4'l$WydZOi{[.޾ĝjWg_0Wg/Tg̱vɗTh2Z,$^ӄ/>55j>!q"npk/̀'b8.<Ё \<[WY~5x:+TF7XW |I;jY²J6Ib0}BBe@S1&:"E\9Qq`Q Ϟ#2_QWs:7t}&jZE Pe?vg_3򶵡zf -J&š$6}dO-緭ƚa+ 643+NGo~61hbNcPv77Elf 6_w3 A0y)2zjLAg=AmZ =m& : =RG S16 ͹M4S{{=K4u.vs>PS.A*z D]#eMZ0HW'no=.d!hM K.̤yS1[EGׅٗ|,rI&R /굣9=yZ=m<8h(Dm1JinI|3cXcP'P Cs7~NDE[22 'n<@ܡ^в. }E&^D/=zE5]ۗ`c#\lDag&=z5ÅK3ǽm((_gC K"q*=J+JX!$9 bΛySlA:*Cjj04(4uD#Wo 7U _UY+l~DxVхUȅNG-}5T:F(2Z>iלU3S1C0R1m=н_P8pТ=AY.6~b!RFg%L\ix_nze',][7sfӺҜpH@F׸Sf*)xA}gAa^ \*BKLOGn/Εu+MHi \!0niAFg?#Bd/Y-f242ɘG?+i;S &iK"PFT0D8}kQ4{ҫCDɿo28S Qö+hHCD݄mRa|Nwŋq7'ؿ^]GQ@{ڨ樗b{ ڿ9bEDE'O#zzɄ0Ϋ3n>Y$9Сz5vjOsZoX+Q &GNT|0J1l(B^Gu`MBGb%IZ,78"n{EC{m}֢@ޘ a8ʚlI(ۃՎ$,_y_tg΅eTOap]t-D~՘Sm(< $.{$ r3Œ1%:ݱr]UQ#u{ʼn+.O{rdcwѹ7'pF8e?`prM3)jl+ld!EɒэdaJs AlOzջɟ(!#UT g A;U o@o>+KY޻w"OmBKaN9@7cINiNt +I#j}Tɘ8 _Ԣ0ҳ J&Onft!/聩\֓ňdoTeAˡ\Oq剔 E5"y9 'Oɝ5"iv+$Iq''LE-Bs?@ $9 7pT6YB4@+*)lXNVB20ql!o {5>oGƐ_1L?CÅJ+wd/1RGx^f۞Ln*2Fkn1V@h̀YSE@W6r.M3ﺡ+oBJ,:}i;P35WtsMUv_h0S_Ϙs7[ct$@h#XD434Rdw̩ h@ -k?bXGG|)Ĥ<25F6QOJ`ctIٝfE69|JuއټL{bwrԕSY.$tpTƇ&E$n+^r9|L;@I){T z崗 }#tLÏ{+ E5}J P'"v*yZ&dBJ\,}m}kPV*3|k5kOZv1N#+mݫ+v h|& $.]*i͌+3^d{kɥ\tj/r 6~Z+/nղFL9sփalH2i {PT>}zscCRMܖCԸihNyɟMfo[;'I +)iPGSE=v0'(PyKϏQlz=8Rv+=X)VH>kQA(<~f94[ݼ5E]ҋzkEp ZHip )L_JEm#ǔjѿ? EK3gyCV8ȅ+e9X-K!YINޫSPxe=?F7P_ 0Miy`dmC{D`_`+sKOUֱV[L]0Tߥ{SnLf>4M2E'vڏC!*wqa1\T7\`"X #s}Gϡf3gơYj 8/ߜ,B^hI(9՚.6i65I= #`=re'~VE#^$e25dDZH0^B};xL|:qet{7j"So X05r;ƩZGAnP s/<&)"n]B{Du aϚAEJw|WiXdt0|uh,4Ȁr D JɴK:?v9x.WE:!vfTLDھ'(E5[ xxA ]6#z9_OXBj FDZP߁4 T1Be`nJ=R!BValo%j׿u`hp:x 9k5~` (܅λ):7Mh1$ƕ+m/dJ$Jcwcည7W\z ,`Pu ZQ~ Wԇ4wT?D镋* у*_ǒ$6x ,d{G@炢1x DQ=thlB@Sij;:iW$:bSoD psw=ӭWCT+ڗ~onubcmȪ+m9Ue`{tpW_ZU0Q|,0BRZXzo5sfUzKQ,Ê ?>XjVu {Wzˋ  ڣR%. {$R\ny+_֣ZSk|RGυB/Đyk)q\9c{Ӣs5KJY-kh1X ܗ8YpKҪYkDF R a\ @& :/%/m7bDdwF |udjt?}\tR)?M_uV_Γ,MJ ȜxuNTd B8K\:5OKeUj{3gJ6܁s8e~aǡɴ7 YX;!_h ߼O!{& >jˡGh%7m#0Y DMM:HE4znPs8"%Qk**8`T/8ӱb ,fIe`jNw#?xJBު-$@@$lUZRRz-">kZ+!]Y2nXu (BڼßB8"ܳf5*:|CYd2cOfF#lf}Yg:%y>>bbF `q W{ T)"w-,BGL-'͟BsO6n%EdYg+s@N]RNVZaTWRInD"C>|Fb+ vr:=caG]1aU4m^^Xrl.%R7t9S8?*}g<).zW-sV^sh BVnO?Klk,v6O 6\G^7KBrxo#=nôAqFD~R:3 +2.h&^'`J20zB2Lnn(ZX,q2ӯ2 .$32ڶlGy(pޙ-WIBlUW#4 8+niwHHٜ 2 2Qк~]5 +s ~뭏ڑVr }2-$^)X(q$ 07 e'|vW(o*A3vtBav*{OpRJ "el3#c Qxlr^ӊ O9 ༀ̃lpxybH1_̞c [[bՇG!]1Xm͛ &saz{rshܫL'ٗ {խЄ2T)C仌RA!8_YD|@9 ;޲י@0_4ޑi8[VcJ|c6]jXx?`}cY]p}tq|64w P|ijöp}'sKUHE“7z [6zP eb@>Q`/t9I C\! Exo^q f)4@qDL.\)b7l8SjR4 2tfS$cd2hp$Zl QbY}] p|8z=9vF~HEV~eϓ "ܓ&א:QQ܇ ON "j_S͡8-i8ai2 '4>A=Z2pf"~`TqEBrD@9clyJ;-}OfLY܀KMq'/aQEi7!ۄD1N ե> }f!\MugZZlCxp{-v#vBz6 5_si̟uBgZcĤ`TF$ٸ=jE#T)*U:$hb5g :B0zgښߦپդKR|_%4p8J0RˆVFFV\ᔦS7~uISteO>xeڽrO|meϲ⌌EJL12wcE =0~b( w&/hΙC#贛T+oE5E{'ue/_hFJXD, \.;|{1F8 g=b7~1/r 7Ѐ^u`B*|#< 2͆2Mԣx2F$/RˇO\6QBKEp%?#a{Lyȑ&՜=lV*+Vl(/ w[kT r ºxK@hjpw. Ykpfj¸{Hr'`)? 1)x uH>hY2q1b^ano`VGy|Hz%d&ym 5s]V=olS6O-29g„tgp%4T5ExbHMHС4,:y̽qy^~yjv b~2cwhl>a 7z՟qlBe;qc}ϸ ѷDYgYZ.shstrtab.note.gnu.property.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_d.gnu.version_r.rela.dyn.rela.plt.init.plt.sec.text.fini.rodata.eh_frame_hdr.eh_frame.init_array.fini_array.data.rel.ro.dynamic.got.data.bss.gnu_debuglink.gnu_debugdata  $1oD; 88CKo((Xo**8go++v-- B(3(3PP P P^^mmltt  !!dK8"8" %$ %$%$ %&&((&(&0& &`/ `_&`O& `O&8O&o$&!